F450109

General Info

Members Datasets Scaffolds Average Seq Length
468 258 936 76

Family's Representative Sequence

Representative Sequence 3300046559|Ga0495667_0237748|Ga0495667_0237748_560_814
Length 84
Sequence VTERPEIDQMVGRLLGPSAPEVGCDECFDELDRFVELDLAGRDADAAIPGLRAHLAGCPACREEYESLRALVASDAGVDAPPGD

Samples

Sample ID Description Type Environment
1 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
138 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
148 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
149 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
150 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
151 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
152 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
153 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
154 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
157 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
158 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
159 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
160 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
161 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
162 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
163 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
164 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
165 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
166 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
167 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
168 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
169 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
170 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
255 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
258 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.56
Nodule 0
Rhizoplane 8.33
Rhizosphere 87.61
Stem 0
Stem Tuber 0
Unclassified 10.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495667_0237748 3300046559 Bacteria 1161
2 rootH2_10204812 3300003320 Bacteria 1986
3 JGI25405J52794_10048495 3300003911 Bacteria 907
4 Ga0070658_10548724 3300005327 Bacteria 1000
5 Ga0070676_11026013 3300005328 Bacteria 620
6 Ga0070683_100006939 3300005329 Bacteria 9521
7 Ga0070683_100152490 3300005329 Bacteria 2191
8 Ga0070683_101143408 3300005329 Bacteria 748
9 Ga0070683_102114605 3300005329 Bacteria 541
10 Ga0070670_100598472 3300005331 Bacteria 986
11 Ga0070666_11073371 3300005335 Bacteria 598
12 Ga0070680_100616405 3300005336 Bacteria 932
13 Ga0070680_100829850 3300005336 Bacteria 797
14 Ga0070680_100881340 3300005336 Unclassified 772
15 Ga0070682_100409716 3300005337 Bacteria 1027
16 Ga0068868_100070196 3300005338 Bacteria 2793
17 Ga0068868_100532775 3300005338 Bacteria 1033
18 Ga0070660_100699142 3300005339 Bacteria 850
19 Ga0070691_10069720 3300005341 Unclassified 1705
20 Ga0070687_100274651 3300005343 Bacteria 1058
21 Ga0070687_100629241 3300005343 Bacteria 741
22 Ga0070661_100120734 3300005344 Bacteria 1963
23 Ga0070668_100954719 3300005347 Bacteria 769
24 Ga0070675_100367744 3300005354 Bacteria 1278
25 Ga0070675_100473470 3300005354 Bacteria 1126
26 Ga0070671_100026115 3300005355 Bacteria 4798
27 Ga0070674_100296188 3300005356 Unclassified 1288
28 Ga0070673_101765473 3300005364 Bacteria 586
29 Ga0070714_100042957 3300005435 Bacteria 3820
30 Ga0070714_100588164 3300005435 Bacteria 1068
31 Ga0070713_100113264 3300005436 Bacteria 2368
32 Ga0070711_100017562 3300005439 Unclassified 4558
33 Ga0070711_100514255 3300005439 Bacteria 989
34 Ga0070705_100583897 3300005440 Bacteria 862
35 Ga0070700_100381899 3300005441 Bacteria 1054
36 Ga0070708_102242757 3300005445 Bacteria 504
37 Ga0070678_100274732 3300005456 Unclassified 1422
38 Ga0070678_100991016 3300005456 Bacteria 772
39 Ga0070678_101971627 3300005456 Unclassified 552
40 Ga0070681_10177344 3300005458 Bacteria 2053
41 Ga0070681_10198916 3300005458 Bacteria 1923
