F450127

General Info

Members Datasets Scaffolds Average Seq Length
468 264 468 276

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0031182|Ga0501076_0031182_1653_2501
Length 268
Sequence MKLLVTGAAGMLGRDVMLAAGNAGHDVVGFGRAELDITDPAVLERKLGLERPDVVINCAAWTDVDGAEEAEEAAFAVNGATVVHVSTDYVFDGAKGAPYVESDQPAPLSAYGRTKLAGEEAVAAANKRHFIVRSAGLFGIGGNNFVETMLQLAATRSEVLVVRDQIGSPTYTWHLAYGLVRLIEGLEYGIHHMAAAGQCSWYEFAREIFELAEVDCKVLSVTTAEFGRPAARPPFSALTSQREHAIRLPVWRDGLAAYLSQRKAEREE

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
124 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
125 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
126 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
127 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
130 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
131 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
132 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
133 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
134 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
135 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
141 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
194 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
216 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
217 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
218 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
219 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
220 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
221 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
222 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
254 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
255 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
258 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
259 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
260 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
261 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
262 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.28
Nodule 0
Rhizoplane 11.32
Rhizosphere 81.84
Stem 0
Stem Tuber 0
Unclassified 5.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000342 3300001977 Bacteria 6727
2 JGI24740J21852_10002918 3300001979 Bacteria 7622
3 JGI24748J21848_1000384 3300002074 Bacteria 5014
4 JGI24034J26672_10000353 3300002239 Bacteria 5993
5 rootH2_10175980 3300003320 Bacteria 1156
6 Ga0070658_10039587 3300005327 Bacteria 3803
7 Ga0070683_100000207 3300005329 Bacteria 39723
8 Ga0070683_100031889 3300005329 Bacteria 4795
9 Ga0070683_100145395 3300005329 Bacteria 2246
10 Ga0070683_100293409 3300005329 Bacteria 1547
11 Ga0070690_100101432 3300005330 Bacteria 1909
12 Ga0070670_100093250 3300005331 Bacteria 2590
13 Ga0070677_10000019 3300005333 Bacteria 50177
14 Ga0070666_10012209 3300005335 Bacteria 5412
15 Ga0070666_10021591 3300005335 Bacteria 4174
16 Ga0070680_100537719 3300005336 Bacteria 1001
17 Ga0070682_100000038 3300005337 Bacteria 145670
18 Ga0070682_100000040 3300005337 Bacteria 143944
19 Ga0070682_100146084 3300005337 Bacteria 1617
20 Ga0068868_100000175 3300005338 Bacteria 42576
21 Ga0068868_100002533 3300005338 Bacteria 12693
22 Ga0070691_10000098 3300005341 Bacteria 25336
23 Ga0070691_10007033 3300005341 Bacteria 5158
24 Ga0070661_100000052 3300005344 Bacteria 89458
25 Ga0070668_100506305 3300005347 Bacteria 1046
26 Ga0070675_100000008 3300005354 Bacteria 250004
27 Ga0070671_100108004 3300005355 Bacteria 2337
28 Ga0070674_100000016 3300005356 Bacteria 91058
29 Ga0070674_100000105 3300005356 Bacteria 39263
30 Ga0070673_100004686 3300005364 Bacteria 8679
31 Ga0070688_100000151 3300005365 Bacteria 37674
32 Ga0070688_100000258 3300005365 Bacteria 27791
33 Ga0070667_100026099 3300005367 Bacteria 4858
34 Ga0070714_100210561 3300005435 Bacteria 1782
35 Ga0070713_100000055 3300005436 Bacteria 70759
36 Ga0070700_100011612 3300005441 Bacteria 4883
37 Ga0070700_100052817 3300005441 Bacteria 2535
38 Ga0070663_100000101 3300005455 Bacteria 39196
39 Ga0070678_100332482 3300005456 Bacteria 1301
40 Ga0070662_100000015 3300005457 Bacteria 109379
41 Ga0070685_10000092 3300005466 Bacteria 55484
42 Ga0070685_10000360 3300005466 Bacteria 27792
43 Ga0070679_100000156 3300005530 Bacteria 55265
44 Ga0070679_100000784 3300005530 Bacteria 27643
45 Ga0070679_100282042 3300005530 Bacteria 1614
46 Ga0070684_100001385 3300005535 Bacteria 17404
47 Ga0070684_100020009 3300005535 Bacteria 5547
48 Ga0070684_100021991 3300005535 Bacteria 5314
49 Ga0070684_100044565 3300005535 Bacteria 3838
50 Ga0070684_100412264 3300005535 Bacteria 1246
51 Ga0068853_100022191 3300005539 Bacteria 5299
52 Ga0070672_100000036 3300005543 Bacteria 59645
53 Ga0070686_100124532 3300005544 Bacteria 1774
54 Ga0070695_100295246 3300005545 Bacteria 1196
55 Ga0070693_100003601 3300005547 Bacteria 7234
56 Ga0070665_100000128 3300005548 Bacteria 142568
57 Ga0070665_100002491 3300005548 Bacteria 20261
58 Ga0070665_100070049 3300005548 Bacteria 3513
59 Ga0070665_100309719 3300005548 Bacteria 1582
60 Ga0070664_100005631 3300005564 Bacteria 10084
61 Ga0068854_100000123 3300005578 Bacteria 53446
62 Ga0068856_100003489 3300005614 Bacteria 15873
63 Ga0068856_100036766 3300005614 Bacteria 4802
64 Ga0068856_100664037 3300005614 Bacteria 1063
65 Ga0068852_100000195 3300005616 Bacteria 41405
66 Ga0068866_10000006 3300005718 Bacteria 176129
67 Ga0068866_10000220 3300005718 Bacteria 27117
68 Ga0068866_10016642 3300005718 Bacteria 3292
69 Ga0068861_100535186 3300005719 Bacteria 1065
70 Ga0068851_10000138 3300005834 Bacteria 39261
71 Ga0068851_10016790 3300005834 Bacteria 3508
72 Ga0068863_100000039 3300005841 Bacteria 161450
73 Ga0068863_100018094 3300005841 Bacteria 6747
74 Ga0068858_100000350 3300005842 Bacteria 48492
75 Ga0068858_100003595 3300005842 Bacteria 15344
76 Ga0068858_100417740 3300005842 Bacteria 1290
77 Ga0068860_100001352 3300005843 Bacteria 26645
78 Ga0068862_100002457 3300005844 Bacteria 16420
79 Ga0081455_10019516 3300005937 Bacteria 6412
80 Ga0081455_10070831 3300005937 Bacteria 2893
81 Ga0081540_1000419 3300005983 Bacteria 41957
82 Ga0081539_10000615 3300005985 Bacteria 72134
83 Ga0070715_10000003 3300006163 Bacteria 345282
84 Ga0070712_100000142 3300006175 Bacteria 37397
85 Ga0075431_100087667 3300006847 Bacteria 3212
86 Ga0075433_10000307 3300006852 Bacteria 29603
87 Ga0075433_10003841 3300006852 Bacteria 11629
88 Ga0068865_100000009 3300006881 Bacteria 168291
89 Ga0105245_10000012 3300009098 Bacteria 267151
90 Ga0105245_10000067 3300009098 Bacteria 107929
91 Ga0105245_10000246 3300009098 Bacteria 51410
92 Ga0105245_10137444 3300009098 Bacteria 2298
93 Ga0105247_10000110 3300009101 Bacteria 83499
94 Ga0105247_10247032 3300009101 Bacteria 1218
95 Ga0105242_10000010 3300009176 Bacteria 151649
96 Ga0105242_10000904 3300009176 Bacteria 23037
97 Ga0105242_10256676 3300009176 Bacteria 1577
98 Ga0105248_10000307 3300009177 Bacteria 58221
99 Ga0105238_10000014 3300009551 Bacteria 241954