42 Ga0070681_10332184 3300005458 Bacteria 1430
43 Ga0070698_100818805 3300005471 Bacteria 875
44 Ga0070679_100038323 3300005530 Bacteria 4764
45 Ga0070679_100331416 3300005530 Bacteria 1470
46 Ga0070679_100780486 3300005530 Bacteria 899
47 Ga0070684_100098139 3300005535 Bacteria 2613
48 Ga0070684_100205084 3300005535 Bacteria 1796
49 Ga0068853_102490858 3300005539 Bacteria 501
50 Ga0070672_100270699 3300005543 Bacteria 1434
51 Ga0070686_100069268 3300005544 Unclassified 2304
52 Ga0070696_100879762 3300005546 Unclassified 742
53 Ga0070693_100004354 3300005547 Bacteria 6684
54 Ga0070693_100745762 3300005547 Unclassified 721
55 Ga0070693_101632965 3300005547 Bacteria 507
56 Ga0070704_100003595 3300005549 Bacteria 8910
57 Ga0070664_100009206 3300005564 Bacteria 8017
58 Ga0070664_102079426 3300005564 Bacteria 539
59 Ga0068857_100130838 3300005577 Bacteria 2263
60 Ga0068857_100411943 3300005577 Bacteria 1259
61 Ga0068857_100427517 3300005577 Bacteria 1236
62 Ga0068854_100038961 3300005578 Bacteria 3345
63 Ga0068854_100504148 3300005578 Bacteria 1020
64 Ga0068854_101803971 3300005578 Bacteria 561
65 Ga0068856_100006197 3300005614 Bacteria 11733
66 Ga0068856_100626505 3300005614 Unclassified 1096
67 Ga0068856_100868709 3300005614 Bacteria 921
68 Ga0068856_101901928 3300005614 Bacteria 606
69 Ga0070702_100071723 3300005615 Bacteria 2048
70 Ga0068852_102469686 3300005616 Bacteria 540
71 Ga0068864_100021045 3300005618 Bacteria 5462
72 Ga0068864_101260044 3300005618 Bacteria 739
73 Ga0068870_10701847 3300005840 Unclassified 698
74 Ga0068858_100472101 3300005842 Unclassified 1210
75 Ga0068862_100267591 3300005844 Bacteria 1562
76 Ga0068862_101113829 3300005844 Bacteria 785
77 Ga0081455_10038797 3300005937 Bacteria 4216
78 Ga0081455_10220790 3300005937 Bacteria 1405
79 Ga0081455_10516257 3300005937 Bacteria 798
80 Ga0081455_10571147 3300005937 Bacteria 743
81 Ga0081538_10062341 3300005981 Bacteria 2127
82 Ga0081538_10106037 3300005981 Bacteria 1397
83 Ga0081538_10251586 3300005981 Bacteria 673
84 Ga0081539_10006841 3300005985 Bacteria 10664
85 Ga0070717_10417967 3300006028 Bacteria 1206
86 Ga0075365_10196528 3300006038 Unclassified 1412
87 Ga0075368_10036139 3300006042 Bacteria 1929
88 Ga0075364_10045982 3300006051 Bacteria 2841
89 Ga0070716_100095215 3300006173 Bacteria 1812
90 Ga0070716_101035641 3300006173 Bacteria 651
91 Ga0070712_100004685 3300006175 Bacteria 8454
92 Ga0070712_100093938 3300006175 Bacteria 2203
93 Ga0075367_10076818 3300006178 Bacteria 2016
94 Ga0075367_10475592 3300006178 Bacteria 792
95 Ga0075366_10507487 3300006195 Bacteria 746
96 Ga0097621_100972260 3300006237 Bacteria 793
97 Ga0068871_101258432 3300006358 Bacteria 695
98 Ga0068871_101537845 3300006358 Unclassified 629
99 Ga0075430_100609397 3300006846 Bacteria 901
100 Ga0075431_101786465 3300006847 Unclassified 571
101 Ga0075434_100683946 3300006871 Bacteria 1044
102 Ga0075434_101089835 3300006871 Bacteria 812
103 Ga0075429_101137212 3300006880 Unclassified 682
104 Ga0068865_100523140 3300006881 Bacteria 992
105 Ga0097620_101180101 3300006931 Unclassified 843
106 Ga0075435_100202487 3300007076 Bacteria 1682
107 Ga0075435_100446016 3300007076 Bacteria 1116
108 Ga0111539_10016075 3300009094 Bacteria 9288
109 Ga0111539_10025887 3300009094 Bacteria 7181
110 Ga0111539_10134678 3300009094 Bacteria 2893
111 Ga0111539_10255682 3300009094 Bacteria 2040
112 Ga0111539_10426896 3300009094 Bacteria 1544
113 Ga0105245_10354726 3300009098 Bacteria 1454
114 Ga0105245_11494302 3300009098 Bacteria 726
115 Ga0105245_11522405 3300009098 Bacteria 720
116 Ga0114129_10058683 3300009147 Bacteria 5383
117 Ga0114129_10527943 3300009147 Bacteria 1538
118 Ga0105241_10624781 3300009174 Bacteria 976
119 Ga0105241_11421367 3300009174 Bacteria 665
120 Ga0105242_11710740 3300009176 Unclassified 665
121 Ga0105248_11705195 3300009177 Bacteria 714
122 Ga0105238_10908564 3300009551 Bacteria 899
123 Ga0105249_10870683 3300009553 Bacteria 967
124 Ga0105249_11200764 3300009553 Bacteria 829
125 Ga0105239_10056775 3300010375 Bacteria 4295
126 Ga0105239_11305881 3300010375 Bacteria 837
127 Ga0105239_11701974 3300010375 Bacteria 730
128 Ga0105239_13125440 3300010375 Bacteria 539
129 Ga0105239_13547591 3300010375 Bacteria 507
130 Ga0105246_10116941 3300011119 Bacteria 1969
131 Ga0105246_10903242 3300011119 Bacteria 792
132 Ga0157371_10456816 3300013102 Bacteria 939
133 Ga0157371_11438615 3300013102 Bacteria 536
134 Ga0157370_10483172 3300013104 Bacteria 1138
135 Ga0157369_10265092 3300013105 Bacteria 1791
136 Ga0157374_10171282 3300013296 Bacteria 2118
137 Ga0157374_10270557 3300013296 Bacteria 1675
138 Ga0157372_10452402 3300013307 Bacteria 1496
139 Ga0157372_10825137 3300013307 Bacteria 1077
140 Ga0157375_11308821 3300013308 Bacteria 852
141 Ga0157375_12322231 3300013308 Bacteria 640
142 Ga0163163_10774211 3300014325 Unclassified 1023
143 Ga0182008_10497309 3300014497 Bacteria 670
144 Ga0182008_10525424 3300014497 Unclassified 654
145 Ga0157377_10023752 3300014745 Bacteria 3253
146 Ga0157377_10166409 3300014745 Bacteria 1375
147 Ga0182005_1116514 3300015265 Unclassified 758
148 Ga0206353_10804249 3300020082 Bacteria 1577
149 Ga0213876_10643718 3300021384 Bacteria 564
150 Ga0207692_10199704 3300025898 Bacteria 1175
151 Ga0207692_10675292 3300025898 Unclassified 669
152 Ga0207680_10975550 3300025903 Bacteria 607
153 Ga0207643_10255085 3300025908 Bacteria 1081
154 Ga0207705_10500975 3300025909 Unclassified 943
155 Ga0207705_11434492 3300025909 Bacteria 524
156 Ga0207707_10028093 3300025912 Bacteria 4917
157 Ga0207707_10220521 3300025912 Bacteria 1651
158 Ga0207707_10483527 3300025912 Bacteria 1057
159 Ga0207693_10013113 3300025915 Bacteria 6686
160 Ga0207693_10025613 3300025915 Bacteria 4676
161 Ga0207693_10961509 3300025915 Bacteria 653
162 Ga0207663_10058431 3300025916 Bacteria 2434
163 Ga0207663_10318123 3300025916 Bacteria 1169
164 Ga0207660_10711163 3300025917 Unclassified 819
165 Ga0207660_10742751 3300025917 Bacteria 801
166 Ga0207662_10450456 3300025918 Bacteria 880
167 Ga0207662_10742446 3300025918 Bacteria 690
168 Ga0207657_10116388 3300025919 Bacteria 2203
169 Ga0207657_11058267 3300025919 Unclassified 621
170 Ga0207649_10003056 3300025920 Bacteria 9191
171 Ga0207649_10575921 3300025920 Bacteria 864
172 Ga0207649_11565872 3300025920 Bacteria 522
173 Ga0207652_10689068 3300025921 Bacteria 912
174 Ga0207652_11326595 3300025921 Bacteria 622
175 Ga0207694_10469545 3300025924 Unclassified 1052
176 Ga0207650_10347958 3300025925 Bacteria 1219
177 Ga0207659_10309563 3300025926 Bacteria 1300
178 Ga0207659_11426133 3300025926 Bacteria 593
179 Ga0207687_10737704 3300025927 Bacteria 838
180 Ga0207700_10287133 3300025928 Bacteria 1417
181 Ga0207664_10883986 3300025929 Bacteria 803
182 Ga0207644_10234009 3300025931 Bacteria 1461
183 Ga0207644_11545651 3300025931 Bacteria 557
184 Ga0207709_11472889 3300025935 Bacteria 564
185 Ga0207669_10346682 3300025937 Bacteria 1146
186 Ga0207669_10384455 3300025937 Unclassified 1095
187 Ga0207665_10165909 3300025939 Bacteria 1592
188 Ga0207689_10479412 3300025942 Bacteria 1041
189 Ga0207661_10000864 3300025944 Bacteria 19886
190 Ga0207661_10017485 3300025944 Bacteria 5309
191 Ga0207661_10616752 3300025944 Unclassified 996
192 Ga0207661_11780473 3300025944 Bacteria 561
193 Ga0207679_10180486 3300025945 Bacteria 1746
194 Ga0207679_10185752 3300025945 Bacteria 1723
195 Ga0207651_11867628 3300025960 Bacteria 540
196 Ga0207712_10612018 3300025961 Bacteria 943
197 Ga0207640_10105937 3300025981 Bacteria 1982
198 Ga0207640_11051453 3300025981 Bacteria 718
199 Ga0207640_11263483 3300025981 Bacteria 658
200 Ga0207677_10043872 3300026023 Bacteria 2975
201 Ga0207677_10525883 3300026023 Bacteria 1027