100 Ga0105238_10317327 3300009551 Bacteria 1544
101 Ga0105249_10000159 3300009553 Bacteria 82172
102 Ga0105249_10035006 3300009553 Bacteria 4552
103 Ga0105249_10347919 3300009553 Bacteria 1501
104 Ga0105249_10520326 3300009553 Bacteria 1237
105 Ga0157371_10006368 3300013102 Bacteria 9763
106 Ga0157370_10007054 3300013104 Bacteria 12266
107 Ga0157370_10024314 3300013104 Bacteria 6000
108 Ga0157369_10000222 3300013105 Bacteria 78413
109 Ga0157374_10110668 3300013296 Bacteria 2642
110 Ga0157374_10113022 3300013296 Bacteria 2614
111 Ga0157378_10009467 3300013297 Bacteria 8488
112 Ga0157372_10000150 3300013307 Bacteria 75963
113 Ga0157375_10000095 3300013308 Bacteria 88952
114 Ga0157375_10266217 3300013308 Bacteria 1875
115 Ga0157375_10350246 3300013308 Bacteria 1643
116 Ga0157375_10639532 3300013308 Bacteria 1221
117 Ga0157375_10691736 3300013308 Bacteria 1174
118 Ga0163163_10119347 3300014325 Bacteria 2670
119 Ga0163163_10181360 3300014325 Bacteria 2153
120 Ga0163163_10456340 3300014325 Bacteria 1338
121 Ga0157380_10000300 3300014326 Bacteria 29844
122 Ga0157379_10112677 3300014968 Bacteria 2445
123 Ga0157376_10065771 3300014969 Bacteria 3063
124 Ga0157376_10495894 3300014969 Bacteria 1199
125 Ga0163161_10000192 3300017792 Bacteria 56160
126 Ga0163161_10098365 3300017792 Bacteria 2174
127 Ga0206354_11259931 3300020081 Bacteria 1839
128 Ga0207656_10000377 3300025321 Bacteria 14945
129 Ga0207656_10003944 3300025321 Bacteria 5137
130 Ga0207682_10000090 3300025893 Bacteria 41635
131 Ga0207642_10000001 3300025899 Bacteria 714030
132 Ga0207642_10000003 3300025899 Bacteria 650651
133 Ga0207642_10000004 3300025899 Bacteria 407822
134 Ga0207642_10001124 3300025899 Bacteria 8272
135 Ga0207642_10097099 3300025899 Bacteria 1470
136 Ga0207710_10000138 3300025900 Bacteria 83652
137 Ga0207680_10002321 3300025903 Bacteria 8854
138 Ga0207680_10003763 3300025903 Bacteria 7142
139 Ga0207685_10000003 3300025905 Bacteria 344527
140 Ga0207705_10033101 3300025909 Bacteria 3694
141 Ga0207707_10246398 3300025912 Bacteria 1552
142 Ga0207693_10002948 3300025915 Bacteria 14731
143 Ga0207663_10240160 3300025916 Bacteria 1328
144 Ga0207657_10336698 3300025919 Bacteria 1191
145 Ga0207649_10000024 3300025920 Bacteria 183104
146 Ga0207652_10000119 3300025921 Bacteria 86757
147 Ga0207652_10000303 3300025921 Bacteria 50549
148 Ga0207694_10000008 3300025924 Bacteria 484902
149 Ga0207694_10119832 3300025924 Bacteria 2100
150 Ga0207650_10100924 3300025925 Bacteria 2221
151 Ga0207659_10000049 3300025926 Bacteria 82923
152 Ga0207687_10000011 3300025927 Bacteria 388349
153 Ga0207687_10000012 3300025927 Bacteria 370729
154 Ga0207687_10000325 3300025927 Bacteria 32487
155 Ga0207687_10001447 3300025927 Bacteria 16263
156 Ga0207700_10000009 3300025928 Bacteria 314953
157 Ga0207664_10085531 3300025929 Bacteria 2574
158 Ga0207644_10072072 3300025931 Bacteria 2529
159 Ga0207690_10004070 3300025932 Bacteria 8636
160 Ga0207706_10000062 3300025933 Bacteria 109344
161 Ga0207686_10001002 3300025934 Bacteria 16774
162 Ga0207686_10009806 3300025934 Bacteria 5204
163 Ga0207686_10026625 3300025934 Bacteria 3376
164 Ga0207709_10002634 3300025935 Bacteria 11158
165 Ga0207669_10000037 3300025937 Bacteria 77494
166 Ga0207669_10000070 3300025937 Bacteria 51898
167 Ga0207704_10000009 3300025938 Bacteria 198266
168 Ga0207691_10000323 3300025940 Bacteria 47571
169 Ga0207711_10000024 3300025941 Bacteria 293596
170 Ga0207661_10000136 3300025944 Bacteria 46409
171 Ga0207661_10003104 3300025944 Bacteria 11502
172 Ga0207661_10007210 3300025944 Bacteria 7902
173 Ga0207661_10009813 3300025944 Bacteria 6874
174 Ga0207661_10105814 3300025944 Bacteria 2371
175 Ga0207679_10010479 3300025945 Bacteria 5969
176 Ga0207679_10119409 3300025945 Bacteria 2096
177 Ga0207651_10019743 3300025960 Bacteria 4048
178 Ga0207712_10000003 3300025961 Bacteria 615314
179 Ga0207712_10018791 3300025961 Bacteria 4507
180 Ga0207668_10275868 3300025972 Bacteria 1376
181 Ga0207640_10000040 3300025981 Bacteria 106134
182 Ga0207658_10007739 3300025986 Bacteria 7322
183 Ga0207658_10010669 3300025986 Bacteria 6244
184 Ga0207658_10029902 3300025986 Bacteria 3853
185 Ga0207677_10000239 3300026023 Bacteria 42724
186 Ga0207677_10000605 3300026023 Bacteria 22116
187 Ga0207703_10000028 3300026035 Bacteria 208682
188 Ga0207703_10000185 3300026035 Bacteria 72988
189 Ga0207703_10139145 3300026035 Bacteria 2105
190 Ga0207639_10532896 3300026041 Bacteria 1076
191 Ga0207678_10000174 3300026067 Bacteria 54529
192 Ga0207708_10064920 3300026075 Bacteria 2790
193 Ga0207702_10001236 3300026078 Bacteria 25851
194 Ga0207702_10019132 3300026078 Bacteria 5666
195 Ga0207641_10000072 3300026088 Bacteria 151067
196 Ga0207641_10013003 3300026088 Bacteria 6827
197 Ga0207683_10087729 3300026121 Bacteria 2767
198 Ga0207698_10000009 3300026142 Bacteria 281300
199 Ga0207698_10304150 3300026142 Bacteria 1486
200 Ga0268266_10000023 3300028379 Bacteria 501899
201 Ga0268266_10001090 3300028379 Bacteria 34068
202 Ga0268266_10001616 3300028379 Bacteria 26283
203 Ga0268266_10265022 3300028379 Bacteria 1593
204 Ga0268266_10266425 3300028379 Bacteria 1589
205 Ga0268265_10064217 3300028380 Bacteria 2827
206 Ga0265337_1000041 3300028556 Bacteria 56264
207 Ga0265326_10000015 3300028558 Bacteria 159279
208 Ga0265326_10042834 3300028558 Bacteria 1285
209 Ga0265319_1000269 3300028563 Bacteria 39050
210 Ga0265322_10000003 3300028654 Bacteria 468671
211 Ga0265336_10001926 3300028666 Bacteria 8960
212 Ga0265336_10035101 3300028666 Bacteria 1548
213 Ga0265338_10000383 3300028800 Bacteria 79248
214 Ga0265324_10000453 3300029957 Bacteria 28979
215 Ga0265324_10010022 3300029957 Bacteria 3675
216 Ga0307511_10093350 3300030521 Bacteria 2023
217 Ga0265328_10000317 3300031239 Bacteria 22474
218 Ga0265320_10000001 3300031240 Bacteria 847191
219 Ga0265325_10003689 3300031241 Bacteria 9915
220 Ga0265329_10031923 3300031242 Bacteria 1708
221 Ga0265339_10026918 3300031249 Bacteria 3289
222 Ga0265331_10000931 3300031250 Bacteria 23417
223 Ga0265327_10000003 3300031251 Bacteria 852750
224 Ga0265316_10026849 3300031344 Bacteria 4780
225 Ga0265314_10000356 3300031711 Bacteria 63799
226 Ga0373957_0042502 3300035120 Bacteria 1715
227 Ga0451807_0881530 3300041486 Bacteria 3428
228 Ga0451807_2523630 3300041486 Bacteria 1359
229 Ga0451853_2595654 3300041512 Bacteria 2781
230 Ga0466963_0000002 3300044694 Bacteria 108477
231 Ga0466963_0012604 3300044694 Bacteria 5179
232 Ga0466963_0264025 3300044694 Unclassified 1209
233 Ga0466957_0000232 3300044842 Bacteria 26291
234 Ga0466958_0131390 3300045836 Bacteria 1572
235 Ga0466967_0000020 3300045976 Bacteria 78851
236 Ga0466967_0346537 3300045976 Bacteria 1437
237 Ga0495592_0000749 3300046454 Bacteria 22661
238 Ga0495603_0000022 3300046455 Bacteria 64108
239 Ga0495603_0010022 3300046455 Bacteria 5732
240 Ga0495629_0000028 3300046459 Bacteria 127409
241 Ga0495629_0000674 3300046459 Bacteria 27697
242 Ga0495629_0097265 3300046459 Bacteria 2053