202 Ga0207677_11457454 3300026023 Bacteria 631
203 Ga0207703_11357960 3300026035 Bacteria 684
204 Ga0207639_11765497 3300026041 Bacteria 579
205 Ga0207708_10120974 3300026075 Bacteria 2040
206 Ga0207702_10009154 3300026078 Bacteria 8332
207 Ga0207702_10605148 3300026078 Unclassified 1076
208 Ga0207648_11732420 3300026089 Bacteria 586
209 Ga0207676_11196311 3300026095 Bacteria 753
210 Ga0207674_10036831 3300026116 Bacteria 5093
211 Ga0207674_10349326 3300026116 Bacteria 1430
212 Ga0207674_10368894 3300026116 Bacteria 1388
213 Ga0207675_100449058 3300026118 Bacteria 1277
214 Ga0207683_10089890 3300026121 Unclassified 2734
215 Ga0207683_11134828 3300026121 Bacteria 725
216 Ga0207428_10061175 3300027907 Bacteria 2982
217 Ga0207428_10188472 3300027907 Bacteria 1555
218 Ga0207428_10476951 3300027907 Bacteria 908
219 Ga0268266_11291452 3300028379 Bacteria 705
220 Ga0268266_11858205 3300028379 Unclassified 577
221 Ga0268265_10412382 3300028380 Bacteria 1252
222 Ga0268265_11486330 3300028380 Bacteria 681
223 Ga0307408_100552566 3300031548 Unclassified 1016
224 Ga0307405_11428502 3300031731 Unclassified 606
225 Ga0307412_10701319 3300031911 Bacteria 869
226 Ga0307409_100104867 3300031995 Bacteria 2356
227 Ga0307409_101904251 3300031995 Bacteria 624
228 Ga0307409_102961910 3300031995 Bacteria 501
229 Ga0307416_100675742 3300032002 Bacteria 1120
230 Ga0307416_100981508 3300032002 Unclassified 947
231 Ga0307415_100008142 3300032126 Bacteria 5793
232 Ga0307415_102320684 3300032126 Unclassified 526
233 Ga0373961_0224650 3300035241 Bacteria 671
234 Ga0373962_0171637 3300035242 Bacteria 720
235 Ga0373947_0730329 3300035725 Bacteria 676
236 Ga0373937_1061328 3300036401 Bacteria 759
237 Ga0395899_0006592 3300037312 Bacteria 8995
238 Ga0395899_0066507 3300037312 Unclassified 2646
239 Ga0395900_0001810 3300037418 Bacteria 24466
240 Ga0395900_0243090 3300037418 Bacteria 1805
241 Ga0395900_1132637 3300037418 Unclassified 699
242 Ga0395898_0018860 3300037466 Bacteria 7029
243 Ga0395898_0069596 3300037466 Bacteria 3404
244 Ga0395898_1044350 3300037466 Bacteria 752
245 Ga0395905_0013593 3300037471 Bacteria 7798
246 Ga0395905_0392845 3300037471 Bacteria 1282
247 Ga0395905_0532183 3300037471 Bacteria 1076
248 Ga0395905_0608441 3300037471 Unclassified 995
249 Ga0395901_0010238 3300038443 Bacteria 9497
250 Ga0395901_0090580 3300038443 Bacteria 3201
251 Ga0395901_0166231 3300038443 Unclassified 2316
252 Ga0395901_1144022 3300038443 Bacteria 747
253 Ga0395901_1281793 3300038443 Bacteria 695
254 Ga0436365_0355175 3300039437 Bacteria 579
255 Ga0439439_0004574 3300041406 Bacteria 3128
256 Ga0451789_1085657 3300041443 Bacteria 665
257 Ga0451793_0308359 3300041452 Bacteria 954
258 Ga0451802_0085701 3300041460 Bacteria 674
259 Ga0451804_0096207 3300041463 Bacteria 1154
260 Ga0451839_0903188 3300041496 Bacteria 619
261 Ga0451849_1168296 3300041505 Bacteria 2057
262 Ga0451851_1023841 3300041507 Bacteria 991
263 Ga0451853_2486766 3300041512 Bacteria 1591
264 Ga0439431_0050501 3300041997 Bacteria 1077
265 Ga0439433_0042761 3300041999 Bacteria 1057
266 Ga0439448_0028929 3300042005 Bacteria 1752
267 Ga0439448_0168451 3300042005 Unclassified 764
268 Ga0439450_097981 3300042008 Bacteria 742
269 Ga0439451_082571 3300042009 Bacteria 646
270 Ga0439456_068464 3300042013 Bacteria 785
271 Ga0439462_0000555 3300042015 Bacteria 7394
272 Ga0439463_064218 3300042016 Bacteria 939
273 Ga0450922_035967 3300042124 Bacteria 551
274 Ga0450898_120784 3300042134 Bacteria 559
275 Ga0450902_007814 3300042137 Bacteria 1662
276 Ga0450906_004386 3300042145 Bacteria 2959
277 Ga0439446_0002209 3300042156 Bacteria 4642
278 Ga0439459_0027868 3300042438 Bacteria 1130
279 Ga0439440_0095730 3300042993 Bacteria 802
280 Ga0466963_0019815 3300044694 Bacteria 4224
281 Ga0466963_0027175 3300044694 Bacteria 3663
282 Ga0466963_1000061 3300044694 Bacteria 589
283 Ga0466971_0267239 3300044719 Bacteria 817
284 Ga0466957_0398967 3300044842 Bacteria 940
285 Ga0466959_0857008 3300045049 Bacteria 607
286 Ga0466967_0016414 3300045976 Bacteria 5840
287 Ga0466967_0058248 3300045976 Bacteria 3414
288 Ga0466967_0091959 3300045976 Bacteria 2758
289 Ga0466967_0465253 3300045976 Bacteria 1237
290 Ga0466967_1235039 3300045976 Bacteria 744
291 Ga0495653_0194187 3300046463 Bacteria 1383
292 Ga0495608_0177006 3300046511 Bacteria 1351
293 Ga0495628_0613926 3300046516 Bacteria 776
294 Ga0495652_0207272 3300046529 Bacteria 1483
295 Ga0495652_1038751 3300046529 Unclassified 534
296 Ga0495645_0355566 3300046543 Bacteria 943
297 Ga0495634_0069806 3300046642 Bacteria 2317
298 Ga0495635_0223573 3300046663 Bacteria 1273
299 Ga0495657_0746216 3300046675 Bacteria 561
300 Ga0495600_0567180 3300046809 Bacteria 692
301 Ga0495604_0810485 3300047317 Bacteria 589
302 Ga0495674_1265237 3300047319 Bacteria 555
303 Ga0495680_0395327 3300047322 Bacteria 955
304 Ga0495680_0685891 3300047322 Bacteria 678
305 Ga0495675_0673816 3300047444 Bacteria 581
306 Ga0495684_0628110 3300047471 Bacteria 721
307 Ga0495684_0816258 3300047471 Bacteria 608
308 Ga0495593_0376299 3300047673 Bacteria 710
309 Ga0495602_0670705 3300048088 Bacteria 706
310 Ga0496100_0003140 3300048903 Bacteria 8560
311 Ga0496100_0409799 3300048903 Unclassified 1034
312 Ga0496100_0488779 3300048903 Bacteria 947
313 Ga0496100_0909778 3300048903 Bacteria 691
314 Ga0496101_0005451 3300048904 Bacteria 8111
315 Ga0496101_0250822 3300048904 Bacteria 1379
316 Ga0496101_0882498 3300048904 Bacteria 704
317 Ga0496102_0052646 3300048905 Unclassified 3709
318 Ga0496102_0755131 3300048905 Bacteria 895
319 Ga0496102_0920772 3300048905 Bacteria 796
320 Ga0496102_0930997 3300048905 Bacteria 790
321 Ga0496103_0035484 3300048906 Unclassified 3053
322 Ga0496103_0211746 3300048906 Bacteria 1246
323 Ga0496104_0000278 3300048907 Bacteria 45634
324 Ga0496104_0386068 3300048907 Bacteria 1313
325 Ga0496105_0139318 3300048908 Bacteria 1997
326 Ga0496105_0791462 3300048908 Bacteria 722
327 Ga0496106_0196371 3300048909 Bacteria 1605
328 Ga0496107_0902367 3300048910 Bacteria 644
329 Ga0496108_0002990 3300048911 Bacteria 13582
330 Ga0496108_0264804 3300048911 Bacteria 1496
331 Ga0496109_0009286 3300048912 Bacteria 8379
332 Ga0496109_1856818 3300048912 Bacteria 535
333 Ga0496109_1893354 3300048912 Bacteria 529
334 Ga0496110_0016483 3300048913 Bacteria 6171
335 Ga0496110_0297706 3300048913 Bacteria 1470
336 Ga0496110_1149491 3300048913 Bacteria 685
337 Ga0496111_0008333 3300048914 Bacteria 6853
338 Ga0496112_0076295 3300048915 Bacteria 3315
339 Ga0496112_0384654 3300048915 Bacteria 1344
340 Ga0496113_0075358 3300048916 Unclassified 2575
341 Ga0496114_0133499 3300048917 Unclassified 2145
342 Ga0496114_0576667 3300048917 Unclassified 993
343 Ga0496114_1172755 3300048917 Bacteria 654
344 Ga0496115_0000616 3300048918 Bacteria 27043
345 Ga0501031_0010913 3300049568 Bacteria 5916
346 Ga0501031_0038088 3300049568 Bacteria 3139
347 Ga0501031_0453480 3300049568 Unclassified 828
348 Ga0501031_0811598 3300049568 Bacteria 600
349 Ga0501032_1061320 3300049569 Bacteria 508
350 Ga0501033_0160590 3300049570 Bacteria 1618
351 Ga0501033_0599600 3300049570 Bacteria 755
352 Ga0501036_0002524 3300049572 Bacteria 14364
353 Ga0501036_0047341 3300049572 Bacteria 3642
354 Ga0501036_0108780 3300049572 Bacteria 2343
355 Ga0501036_1083028 3300049572 Bacteria 655
356 Ga0501037_0071912 3300049573 Bacteria 2516
357 Ga0501037_0098688 3300049573 Bacteria 2110
358 Ga0501037_0293173 3300049573 Bacteria 1131
359 Ga0501038_0014110 3300049574 Bacteria 7278
360 Ga0501038_0303573 3300049574 Bacteria 1252
361 Ga0501038_0379203 3300049574 Bacteria 1097
362 Ga0501039_0011222 3300049575 Bacteria 6828
363 Ga0501039_0020844 3300049575 Bacteria 5025
364 Ga0501039_0102954 3300049575 Bacteria 2228
365 Ga0501040_0000959 3300049576 Bacteria 18211