243 Ga0495629_0160924 3300046459 Bacteria 1559
244 Ga0495638_0040453 3300046460 Bacteria 2954
245 Ga0495641_0000298 3300046461 Bacteria 39640
246 Ga0495641_0021785 3300046461 Bacteria 3218
247 Ga0495653_0023800 3300046463 Bacteria 4944
248 Ga0495582_0000048 3300046473 Bacteria 60887
249 Ga0495662_0000006 3300046476 Bacteria 79206
250 Ga0495662_0004617 3300046476 Bacteria 6907
251 Ga0495594_0000021 3300046499 Bacteria 74679
252 Ga0495606_0000219 3300046507 Bacteria 101614
253 Ga0495608_0000301 3300046511 Bacteria 34659
254 Ga0495608_0021310 3300046511 Bacteria 4449
255 Ga0495608_0024578 3300046511 Bacteria 4117
256 Ga0495618_0000003 3300046514 Bacteria 256269
257 Ga0495618_0168828 3300046514 Bacteria 1393
258 Ga0495620_0000060 3300046515 Bacteria 95642
259 Ga0495628_0002027 3300046516 Bacteria 18361
260 Ga0495628_0003567 3300046516 Bacteria 13932
261 Ga0495628_0029184 3300046516 Bacteria 4475
262 Ga0495628_0041977 3300046516 Bacteria 3650
263 Ga0495630_0000115 3300046517 Bacteria 63124
264 Ga0495630_0010343 3300046517 Bacteria 6733
265 Ga0495630_0023139 3300046517 Bacteria 4591
266 Ga0495630_0134323 3300046517 Bacteria 1880
267 Ga0495644_0000528 3300046523 Bacteria 16226
268 Ga0495652_0000003 3300046529 Bacteria 597094
269 Ga0495640_0001957 3300046533 Bacteria 16433
270 Ga0495586_0000210 3300046535 Bacteria 39196
271 Ga0495587_0004142 3300046536 Bacteria 9593
272 Ga0495598_0010040 3300046537 Bacteria 2256
273 Ga0495621_0005188 3300046539 Bacteria 3728
274 Ga0495645_0118686 3300046543 Bacteria 1864
275 Ga0495645_0406056 3300046543 Bacteria 867
276 Ga0495622_0000325 3300046557 Bacteria 35075
277 Ga0495667_0000057 3300046559 Bacteria 100656
278 Ga0495656_0000195 3300046615 Bacteria 21694
279 Ga0495634_0000974 3300046642 Bacteria 26986
280 Ga0495634_0003817 3300046642 Bacteria 11969
281 Ga0495634_0049023 3300046642 Bacteria 2841
282 Ga0495635_0000006 3300046663 Bacteria 301820
283 Ga0495635_0040276 3300046663 Bacteria 3229
284 Ga0495588_0000195 3300046674 Bacteria 64337
285 Ga0495657_0000002 3300046675 Bacteria 411958
286 Ga0495657_0037844 3300046675 Bacteria 3322
287 Ga0495599_0026189 3300046678 Bacteria 3654
288 Ga0495646_0077125 3300046680 Bacteria 1950
289 Ga0495647_0000858 3300046681 Bacteria 9100
290 Ga0495647_0001270 3300046681 Bacteria 7775
291 Ga0495658_0000031 3300046683 Bacteria 71165
292 Ga0495658_0207796 3300046683 Bacteria 1222
293 Ga0495669_0000064 3300046684 Bacteria 70549
294 Ga0495669_0018302 3300046684 Bacteria 3011
295 Ga0495613_0000003 3300046689 Bacteria 248826
296 Ga0495613_0117392 3300046689 Bacteria 1913
297 Ga0495613_0128974 3300046689 Bacteria 1812
298 Ga0495624_0000002 3300046690 Bacteria 189957
299 Ga0495624_0000149 3300046690 Bacteria 51112
300 Ga0495624_0006553 3300046690 Bacteria 8249
301 Ga0495670_0004840 3300046691 Bacteria 6611
302 Ga0495649_0005180 3300046694 Bacteria 8358
303 Ga0495600_0001113 3300046809 Bacteria 14646
304 Ga0495600_0011652 3300046809 Bacteria 5484
305 Ga0495604_0000056 3300047317 Bacteria 100110
306 Ga0495604_0098430 3300047317 Bacteria 2155
307 Ga0495674_0000007 3300047319 Bacteria 336257
308 Ga0495672_0087420 3300047320 Bacteria 1721
309 Ga0495676_0001589 3300047321 Bacteria 19708
310 Ga0495676_0084081 3300047321 Bacteria 2402
311 Ga0495680_0000185 3300047322 Bacteria 66139
312 Ga0495680_0000324 3300047322 Bacteria 53748
313 Ga0495680_0001393 3300047322 Bacteria 26081
314 Ga0495680_0031381 3300047322 Bacteria 4326
315 Ga0495680_0083808 3300047322 Bacteria 2403
316 Ga0495675_0000104 3300047444 Bacteria 60748
317 Ga0495679_005000 3300047446 Bacteria 5971
318 Ga0495685_004428 3300047447 Bacteria 4539
319 Ga0495684_0084173 3300047471 Bacteria 2413
320 Ga0495686_0166144 3300047472 Bacteria 1286
321 Ga0495593_0078002 3300047673 Bacteria 1716
322 Ga0495602_0000063 3300048088 Bacteria 104915
323 Ga0495602_0023176 3300048088 Bacteria 6055
324 Ga0495602_0042963 3300048088 Bacteria 4114
325 Ga0495602_0177795 3300048088 Bacteria 1644
326 Ga0496100_0000004 3300048903 Bacteria 321778
327 Ga0496100_0000027 3300048903 Bacteria 115829
328 Ga0496101_0000007 3300048904 Bacteria 321778
329 Ga0496101_0000012 3300048904 Bacteria 268127
330 Ga0496102_0000533 3300048905 Bacteria 41239
331 Ga0496102_0215817 3300048905 Bacteria 1808
332 Ga0496103_0000001 3300048906 Bacteria 643471
333 Ga0496103_0104391 3300048906 Bacteria 1796
334 Ga0496104_0000002 3300048907 Bacteria 686017
335 Ga0496104_0000003 3300048907 Bacteria 669219
336 Ga0496104_0000243 3300048907 Bacteria 48237
337 Ga0496105_0000001 3300048908 Bacteria 1328178
338 Ga0496105_0000008 3300048908 Bacteria 335652
339 Ga0496105_0000622 3300048908 Bacteria 23722
340 Ga0496105_0027357 3300048908 Bacteria 4658
341 Ga0496106_0000004 3300048909 Bacteria 279896
342 Ga0496106_0000020 3300048909 Bacteria 169168
343 Ga0496106_0000096 3300048909 Bacteria 67122
344 Ga0496106_0316147 3300048909 Bacteria 1253
345 Ga0496107_0000001 3300048910 Bacteria 321778
346 Ga0496107_0000014 3300048910 Bacteria 176738
347 Ga0496107_0054505 3300048910 Bacteria 2886
348 Ga0496107_0105292 3300048910 Bacteria 2071
349 Ga0496108_0000002 3300048911 Bacteria 700890
350 Ga0496108_0000012 3300048911 Bacteria 258433
351 Ga0496108_0000795 3300048911 Bacteria 24608
352 Ga0496108_0007459 3300048911 Bacteria 8866
353 Ga0496109_0000001 3300048912 Bacteria 700852
354 Ga0496109_0000035 3300048912 Bacteria 159744
355 Ga0496109_0000057 3300048912 Bacteria 120274
356 Ga0496109_0000058 3300048912 Bacteria 118556
357 Ga0496109_0099399 3300048912 Bacteria 2698
358 Ga0496110_0000170 3300048913 Bacteria 39947
359 Ga0496110_0003956 3300048913 Bacteria 11398
360 Ga0496110_0064445 3300048913 Bacteria 3239
361 Ga0496110_0188650 3300048913 Bacteria 1872
362 Ga0496111_0000001 3300048914 Bacteria 194837
363 Ga0496111_0125460 3300048914 Bacteria 1897
364 Ga0496111_0204560 3300048914 Bacteria 1467
365 Ga0496112_0000002 3300048915 Bacteria 782039
366 Ga0496112_0009465 3300048915 Bacteria 8781
367 Ga0496112_0085741 3300048915 Bacteria 3116
368 Ga0496113_0000010 3300048916 Bacteria 86561
369 Ga0496113_0012576 3300048916 Bacteria 5693
370 Ga0496113_0029642 3300048916 Bacteria 3955
371 Ga0496114_0000080 3300048917 Bacteria 68701
372 Ga0496114_0087006 3300048917 Bacteria 2649
373 Ga0496114_0162632 3300048917 Bacteria 1942
374 Ga0496114_0395680 3300048917 Bacteria 1224
375 Ga0496115_0000004 3300048918 Bacteria 319734
376 Ga0496115_0000104 3300048918 Bacteria 79824
377 Ga0496116_0000500 3300048919 Bacteria 53809
378 Ga0496116_0145244 3300048919 Bacteria 1327
379 Ga0496117_0001638 3300048920 Bacteria 31520
380 Ga0496117_0175804 3300048920 Bacteria 1237
381 Ga0496118_0001976 3300048921 Bacteria 29112
382 Ga0496118_0162191 3300048921 Bacteria 1380
383 Ga0496119_0001539 3300048922 Bacteria 27538
384 Ga0496119_0022615 3300048922 Bacteria 4492
385 Ga0496119_0025847 3300048922 Bacteria 4089
386 Ga0496119_0087729 3300048922 Bacteria 1775
387 Ga0496119_0095568 3300048922 Bacteria 1678