366 Ga0501040_0051137 3300049576 Bacteria 2827
367 Ga0501040_0095039 3300049576 Bacteria 2074
368 Ga0501041_0021465 3300049577 Bacteria 3868
369 Ga0501041_0055623 3300049577 Bacteria 2416
370 Ga0501042_0010114 3300049578 Bacteria 6309
371 Ga0501042_0011961 3300049578 Bacteria 5865
372 Ga0501042_0015103 3300049578 Bacteria 5279
373 Ga0501042_0151712 3300049578 Bacteria 1671
374 Ga0501042_0860808 3300049578 Bacteria 660
375 Ga0501043_0170638 3300049579 Bacteria 1697
376 Ga0501046_0045585 3300049580 Bacteria 3483
377 Ga0501046_0188633 3300049580 Bacteria 1539
378 Ga0501048_0014367 3300049582 Bacteria 5864
379 Ga0501048_0016605 3300049582 Bacteria 5428
380 Ga0501048_0076854 3300049582 Bacteria 2356
381 Ga0501048_0887292 3300049582 Bacteria 641
382 Ga0501048_0954305 3300049582 Bacteria 617
383 Ga0501067_0024545 3300049583 Bacteria 3344
384 Ga0501067_0060413 3300049583 Bacteria 2098
385 Ga0501068_0006738 3300049584 Bacteria 6347
386 Ga0501068_0063187 3300049584 Bacteria 2252
387 Ga0501069_0037789 3300049585 Bacteria 2664
388 Ga0501069_0300699 3300049585 Bacteria 941
389 Ga0501070_0560655 3300049586 Bacteria 914
390 Ga0501071_0021135 3300049587 Bacteria 4532
391 Ga0501071_0021276 3300049587 Bacteria 4515
392 Ga0501071_1383884 3300049587 Bacteria 543
393 Ga0501071_1454537 3300049587 Unclassified 529
394 Ga0501072_0003784 3300049588 Bacteria 11426
395 Ga0501072_0009880 3300049588 Bacteria 7257
396 Ga0501073_0319930 3300049589 Bacteria 1071
397 Ga0501073_0489873 3300049589 Bacteria 850
398 Ga0501074_0015108 3300049590 Bacteria 5615
399 Ga0501074_0018328 3300049590 Bacteria 5085
400 Ga0501075_0024962 3300049591 Bacteria 4388
401 Ga0501075_0038975 3300049591 Bacteria 3554
402 Ga0501075_0735535 3300049591 Bacteria 751
403 Ga0501075_0998171 3300049591 Bacteria 636
404 Ga0501075_1438077 3300049591 Bacteria 522
405 Ga0501076_0003617 3300049592 Bacteria 10853
406 Ga0501076_0015559 3300049592 Bacteria 5753
407 Ga0501076_0041701 3300049592 Bacteria 3612
408 Ga0501076_0713451 3300049592 Bacteria 828
409 Ga0501076_1090823 3300049592 Bacteria 657
410 Ga0501076_1150136 3300049592 Bacteria 639
411 Ga0501077_0013154 3300049593 Bacteria 5185
412 Ga0501077_0015744 3300049593 Bacteria 4762
413 Ga0501077_0032408 3300049593 Bacteria 3326
414 Ga0501079_0006065 3300049741 Bacteria 9056
415 Ga0501079_0094918 3300049741 Bacteria 2311
416 Ga0501079_0632545 3300049741 Bacteria 842
417 Ga0501079_0715156 3300049741 Bacteria 788
418 Ga0501079_1596653 3300049741 Bacteria 513
419 Ga0501080_0081274 3300049742 Bacteria 3011
420 Ga0501080_0332643 3300049742 Bacteria 1373
421 Ga0501081_0015524 3300049743 Bacteria 5026
422 Ga0501081_0021810 3300049743 Bacteria 4278
423 Ga0501081_0037476 3300049743 Bacteria 3308
424 Ga0501081_0900756 3300049743 Bacteria 667
425 Ga0501083_0063298 3300049744 Bacteria 2467
426 Ga0501273_097382 3300049770 Bacteria 507
427 Ga0501035_0048076 3300049822 Bacteria 3827
428 Ga0501035_0057276 3300049822 Bacteria 3475
429 Ga0501035_0177956 3300049822 Bacteria 1834
430 Ga0501044_0475688 3300049823 Bacteria 1153
431 Ga0501045_0005803 3300049824 Bacteria 8544
432 Ga0501045_0019316 3300049824 Bacteria 4856
433 Ga0501045_0024513 3300049824 Bacteria 4332
434 nmdc:mga03n38_422983_c1 3300050490 Bacteria 737
435 nmdc:mga00v17_11892_c1 3300050491 Bacteria 4792
436 nmdc:mga0yw44_295304_c1 3300050492 Bacteria 1085
437 nmdc:mga0yw44_5302_c1 3300050492 Bacteria 6061
438 nmdc:mga06z11_348262_c1 3300050494 Bacteria 886
439 nmdc:mga06z11_54166_c1 3300050494 Bacteria 2066
440 nmdc:mga05p37_106964_c1 3300050507 Bacteria 3441
441 nmdc:mga05p37_1970528_c1 3300050507 Bacteria 554
442 nmdc:mga09592_1007590_c1 3300050508 Unclassified 696
443 nmdc:mga0qj67_410542_c1 3300050509 Bacteria 1092
444 nmdc:mga06r32_1289846_c1 3300050510 Bacteria 674
445 nmdc:mga08y16_1683057_c1 3300050511 Bacteria 590
446 nmdc:mga08y16_193507_c1 3300050511 Bacteria 2109
447 nmdc:mga08y16_33642_c1 3300050511 Bacteria 5382
448 nmdc:mga08y16_399047_c1 3300050511 Bacteria 1408
449 nmdc:mga0n895_866175_c1 3300050512 Bacteria 890
450 nmdc:mga0rr50_463143_c1 3300050513 Bacteria 1075
451 nmdc:mga0rr50_871929_c1 3300050513 Bacteria 767
452 Ga0495595_0078967 3300053084 Bacteria 1565
453 Ga0495619_0311079 3300053085 Bacteria 1091
454 Ga0495619_0666409 3300053085 Bacteria 709
455 Ga0501084_0008866 3300054114 Bacteria 8324
456 Ga0501084_0030486 3300054114 Bacteria 4509
457 Ga0501084_0289360 3300054114 Bacteria 1384
458 Ga0501084_1092270 3300054114 Bacteria 670
459 Ga0590071_056467 3300059421 Unclassified 955
460 Ga0590075_025527 3300059424 Bacteria 1485
461 Ga0501082_0007521 3300060353 Bacteria 9401
462 Ga0501082_0126268 3300060353 Bacteria 2219
463 Ga0501082_0143228 3300060353 Bacteria 2074
464 Ga0466962_0168806 3300061719 Bacteria 1065
465 Ga0530510_0008919 3300061734 Bacteria 7021
466 Ga0530510_0014386 3300061734 Bacteria 5579
467 Ga0530510_0098694 3300061734 Bacteria 2135
468 Ga0530510_0869485 3300061734 Bacteria 689
469 Ga0495667_0237748
470 rootH2_10204812
471 JGI25405J52794_10048495
472 Ga0070658_10548724
473 Ga0070676_11026013
474 Ga0070683_100006939
475 Ga0070683_100152490
476 Ga0070683_101143408
477 Ga0070683_102114605
478 Ga0070670_100598472
479 Ga0070666_11073371
480 Ga0070680_100616405
481 Ga0070680_100829850
482 Ga0070680_100881340
483 Ga0070682_100409716
484 Ga0068868_100070196
485 Ga0068868_100532775
486 Ga0070660_100699142
487 Ga0070691_10069720
488 Ga0070687_100274651
489 Ga0070687_100629241
490 Ga0070661_100120734
491 Ga0070668_100954719
492 Ga0070675_100367744
493 Ga0070675_100473470
494 Ga0070671_100026115
495 Ga0070674_100296188
496 Ga0070673_101765473
497 Ga0070714_100042957
498 Ga0070714_100588164
499 Ga0070713_100113264
500 Ga0070711_100017562
501 Ga0070711_100514255
502 Ga0070705_100583897
503 Ga0070700_100381899
504 Ga0070708_102242757
505 Ga0070678_100274732
506 Ga0070678_100991016
507 Ga0070678_101971627
508 Ga0070681_10177344
509 Ga0070681_10198916
510 Ga0070681_10332184
511 Ga0070698_100818805
512 Ga0070679_100038323
513 Ga0070679_100331416
514 Ga0070679_100780486
515 Ga0070684_100098139
516 Ga0070684_100205084
517 Ga0068853_102490858
518 Ga0070672_100270699
519 Ga0070686_100069268
520 Ga0070696_100879762
521 Ga0070693_100004354
522 Ga0070693_100745762
523 Ga0070693_101632965
524 Ga0070704_100003595
525 Ga0070664_100009206
526 Ga0070664_102079426
527 Ga0068857_100130838
528 Ga0068857_100411943
529 Ga0068857_100427517
530 Ga0068854_100038961
531 Ga0068854_100504148
532 Ga0068854_101803971
533 Ga0068856_100006197
534 Ga0068856_100626505
535 Ga0068856_100868709
536 Ga0068856_101901928
537 Ga0070702_100071723
538 Ga0068852_102469686
539 Ga0068864_100021045
540 Ga0068864_101260044
541 Ga0068870_10701847
542 Ga0068858_100472101
543 Ga0068862_100267591
544 Ga0068862_101113829
545 Ga0081455_10038797
546 Ga0081455_10220790
547 Ga0081455_10516257
548 Ga0081455_10571147
549 Ga0081538_10062341
550 Ga0081538_10106037
551 Ga0081538_10251586
552 Ga0081539_10006841
553 Ga0070717_10417967
554 Ga0075365_10196528
555 Ga0075368_10036139
556 Ga0075364_10045982
557 Ga0070716_100095215
558 Ga0070716_101035641
559 Ga0070712_100004685
560 Ga0070712_100093938
561 Ga0075367_10076818
562 Ga0075367_10475592
563 Ga0075366_10507487
564 Ga0097621_100972260
565 Ga0068871_101258432
566 Ga0068871_101537845
567 Ga0075430_100609397
568 Ga0075431_101786465
569 Ga0075434_100683946
570 Ga0075434_101089835
571 Ga0075429_101137212
572 Ga0068865_100523140
573 Ga0097620_101180101
574 Ga0075435_100202487
575 Ga0075435_100446016
576 Ga0111539_10016075
577 Ga0111539_10025887
578 Ga0111539_10134678
579 Ga0111539_10255682
580 Ga0111539_10426896
581 Ga0105245_10354726
582 Ga0105245_11494302
583 Ga0105245_11522405
584 Ga0114129_10058683
585 Ga0114129_10527943
586 Ga0105241_10624781