388 Ga0496120_0000528 3300048923 Bacteria 59001
389 Ga0496120_0084417 3300048923 Bacteria 1712
390 Ga0496121_0004909 3300048924 Bacteria 17553
391 Ga0496121_0033008 3300048924 Bacteria 4694
392 Ga0496124_0038160 3300048927 Bacteria 4172
393 Ga0496124_0220159 3300048927 Bacteria 1428
394 Ga0496124_0417140 3300048927 Bacteria 926
395 Ga0496125_0073869 3300048928 Bacteria 2648
396 Ga0496125_0131065 3300048928 Bacteria 1765
397 Ga0496126_0006214 3300048929 Bacteria 13364
398 Ga0496126_0015574 3300048929 Bacteria 7641
399 Ga0496126_0044024 3300048929 Bacteria 4113
400 Ga0501031_0000326 3300049568 Bacteria 27423
401 Ga0501032_0000701 3300049569 Bacteria 27295
402 Ga0501033_0000890 3300049570 Bacteria 27318
403 Ga0501034_0002987 3300049571 Bacteria 19578
404 Ga0501036_0000131 3300049572 Bacteria 48019
405 Ga0501037_0000621 3300049573 Bacteria 27506
406 Ga0501038_0000835 3300049574 Bacteria 27413
407 Ga0501042_0014841 3300049578 Bacteria 5322
408 Ga0501043_0000841 3300049579 Bacteria 27283
409 Ga0501043_0280769 3300049579 Bacteria 1276
410 Ga0501046_0001019 3300049580 Bacteria 27339
411 Ga0501047_0000177 3300049581 Bacteria 78448
412 Ga0501047_0001093 3300049581 Bacteria 26985
413 Ga0501048_0000094 3300049582 Bacteria 48036
414 Ga0501068_0009320 3300049584 Bacteria 5489
415 Ga0501069_0003674 3300049585 Bacteria 7897
416 Ga0501069_0005225 3300049585 Bacteria 6748
417 Ga0501070_0000184 3300049586 Bacteria 58715
418 Ga0501070_0005259 3300049586 Bacteria 11036
419 Ga0501070_0023596 3300049586 Bacteria 5154
420 Ga0501070_0471454 3300049586 Bacteria 1010
421 Ga0501071_0129846 3300049587 Bacteria 1871
422 Ga0501072_0181685 3300049588 Bacteria 1678
423 Ga0501072_0546427 3300049588 Bacteria 915
424 Ga0501073_0010593 3300049589 Bacteria 6745
425 Ga0501074_0004638 3300049590 Bacteria 9843
426 Ga0501074_0097407 3300049590 Bacteria 2105
427 Ga0501074_0103775 3300049590 Bacteria 2035
428 Ga0501075_0004618 3300049591 Bacteria 9344
429 Ga0501075_0289639 3300049591 Bacteria 1248
430 Ga0501076_0031182 3300049592 Bacteria 4156
431 Ga0501079_0009133 3300049741 Bacteria 7505
432 Ga0501079_0013430 3300049741 Bacteria 6246
433 Ga0501080_0087516 3300049742 Bacteria 2894
434 Ga0501083_0000414 3300049744 Bacteria 27277
435 Ga0501083_0010953 3300049744 Bacteria 6376
436 Ga0501035_0006508 3300049822 Bacteria 10974
437 Ga0501035_0253168 3300049822 Bacteria 1495
438 Ga0501044_0001862 3300049823 Bacteria 24452
439 Ga0501044_0111608 3300049823 Bacteria 2741
440 Ga0501044_0585665 3300049823 Bacteria 1010
441 Ga0501045_0072891 3300049824 Bacteria 2528
442 Ga0501045_0310436 3300049824 Bacteria 1174
443 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
444 nmdc:mga0a205_5429_c1 3300050515 Bacteria 11491
445 Ga0495601_0000246 3300053077 Bacteria 28887
446 Ga0495601_0017636 3300053077 Bacteria 4336
447 Ga0495601_0036328 3300053077 Bacteria 3076
448 Ga0495601_0086343 3300053077 Bacteria 2016
449 Ga0495612_0001971 3300053078 Bacteria 8452
450 Ga0495612_0012977 3300053078 Bacteria 3356
451 Ga0495612_0042441 3300053078 Bacteria 1856
452 Ga0495655_0000012 3300053083 Bacteria 92485
453 Ga0495595_0000001 3300053084 Bacteria 495226
454 Ga0495595_0000084 3300053084 Bacteria 45392
455 Ga0495619_0000018 3300053085 Bacteria 209943
456 Ga0495619_0000041 3300053085 Bacteria 112824
457 Ga0495619_0000094 3300053085 Bacteria 67416
458 Ga0495619_0000745 3300053085 Bacteria 21209
459 Ga0495619_0001141 3300053085 Bacteria 17453
460 Ga0495619_0025976 3300053085 Bacteria 3765
461 Ga0500566_0010766 3300053094 Bacteria 5391
462 Ga0500641_0006108 3300053096 Bacteria 4269
463 Ga0500595_035468 3300053119 Bacteria 1642
464 Ga0500614_000483 3300053123 Bacteria 10349
465 Ga0500628_000014 3300053129 Bacteria 102838
466 Ga0500658_0016258 3300053134 Bacteria 2771
467 Ga0501082_0005208 3300060353 Bacteria 11305
468 Ga0530510_0561944 3300061734 Bacteria 867

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0417140 Ga0496124_0417140_13_756 221
2 3300046642 Ga0495634_0000974 Ga0495634_0000974_7664_8488 235
3 3300003320 rootH2_10175980 rootH2_101759802 237
4 3300009177 Ga0105248_10000307 Ga0105248_1000030721 239
5 3300047472 Ga0495686_0166144 Ga0495686_0166144_467_1264 239
6 3300014325 Ga0163163_10456340 Ga0163163_104563402 244
7 3300046543 Ga0495645_0406056 Ga0495645_0406056_18_830 244
8 3300047317 Ga0495604_0098430 Ga0495604_0098430_1317_2141 244
9 3300005544 Ga0070686_100124532 Ga0070686_1001245322 245
10 3300005842 Ga0068858_100003595 Ga0068858_1000035955 245
11 3300009553 Ga0105249_10520326 Ga0105249_105203261 245
12 3300013104 Ga0157370_10007054 Ga0157370_1000705411 245
13 3300013308 Ga0157375_10000095 Ga0157375_1000009519 245
14 3300026035 Ga0207703_10000028 Ga0207703_1000002874 245
15 3300046511 Ga0495608_0024578 Ga0495608_0024578_2315_3169 245
16 3300046689 Ga0495613_0117392 Ga0495613_0117392_475_1329 245
17 3300053085 Ga0495619_0000041 Ga0495619_0000041_72138_72992 245
18 3300001979 JGI24740J21852_10002918 JGI24740J21852_100029183 246
19 3300005329 Ga0070683_100145395 Ga0070683_1001453952 246
20 3300005331 Ga0070670_100093250 Ga0070670_1000932502 246
21 3300005344 Ga0070661_100000052 Ga0070661_10000005279 246
22 3300005347 Ga0070668_100506305 Ga0070668_1005063051 246
23 3300005535 Ga0070684_100412264 Ga0070684_1004122642 246
24 3300005548 Ga0070665_100070049 Ga0070665_1000700492 246
25 3300005564 Ga0070664_100005631 Ga0070664_1000056312 246
26 3300005842 Ga0068858_100417740 Ga0068858_1004177402 246
27 3300005844 Ga0068862_100002457 Ga0068862_1000024572 246
28 3300009101 Ga0105247_10247032 Ga0105247_102470321 246
29 3300009553 Ga0105249_10035006 Ga0105249_100350064 246
30 3300013105 Ga0157369_10000222 Ga0157369_1000022219 246
31 3300014968 Ga0157379_10112677 Ga0157379_101126772 246
32 3300025920 Ga0207649_10000024 Ga0207649_10000024175 246
33 3300025925 Ga0207650_10100924 Ga0207650_101009242 246
34 3300025934 Ga0207686_10001002 Ga0207686_1000100211 246
35 3300025944 Ga0207661_10105814 Ga0207661_101058142 246
36 3300025945 Ga0207679_10010479 Ga0207679_100104792 246
37 3300025961 Ga0207712_10018791 Ga0207712_100187912 246
38 3300025972 Ga0207668_10275868 Ga0207668_102758681 246
39 3300025986 Ga0207658_10010669 Ga0207658_100106696 246
40 3300026035 Ga0207703_10139145 Ga0207703_101391452 246
41 3300026041 Ga0207639_10532896 Ga0207639_105328962 246
42 3300028380 Ga0268265_10064217 Ga0268265_100642172 246
43 3300049586 Ga0501070_0023596 Ga0501070_0023596_48_866 246
44 3300053077 Ga0495601_0017636 Ga0495601_0017636_289_1110 246
45 3300005337 Ga0070682_100000040 Ga0070682_10000004085 247
46 3300005436 Ga0070713_100000055 Ga0070713_1000000556 247
47 3300005543 Ga0070672_100000036 Ga0070672_10000003611 247
48 3300009098 Ga0105245_10137444 Ga0105245_101374442 247
49 3300009176 Ga0105242_10000010 Ga0105242_1000001066 247
50 3300013307 Ga0157372_10000150 Ga0157372_1000015054 247
51 3300013308 Ga0157375_10350246 Ga0157375_103502462 247
52 3300014969 Ga0157376_10495894 Ga0157376_104958942 247
53 3300020081 Ga0206354_11259931 Ga0206354_112599312 247
54 3300025903 Ga0207680_10002321 Ga0207680_100023212 247
55 3300025916 Ga0207663_10240160 Ga0207663_102401602 247
56 3300025919 Ga0207657_10336698 Ga0207657_103366982 247
57 3300025927 Ga0207687_10001447 Ga0207687_100014472 247
58 3300025928 Ga0207700_10000009 Ga0207700_10000009309 247
59 3300025932 Ga0207690_10004070 Ga0207690_100040707 247
60 3300025940 Ga0207691_10000323 Ga0207691_1000032311 247
61 3300045836 Ga0466958_0131390 Ga0466958_0131390_610_1431 247
62 3300046459 Ga0495629_0097265 Ga0495629_0097265_312_1133 247
63 3300046476 Ga0495662_0000006 Ga0495662_0000006_63658_64479 247
64 3300046507 Ga0495606_0000219 Ga0495606_0000219_6116_6937 247
65 3300046511 Ga0495608_0000301 Ga0495608_0000301_14341_15162 247
66 3300046516 Ga0495628_0029184 Ga0495628_0029184_1704_2525 247
67 3300046517 Ga0495630_0010343 Ga0495630_0010343_3837_4658 247
68 3300046675 Ga0495657_0037844 Ga0495657_0037844_1317_2138 247
69 3300046689 Ga0495613_0000003 Ga0495613_0000003_224610_225434 247
70 3300046809 Ga0495600_0011652 Ga0495600_0011652_4447_5298 247
71 3300047673 Ga0495593_0078002 Ga0495593_0078002_775_1596 247
72 3300048088 Ga0495602_0000063 Ga0495602_0000063_94566_95417 247
73 3300048088 Ga0495602_0042963 Ga0495602_0042963_360_1184 247
74 3300048905 Ga0496102_0000533 Ga0496102_0000533_8276_9097 247
75 3300048906 Ga0496103_0000001 Ga0496103_0000001_339426_340247 247
76 3300048913 Ga0496110_0000170 Ga0496110_0000170_27731_28582 247
77 3300048914 Ga0496111_0000001 Ga0496111_0000001_67608_68459 247
78 3300049588 Ga0501072_0546427 Ga0501072_0546427_14_835 247
79 3300053077 Ga0495601_0086343 Ga0495601_0086343_1118_1939 247
80 3300053085 Ga0495619_0000018 Ga0495619_0000018_25357_26208 247
81 3300053085 Ga0495619_0025976 Ga0495619_0025976_1705_2526 247
82 3300053094 Ga0500566_0010766 Ga0500566_0010766_2779_3600 247
83 3300061734 Ga0530510_0561944 Ga0530510_0561944_16_837 247
84 3300005614 Ga0068856_100664037 Ga0068856_1006640371 248
85 3300017792 Ga0163161_10000192 Ga0163161_1000019251 248
86 3300046516 Ga0495628_0002027 Ga0495628_0002027_3886_4710 248
87 3300046535 Ga0495586_0000210 Ga0495586_0000210_36234_37058 248
88 3300046615 Ga0495656_0000195 Ga0495656_0000195_8339_9163 248
89 3300047447 Ga0495685_004428 Ga0495685_004428_2052_2876 248
90 3300048088 Ga0495602_0177795 Ga0495602_0177795_13_837 248
91 3300048907 Ga0496104_0000003 Ga0496104_0000003_462993_463847 248
92 3300048908 Ga0496105_0000008 Ga0496105_0000008_9020_9874 248
93 3300048915 Ga0496112_0009465 Ga0496112_0009465_3137_3985 248
94 3300048916 Ga0496113_0000010 Ga0496113_0000010_78046_78894 248
95 3300053077 Ga0495601_0000246 Ga0495601_0000246_17343_18167 248
96 3300053084 Ga0495595_0000084 Ga0495595_0000084_34807_35631 248
97 3300005336 Ga0070680_100537719 Ga0070680_1005377191 249
98 3300005530 Ga0070679_100000156 Ga0070679_10000015644 249
99 3300005578 Ga0068854_100000123 Ga0068854_10000012324 249
100 3300005834 Ga0068851_10000138 Ga0068851_1000013833 249
101 3300025321 Ga0207656_10000377 Ga0207656_100003779 249
102 3300025921 Ga0207652_10000119 Ga0207652_1000011935 249
103 3300025981 Ga0207640_10000040 Ga0207640_1000004077 249
104 3300046515 Ga0495620_0000060 Ga0495620_0000060_20783_21637 249
105 3300046690 Ga0495624_0000002 Ga0495624_0000002_177246_178100 249
106 3300047446 Ga0495679_005000 Ga0495679_005000_1629_2483 249
107 3300048903 Ga0496100_0000004 Ga0496100_0000004_111963_112817 249
108 3300048904 Ga0496101_0000007 Ga0496101_0000007_111963_112817 249
109 3300048909 Ga0496106_0000004 Ga0496106_0000004_73377_74231 249
110 3300048910 Ga0496107_0000001 Ga0496107_0000001_111963_112817 249
111 3300048911 Ga0496108_0000002 Ga0496108_0000002_530112_530966 249
112 3300048912 Ga0496109_0000001 Ga0496109_0000001_530074_530928 249
113 3300048928 Ga0496125_0073869 Ga0496125_0073869_1433_2287 249
114 3300046678 Ga0495599_0026189 Ga0495599_0026189_1484_2338 250
115 3300048911 Ga0496108_0000795 Ga0496108_0000795_13626_14480 251
116 3300048912 Ga0496109_0000058 Ga0496109_0000058_44905_45759 251
117 3300048917 Ga0496114_0395680 Ga0496114_0395680_296_1150 251
118 3300053096 Ga0500641_0006108 Ga0500641_0006108_1832_2677 251
119 3300046461 Ga0495641_0000298 Ga0495641_0000298_16057_16911 252
120 3300046517 Ga0495630_0023139 Ga0495630_0023139_3186_4040 252
121 3300053123 Ga0500614_000483 Ga0500614_000483_2277_3131 252
122 3300009553 Ga0105249_10000159 Ga0105249_1000015963 253
123 3300014325 Ga0163163_10119347 Ga0163163_101193473 253
124 3300025961 Ga0207712_10000003 Ga0207712_10000003219 253
125 3300053078 Ga0495612_0042441 Ga0495612_0042441_541_1395 253
126 3300005329 Ga0070683_100000207 Ga0070683_10000020735 254
127 3300005354 Ga0070675_100000008 Ga0070675_10000000863 254
128 3300005435 Ga0070714_100210561 Ga0070714_1002105612 254
129 3300005535 Ga0070684_100044565 Ga0070684_1000445656 254
130 3300025926 Ga0207659_10000049 Ga0207659_1000004911 254
131 3300025929 Ga0207664_10085531 Ga0207664_100855312 254
132 3300025944 Ga0207661_10000136 Ga0207661_1000013611 254
133 3300045976 Ga0466967_0000020 Ga0466967_0000020_44910_45752 254
134 3300046511 Ga0495608_0021310 Ga0495608_0021310_2336_3190 254
135 3300046529 Ga0495652_0000003 Ga0495652_0000003_485595_486437 254
136 3300047319 Ga0495674_0000007 Ga0495674_0000007_219306_220151 254
137 3300048921 Ga0496118_0162191 Ga0496118_0162191_320_1162 254
138 3300048929 Ga0496126_0006214 Ga0496126_0006214_1768_2610 254
139 3300048929 Ga0496126_0044024 Ga0496126_0044024_563_1405 254
140 3300053077 Ga0495601_0036328 Ga0495601_0036328_564_1406 254
141 3300005335 Ga0070666_10012209 Ga0070666_100122095 255
142 3300005355 Ga0070671_100108004 Ga0070671_1001080042 255
143 3300005367 Ga0070667_100026099 Ga0070667_1000260994 255
144 3300005455 Ga0070663_100000101 Ga0070663_1000001013 255
145 3300005530 Ga0070679_100000784 Ga0070679_1000007844 255
146 3300005614 Ga0068856_100003489 Ga0068856_1000034894 255
147 3300005718 Ga0068866_10016642 Ga0068866_100166424 255
148 3300005937 Ga0081455_10070831 Ga0081455_100708311 255
149 3300005983 Ga0081540_1000419 Ga0081540_100041940 255
150 3300005985 Ga0081539_10000615 Ga0081539_1000061565 255
151 3300009551 Ga0105238_10317327 Ga0105238_103173272 255
152 3300013308 Ga0157375_10639532 Ga0157375_106395322 255
153 3300014969 Ga0157376_10065771 Ga0157376_100657712 255
154 3300025899 Ga0207642_10097099 Ga0207642_100970992 255
155 3300025903 Ga0207680_10003763 Ga0207680_100037637 255
156 3300025921 Ga0207652_10000303 Ga0207652_100003033 255
157 3300025924 Ga0207694_10119832 Ga0207694_101198321 255
158 3300025931 Ga0207644_10072072 Ga0207644_100720722 255
159 3300025986 Ga0207658_10007739 Ga0207658_100077396 255
160 3300026067 Ga0207678_10000174 Ga0207678_100001743 255
161 3300026078 Ga0207702_10019132 Ga0207702_100191324 255
162 3300028379 Ga0268266_10001090 Ga0268266_100010905 255
163 3300044694 Ga0466963_0264025 Ga0466963_0264025_67_912 255
164 3300046460 Ga0495638_0040453 Ga0495638_0040453_736_1581 255
165 3300046499 Ga0495594_0000021 Ga0495594_0000021_12707_13552 255
166 3300046516 Ga0495628_0003567 Ga0495628_0003567_1400_2245 255
167 3300046557 Ga0495622_0000325 Ga0495622_0000325_12506_13351 255
168 3300046684 Ga0495669_0000064 Ga0495669_0000064_32430_33284 255
169 3300046694 Ga0495649_0005180 Ga0495649_0005180_5173_6024 255
170 3300047317 Ga0495604_0000056 Ga0495604_0000056_96375_97226 255
171 3300048088 Ga0495602_0023176 Ga0495602_0023176_1564_2409 255
172 3300048905 Ga0496102_0215817 Ga0496102_0215817_367_1212 255
173 3300048906 Ga0496103_0104391 Ga0496103_0104391_811_1656 255
174 3300048908 Ga0496105_0027357 Ga0496105_0027357_3399_4244 255
175 3300048909 Ga0496106_0316147 Ga0496106_0316147_207_1052 255
176 3300048919 Ga0496116_0145244 Ga0496116_0145244_128_973 255
177 3300048920 Ga0496117_0001638 Ga0496117_0001638_645_1490 255
178 3300048920 Ga0496117_0175804 Ga0496117_0175804_95_940 255
179 3300048921 Ga0496118_0001976 Ga0496118_0001976_16466_17311 255
180 3300048922 Ga0496119_0022615 Ga0496119_0022615_270_1115 255
181 3300048922 Ga0496119_0025847 Ga0496119_0025847_337_1182 255
182 3300048922 Ga0496119_0087729 Ga0496119_0087729_717_1562 255
183 3300048923 Ga0496120_0000528 Ga0496120_0000528_21387_22232 255
184 3300048924 Ga0496121_0004909 Ga0496121_0004909_566_1411 255
185 3300048924 Ga0496121_0033008 Ga0496121_0033008_460_1305 255
186 3300048927 Ga0496124_0038160 Ga0496124_0038160_3189_4034 255
187 3300048928 Ga0496125_0131065 Ga0496125_0131065_619_1464 255
188 3300048929 Ga0496126_0015574 Ga0496126_0015574_6585_7430 255
189 3300049568 Ga0501031_0000326 Ga0501031_0000326_16670_17515 255
190 3300049569 Ga0501032_0000701 Ga0501032_0000701_16630_17475 255
191 3300049570 Ga0501033_0000890 Ga0501033_0000890_16655_17500 255
192 3300049571 Ga0501034_0002987 Ga0501034_0002987_18484_19329 255
193 3300049572 Ga0501036_0000131 Ga0501036_0000131_37362_38207 255
194 3300049573 Ga0501037_0000621 Ga0501037_0000621_9859_10704 255
195 3300049574 Ga0501038_0000835 Ga0501038_0000835_9860_10705 255
196 3300049578 Ga0501042_0014841 Ga0501042_0014841_212_1057 255
197 3300049579 Ga0501043_0000841 Ga0501043_0000841_9815_10660 255
198 3300049579 Ga0501043_0280769 Ga0501043_0280769_350_1195 255
199 3300049580 Ga0501046_0001019 Ga0501046_0001019_9832_10677 255
200 3300049581 Ga0501047_0000177 Ga0501047_0000177_67717_68562 255
201 3300049581 Ga0501047_0001093 Ga0501047_0001093_197_1042 255
202 3300049582 Ga0501048_0000094 Ga0501048_0000094_37366_38211 255
203 3300049584 Ga0501068_0009320 Ga0501068_0009320_4623_5468 255
204 3300049585 Ga0501069_0003674 Ga0501069_0003674_403_1248 255
205 3300049585 Ga0501069_0005225 Ga0501069_0005225_5868_6713 255
206 3300049586 Ga0501070_0000184 Ga0501070_0000184_9816_10661 255
207 3300049586 Ga0501070_0005259 Ga0501070_0005259_3291_4136 255
208 3300049586 Ga0501070_0471454 Ga0501070_0471454_107_952 255
209 3300049587 Ga0501071_0129846 Ga0501071_0129846_139_984 255
210 3300049588 Ga0501072_0181685 Ga0501072_0181685_562_1407 255
211 3300049589 Ga0501073_0010593 Ga0501073_0010593_160_1005 255
212 3300049590 Ga0501074_0004638 Ga0501074_0004638_4348_5193 255
213 3300049590 Ga0501074_0097407 Ga0501074_0097407_608_1453 255
214 3300049590 Ga0501074_0103775 Ga0501074_0103775_306_1151 255
215 3300049741 Ga0501079_0009133 Ga0501079_0009133_5690_6535 255
216 3300049741 Ga0501079_0013430 Ga0501079_0013430_4826_5671 255
217 3300049742 Ga0501080_0087516 Ga0501080_0087516_1808_2653 255
218 3300049744 Ga0501083_0000414 Ga0501083_0000414_16619_17464 255
219 3300049744 Ga0501083_0010953 Ga0501083_0010953_3559_4404 255
220 3300049822 Ga0501035_0006508 Ga0501035_0006508_250_1095 255
221 3300049822 Ga0501035_0253168 Ga0501035_0253168_104_949 255
222 3300049823 Ga0501044_0001862 Ga0501044_0001862_23352_24197 255
223 3300049823 Ga0501044_0111608 Ga0501044_0111608_842_1687 255
224 3300049823 Ga0501044_0585665 Ga0501044_0585665_141_986 255
225 3300049824 Ga0501045_0072891 Ga0501045_0072891_1400_2245 255
226 3300053119 Ga0500595_035468 Ga0500595_035468_494_1339 255
227 3300053134 Ga0500658_0016258 Ga0500658_0016258_817_1662 255
228 3300060353 Ga0501082_0005208 Ga0501082_0005208_3272_4117 255
229 3300005337 Ga0070682_100146084 Ga0070682_1001460842 256
230 3300005338 Ga0068868_100002533 Ga0068868_1000025332 256
231 3300005341 Ga0070691_10000098 Ga0070691_1000009818 256
232 3300005365 Ga0070688_100000151 Ga0070688_10000015126 256
233 3300005365 Ga0070688_100000258 Ga0070688_10000025812 256
234 3300005466 Ga0070685_10000092 Ga0070685_1000009220 256
235 3300005466 Ga0070685_10000360 Ga0070685_1000036013 256
236 3300005539 Ga0068853_100022191 Ga0068853_1000221917 256
237 3300005545 Ga0070695_100295246 Ga0070695_1002952461 256
238 3300005614 Ga0068856_100036766 Ga0068856_1000367666 256
239 3300005616 Ga0068852_100000195 Ga0068852_1000001959 256
240 3300005719 Ga0068861_100535186 Ga0068861_1005351862 256
241 3300005834 Ga0068851_10016790 Ga0068851_100167902 256
242 3300005841 Ga0068863_100018094 Ga0068863_1000180942 256
243 3300005937 Ga0081455_10019516 Ga0081455_100195165 256
244 3300006881 Ga0068865_100000009 Ga0068865_10000000961 256
245 3300009098 Ga0105245_10000012 Ga0105245_10000012187 256
246 3300009098 Ga0105245_10000067 Ga0105245_10000067111 256
247 3300009176 Ga0105242_10000904 Ga0105242_1000090411 256
248 3300013102 Ga0157371_10006368 Ga0157371_100063685 256
249 3300013104 Ga0157370_10024314 Ga0157370_100243147 256
250 3300017792 Ga0163161_10098365 Ga0163161_100983652 256
251 3300025321 Ga0207656_10003944 Ga0207656_100039445 256
252 3300025927 Ga0207687_10000011 Ga0207687_10000011241 256
253 3300025927 Ga0207687_10000012 Ga0207687_10000012245 256
254 3300025935 Ga0207709_10002634 Ga0207709_100026345 256
255 3300025938 Ga0207704_10000009 Ga0207704_10000009166 256
256 3300025941 Ga0207711_10000024 Ga0207711_1000002425 256
257 3300025986 Ga0207658_10029902 Ga0207658_100299022 256
258 3300026023 Ga0207677_10000605 Ga0207677_100006057 256
259 3300026078 Ga0207702_10001236 Ga0207702_100012366 256
260 3300026088 Ga0207641_10013003 Ga0207641_100130037 256
261 3300026142 Ga0207698_10000009 Ga0207698_10000009137 256
262 3300041486 Ga0451807_0881530 Ga0451807_0881530_329_1177 256
263 3300041486 Ga0451807_2523630 Ga0451807_2523630_258_1106 256
264 3300044694 Ga0466963_0012604 Ga0466963_0012604_1179_2027 256
265 3300044842 Ga0466957_0000232 Ga0466957_0000232_6786_7634 256
266 3300046455 Ga0495603_0000022 Ga0495603_0000022_14272_15123 256
267 3300046459 Ga0495629_0000674 Ga0495629_0000674_26559_27407 256
268 3300046514 Ga0495618_0000003 Ga0495618_0000003_196278_197129 256
269 3300046514 Ga0495618_0168828 Ga0495618_0168828_61_909 256
270 3300046809 Ga0495600_0001113 Ga0495600_0001113_9315_10166 256
271 3300047320 Ga0495672_0087420 Ga0495672_0087420_794_1642 256
272 3300047321 Ga0495676_0001589 Ga0495676_0001589_13092_13940 256
273 3300047322 Ga0495680_0031381 Ga0495680_0031381_2287_3135 256
274 3300048903 Ga0496100_0000027 Ga0496100_0000027_86459_87307 256
275 3300048904 Ga0496101_0000012 Ga0496101_0000012_129047_129895 256
276 3300048909 Ga0496106_0000020 Ga0496106_0000020_28548_29396 256
277 3300048910 Ga0496107_0000014 Ga0496107_0000014_28537_29385 256
278 3300048911 Ga0496108_0000012 Ga0496108_0000012_120589_121437 256
279 3300048912 Ga0496109_0000057 Ga0496109_0000057_103875_104723 256
280 3300048914 Ga0496111_0204560 Ga0496111_0204560_214_1062 256
281 3300048919 Ga0496116_0000500 Ga0496116_0000500_21114_21962 256
282 3300048922 Ga0496119_0001539 Ga0496119_0001539_21112_21960 256
283 3300048927 Ga0496124_0220159 Ga0496124_0220159_121_969 256
284 3300049592 Ga0501076_0031182 Ga0501076_0031182_1653_2501 256
285 3300005327 Ga0070658_10039587 Ga0070658_100395873 257
286 3300005329 Ga0070683_100031889 Ga0070683_1000318891 257
287 3300005330 Ga0070690_100101432 Ga0070690_1001014322 257
288 3300005335 Ga0070666_10021591 Ga0070666_100215914 257
289 3300005364 Ga0070673_100004686 Ga0070673_1000046863 257
290 3300005456 Ga0070678_100332482 Ga0070678_1003324821 257
291 3300005457 Ga0070662_100000015 Ga0070662_10000001533 257
292 3300005530 Ga0070679_100282042 Ga0070679_1002820422 257
293 3300005535 Ga0070684_100020009 Ga0070684_1000200092 257
294 3300005535 Ga0070684_100021991 Ga0070684_1000219914 257
295 3300005548 Ga0070665_100000128 Ga0070665_10000012822 257
296 3300005548 Ga0070665_100002491 Ga0070665_10000249117 257
297 3300005548 Ga0070665_100309719 Ga0070665_1003097192 257
298 3300005842 Ga0068858_100000350 Ga0068858_10000035040 257
299 3300006175 Ga0070712_100000142 Ga0070712_10000014229 257
300 3300006852 Ga0075433_10000307 Ga0075433_1000030721 257
301 3300009551 Ga0105238_10000014 Ga0105238_1000001439 257
302 3300009553 Ga0105249_10347919 Ga0105249_103479192 257
303 3300013296 Ga0157374_10110668 Ga0157374_101106683 257
304 3300013296 Ga0157374_10113022 Ga0157374_101130222 257
305 3300013308 Ga0157375_10266217 Ga0157375_102662172 257
306 3300013308 Ga0157375_10691736 Ga0157375_106917362 257
307 3300025909 Ga0207705_10033101 Ga0207705_100331013 257
308 3300025912 Ga0207707_10246398 Ga0207707_102463982 257
309 3300025915 Ga0207693_10002948 Ga0207693_100029487 257
310 3300025924 Ga0207694_10000008 Ga0207694_10000008199 257
311 3300025933 Ga0207706_10000062 Ga0207706_1000006275 257
312 3300025934 Ga0207686_10009806 Ga0207686_100098064 257
313 3300025944 Ga0207661_10003104 Ga0207661_100031044 257
314 3300025945 Ga0207679_10119409 Ga0207679_101194092 257
315 3300025960 Ga0207651_10019743 Ga0207651_100197433 257
316 3300026035 Ga0207703_10000185 Ga0207703_1000018540 257
317 3300026142 Ga0207698_10304150 Ga0207698_103041502 257
318 3300028379 Ga0268266_10000023 Ga0268266_10000023102 257
319 3300028379 Ga0268266_10001616 Ga0268266_1000161619 257
320 3300028379 Ga0268266_10265022 Ga0268266_102650222 257
321 3300028379 Ga0268266_10266425 Ga0268266_102664252 257
322 3300028556 Ga0265337_1000041 Ga0265337_100004136 257
323 3300028558 Ga0265326_10000015 Ga0265326_10000015108 257
324 3300028558 Ga0265326_10042834 Ga0265326_100428342 257
325 3300028563 Ga0265319_1000269 Ga0265319_100026934 257
326 3300028654 Ga0265322_10000003 Ga0265322_1000000370 257
327 3300028666 Ga0265336_10001926 Ga0265336_100019265 257
328 3300028666 Ga0265336_10035101 Ga0265336_100351012 257
329 3300028800 Ga0265338_10000383 Ga0265338_1000038329 257
330 3300029957 Ga0265324_10000453 Ga0265324_1000045323 257
331 3300029957 Ga0265324_10010022 Ga0265324_100100224 257
332 3300031239 Ga0265328_10000317 Ga0265328_100003174 257
333 3300031240 Ga0265320_10000001 Ga0265320_1000000170 257
334 3300031241 Ga0265325_10003689 Ga0265325_100036895 257
335 3300031242 Ga0265329_10031923 Ga0265329_100319232 257
336 3300031249 Ga0265339_10026918 Ga0265339_100269182 257
337 3300031250 Ga0265331_10000931 Ga0265331_1000093111 257
338 3300031251 Ga0265327_10000003 Ga0265327_1000000370 257
339 3300031344 Ga0265316_10026849 Ga0265316_100268495 257
340 3300031711 Ga0265314_10000356 Ga0265314_100003568 257
341 3300046454 Ga0495592_0000749 Ga0495592_0000749_5419_6270 257
342 3300046459 Ga0495629_0000028 Ga0495629_0000028_93902_94753 257
343 3300046459 Ga0495629_0160924 Ga0495629_0160924_367_1218 257
344 3300046461 Ga0495641_0021785 Ga0495641_0021785_841_1692 257
345 3300046476 Ga0495662_0004617 Ga0495662_0004617_4009_4860 257
346 3300046517 Ga0495630_0000115 Ga0495630_0000115_51364_52215 257
347 3300046517 Ga0495630_0134323 Ga0495630_0134323_392_1243 257
348 3300046533 Ga0495640_0001957 Ga0495640_0001957_13518_14369 257
349 3300046536 Ga0495587_0004142 Ga0495587_0004142_8350_9201 257
350 3300046537 Ga0495598_0010040 Ga0495598_0010040_297_1148 257
351 3300046543 Ga0495645_0118686 Ga0495645_0118686_345_1196 257
352 3300046642 Ga0495634_0003817 Ga0495634_0003817_1589_2440 257
353 3300046642 Ga0495634_0049023 Ga0495634_0049023_1553_2404 257
354 3300046663 Ga0495635_0000006 Ga0495635_0000006_252466_253317 257
355 3300046663 Ga0495635_0040276 Ga0495635_0040276_54_908 257
356 3300046674 Ga0495588_0000195 Ga0495588_0000195_23555_24406 257
357 3300046675 Ga0495657_0000002 Ga0495657_0000002_344754_345605 257
358 3300046681 Ga0495647_0001270 Ga0495647_0001270_3654_4505 257
359 3300046683 Ga0495658_0207796 Ga0495658_0207796_182_1033 257
360 3300046684 Ga0495669_0018302 Ga0495669_0018302_1484_2335 257
361 3300046689 Ga0495613_0128974 Ga0495613_0128974_946_1797 257
362 3300046690 Ga0495624_0000149 Ga0495624_0000149_40533_41384 257
363 3300046690 Ga0495624_0006553 Ga0495624_0006553_2188_3042 257
364 3300047321 Ga0495676_0084081 Ga0495676_0084081_954_1808 257
365 3300047322 Ga0495680_0001393 Ga0495680_0001393_2335_3186 257
366 3300047322 Ga0495680_0083808 Ga0495680_0083808_179_1030 257
367 3300047444 Ga0495675_0000104 Ga0495675_0000104_6304_7155 257
368 3300047471 Ga0495684_0084173 Ga0495684_0084173_1409_2260 257
369 3300048907 Ga0496104_0000243 Ga0496104_0000243_15257_16108 257
370 3300048908 Ga0496105_0000622 Ga0496105_0000622_958_1809 257
371 3300048912 Ga0496109_0000035 Ga0496109_0000035_10447_11298 257
372 3300048912 Ga0496109_0099399 Ga0496109_0099399_82_933 257
373 3300048913 Ga0496110_0003956 Ga0496110_0003956_8103_8954 257
374 3300048913 Ga0496110_0064445 Ga0496110_0064445_2222_3073 257
375 3300048915 Ga0496112_0085741 Ga0496112_0085741_1344_2195 257
376 3300048917 Ga0496114_0000080 Ga0496114_0000080_19351_20202 257
377 3300048917 Ga0496114_0087006 Ga0496114_0087006_413_1264 257
378 3300048917 Ga0496114_0162632 Ga0496114_0162632_811_1662 257
379 3300048918 Ga0496115_0000004 Ga0496115_0000004_109053_109904 257
380 3300048918 Ga0496115_0000104 Ga0496115_0000104_61574_62425 257
381 3300049591 Ga0501075_0289639 Ga0501075_0289639_58_909 257
382 3300050515 nmdc:mga0a205_1_c2 nmdc:mga0a205_1_c2_28072_28923 257
383 3300053078 Ga0495612_0001971 Ga0495612_0001971_7440_8291 257
384 3300053083 Ga0495655_0000012 Ga0495655_0000012_58150_59001 257
385 3300053084 Ga0495595_0000001 Ga0495595_0000001_66354_67205 257
386 3300053085 Ga0495619_0000094 Ga0495619_0000094_13023_13874 257
387 3300053085 Ga0495619_0000745 Ga0495619_0000745_16993_17844 257
388 3300053085 Ga0495619_0001141 Ga0495619_0001141_7985_8836 257
389 3300053129 Ga0500628_000014 Ga0500628_000014_78814_79665 257
390 3300001977 JGI24746J21847_1000342 JGI24746J21847_10003425 258
391 3300002074 JGI24748J21848_1000384 JGI24748J21848_10003845 258
392 3300002239 JGI24034J26672_10000353 JGI24034J26672_100003535 258
393 3300005329 Ga0070683_100293409 Ga0070683_1002934092 258
394 3300005333 Ga0070677_10000019 Ga0070677_1000001910 258
395 3300005337 Ga0070682_100000038 Ga0070682_10000003857 258
396 3300005338 Ga0068868_100000175 Ga0068868_1000001752 258
397 3300005341 Ga0070691_10007033 Ga0070691_100070335 258
398 3300005356 Ga0070674_100000016 Ga0070674_10000001686 258
399 3300005356 Ga0070674_100000105 Ga0070674_10000010518 258
400 3300005441 Ga0070700_100011612 Ga0070700_1000116125 258
401 3300005441 Ga0070700_100052817 Ga0070700_1000528172 258
402 3300005535 Ga0070684_100001385 Ga0070684_1000013859 258
403 3300005547 Ga0070693_100003601 Ga0070693_1000036012 258
404 3300005718 Ga0068866_10000006 Ga0068866_1000000643 258
405 3300005718 Ga0068866_10000220 Ga0068866_1000022026 258
406 3300005841 Ga0068863_100000039 Ga0068863_10000003932 258
407 3300005843 Ga0068860_100001352 Ga0068860_1000013522 258
408 3300006163 Ga0070715_10000003 Ga0070715_1000000392 258
409 3300006847 Ga0075431_100087667 Ga0075431_1000876673 258
410 3300006852 Ga0075433_10003841 Ga0075433_100038415 258
411 3300009098 Ga0105245_10000246 Ga0105245_1000024622 258
412 3300009101 Ga0105247_10000110 Ga0105247_1000011040 258
413 3300009176 Ga0105242_10256676 Ga0105242_102566762 258
414 3300013297 Ga0157378_10009467 Ga0157378_100094675 258
415 3300014325 Ga0163163_10181360 Ga0163163_101813602 258
416 3300014326 Ga0157380_10000300 Ga0157380_1000030018 258
417 3300025893 Ga0207682_10000090 Ga0207682_1000009028 258
418 3300025899 Ga0207642_10000001 Ga0207642_10000001160 258
419 3300025899 Ga0207642_10000003 Ga0207642_10000003160 258
420 3300025899 Ga0207642_10000004 Ga0207642_10000004160 258
421 3300025899 Ga0207642_10001124 Ga0207642_100011244 258
422 3300025900 Ga0207710_10000138 Ga0207710_1000013868 258
423 3300025905 Ga0207685_10000003 Ga0207685_1000000392 258
424 3300025927 Ga0207687_10000325 Ga0207687_1000032518 258
425 3300025934 Ga0207686_10026625 Ga0207686_100266252 258
426 3300025937 Ga0207669_10000037 Ga0207669_100000374 258
427 3300025937 Ga0207669_10000070 Ga0207669_1000007046 258
428 3300025944 Ga0207661_10007210 Ga0207661_100072104 258
429 3300025944 Ga0207661_10009813 Ga0207661_100098137 258
430 3300026023 Ga0207677_10000239 Ga0207677_100002392 258
431 3300026075 Ga0207708_10064920 Ga0207708_100649203 258
432 3300026088 Ga0207641_10000072 Ga0207641_1000007254 258
433 3300026121 Ga0207683_10087729 Ga0207683_100877291 258
434 3300030521 Ga0307511_10093350 Ga0307511_100933502 258
435 3300035120 Ga0373957_0042502 Ga0373957_0042502_594_1448 258
436 3300041512 Ga0451853_2595654 Ga0451853_2595654_1884_2738 258
437 3300044694 Ga0466963_0000002 Ga0466963_0000002_35089_35943 258
438 3300045976 Ga0466967_0346537 Ga0466967_0346537_415_1269 258
439 3300046455 Ga0495603_0010022 Ga0495603_0010022_2535_3389 258
440 3300046463 Ga0495653_0023800 Ga0495653_0023800_2048_2902 258
441 3300046473 Ga0495582_0000048 Ga0495582_0000048_39888_40742 258
442 3300046516 Ga0495628_0041977 Ga0495628_0041977_492_1346 258
443 3300046523 Ga0495644_0000528 Ga0495644_0000528_3328_4182 258
444 3300046539 Ga0495621_0005188 Ga0495621_0005188_252_1106 258
445 3300046559 Ga0495667_0000057 Ga0495667_0000057_40074_40934 258
446 3300046680 Ga0495646_0077125 Ga0495646_0077125_80_934 258
447 3300046681 Ga0495647_0000858 Ga0495647_0000858_1542_2396 258
448 3300046683 Ga0495658_0000031 Ga0495658_0000031_39851_40705 258
449 3300046691 Ga0495670_0004840 Ga0495670_0004840_1777_2631 258
450 3300047322 Ga0495680_0000185 Ga0495680_0000185_49643_50497 258
451 3300047322 Ga0495680_0000324 Ga0495680_0000324_37425_38285 258
452 3300048907 Ga0496104_0000002 Ga0496104_0000002_276250_277104 258
453 3300048908 Ga0496105_0000001 Ga0496105_0000001_1051075_1051929 258
454 3300048909 Ga0496106_0000096 Ga0496106_0000096_33205_34059 258
455 3300048910 Ga0496107_0054505 Ga0496107_0054505_614_1468 258
456 3300048910 Ga0496107_0105292 Ga0496107_0105292_202_1059 258
457 3300048911 Ga0496108_0007459 Ga0496108_0007459_2301_3155 258
458 3300048913 Ga0496110_0188650 Ga0496110_0188650_901_1758 258
459 3300048914 Ga0496111_0125460 Ga0496111_0125460_81_938 258
460 3300048915 Ga0496112_0000002 Ga0496112_0000002_410723_411577 258
461 3300048916 Ga0496113_0012576 Ga0496113_0012576_1882_2736 258
462 3300048916 Ga0496113_0029642 Ga0496113_0029642_2096_2950 258
463 3300048922 Ga0496119_0095568 Ga0496119_0095568_548_1402 258
464 3300048923 Ga0496120_0084417 Ga0496120_0084417_458_1312 258
465 3300049591 Ga0501075_0004618 Ga0501075_0004618_3610_4464 258
466 3300049824 Ga0501045_0310436 Ga0501045_0310436_305_1159 258
467 3300050515 nmdc:mga0a205_5429_c1 nmdc:mga0a205_5429_c1_3223_4077 258
468 3300053078 Ga0495612_0012977 Ga0495612_0012977_2402_3256 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

1

264

0.97

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

3

182

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kpq-assembly1.cif.gz_A crystal structure of ctde in complex with fad 0.9682 1 30
4j31-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase (kmo-396prot) 0.9676 2 29
5nmw-assembly1.cif.gz_A-2 crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.9672 2 30
5nmw-assembly2.cif.gz_D crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.9659 2 30
4bk3-assembly1.cif.gz_A-2 crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: y105f mutant 0.9429 2 32
ID Description Score Start End Superfamily
af_P77337_1_424_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9279 2 29 3.50.50.60
3ihgC01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9138 2 29 3.50.50.60
2y6qB00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9035 2 29 3.50.50.60
af_E0AHD3_2_449_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.885 1 30 3.50.50.60
2vouC01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8844 2 32 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A858RJT1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9128 2 56 GO:0016616
GO:0030497
AF-A0A357CVY4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9055 2 61 GO:0016616
AF-A0A353KDK4-F1-model_v4 deleted 0.8951 2 60
AF-A0A414LVQ2-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.885 2 62 GO:0016616
AF-A0A538BTA0-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.8831 1 61 GO:0050577

Feature Viewer

pLDDT pTM Quality
60.9 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map