587 Ga0105241_11421367
588 Ga0105242_11710740
589 Ga0105248_11705195
590 Ga0105238_10908564
591 Ga0105249_10870683
592 Ga0105249_11200764
593 Ga0105239_10056775
594 Ga0105239_11305881
595 Ga0105239_11701974
596 Ga0105239_13125440
597 Ga0105239_13547591
598 Ga0105246_10116941
599 Ga0105246_10903242
600 Ga0157371_10456816
601 Ga0157371_11438615
602 Ga0157370_10483172
603 Ga0157369_10265092
604 Ga0157374_10171282
605 Ga0157374_10270557
606 Ga0157372_10452402
607 Ga0157372_10825137
608 Ga0157375_11308821
609 Ga0157375_12322231
610 Ga0163163_10774211
611 Ga0182008_10497309
612 Ga0182008_10525424
613 Ga0157377_10023752
614 Ga0157377_10166409
615 Ga0182005_1116514
616 Ga0206353_10804249
617 Ga0213876_10643718
618 Ga0207692_10199704
619 Ga0207692_10675292
620 Ga0207680_10975550
621 Ga0207643_10255085
622 Ga0207705_10500975
623 Ga0207705_11434492
624 Ga0207707_10028093
625 Ga0207707_10220521
626 Ga0207707_10483527
627 Ga0207693_10013113
628 Ga0207693_10025613
629 Ga0207693_10961509
630 Ga0207663_10058431
631 Ga0207663_10318123
632 Ga0207660_10711163
633 Ga0207660_10742751
634 Ga0207662_10450456
635 Ga0207662_10742446
636 Ga0207657_10116388
637 Ga0207657_11058267
638 Ga0207649_10003056
639 Ga0207649_10575921
640 Ga0207649_11565872
641 Ga0207652_10689068
642 Ga0207652_11326595
643 Ga0207694_10469545
644 Ga0207650_10347958
645 Ga0207659_10309563
646 Ga0207659_11426133
647 Ga0207687_10737704
648 Ga0207700_10287133
649 Ga0207664_10883986
650 Ga0207644_10234009
651 Ga0207644_11545651
652 Ga0207709_11472889
653 Ga0207669_10346682
654 Ga0207669_10384455
655 Ga0207665_10165909
656 Ga0207689_10479412
657 Ga0207661_10000864
658 Ga0207661_10017485
659 Ga0207661_10616752
660 Ga0207661_11780473
661 Ga0207679_10180486
662 Ga0207679_10185752
663 Ga0207651_11867628
664 Ga0207712_10612018
665 Ga0207640_10105937
666 Ga0207640_11051453
667 Ga0207640_11263483
668 Ga0207677_10043872
669 Ga0207677_10525883
670 Ga0207677_11457454
671 Ga0207703_11357960
672 Ga0207639_11765497
673 Ga0207708_10120974
674 Ga0207702_10009154
675 Ga0207702_10605148
676 Ga0207648_11732420
677 Ga0207676_11196311
678 Ga0207674_10036831
679 Ga0207674_10349326
680 Ga0207674_10368894
681 Ga0207675_100449058
682 Ga0207683_10089890
683 Ga0207683_11134828
684 Ga0207428_10061175
685 Ga0207428_10188472
686 Ga0207428_10476951
687 Ga0268266_11291452
688 Ga0268266_11858205
689 Ga0268265_10412382
690 Ga0268265_11486330
691 Ga0307408_100552566
692 Ga0307405_11428502
693 Ga0307412_10701319
694 Ga0307409_100104867
695 Ga0307409_101904251
696 Ga0307409_102961910
697 Ga0307416_100675742
698 Ga0307416_100981508
699 Ga0307415_100008142
700 Ga0307415_102320684
701 Ga0373961_0224650
702 Ga0373962_0171637
703 Ga0373947_0730329
704 Ga0373937_1061328
705 Ga0395899_0006592
706 Ga0395899_0066507
707 Ga0395900_0001810
708 Ga0395900_0243090
709 Ga0395900_1132637
710 Ga0395898_0018860
711 Ga0395898_0069596
712 Ga0395898_1044350
713 Ga0395905_0013593
714 Ga0395905_0392845
715 Ga0395905_0532183
716 Ga0395905_0608441
717 Ga0395901_0010238
718 Ga0395901_0090580
719 Ga0395901_0166231
720 Ga0395901_1144022
721 Ga0395901_1281793
722 Ga0436365_0355175
723 Ga0439439_0004574
724 Ga0451789_1085657
725 Ga0451793_0308359
726 Ga0451802_0085701
727 Ga0451804_0096207
728 Ga0451839_0903188
729 Ga0451849_1168296
730 Ga0451851_1023841
731 Ga0451853_2486766
732 Ga0439431_0050501
733 Ga0439433_0042761
734 Ga0439448_0028929
735 Ga0439448_0168451
736 Ga0439450_097981
737 Ga0439451_082571
738 Ga0439456_068464
739 Ga0439462_0000555
740 Ga0439463_064218
741 Ga0450922_035967
742 Ga0450898_120784
743 Ga0450902_007814
744 Ga0450906_004386
745 Ga0439446_0002209
746 Ga0439459_0027868
747 Ga0439440_0095730
748 Ga0466963_0019815
749 Ga0466963_0027175
750 Ga0466963_1000061
751 Ga0466971_0267239
752 Ga0466957_0398967
753 Ga0466959_0857008
754 Ga0466967_0016414
755 Ga0466967_0058248
756 Ga0466967_0091959
757 Ga0466967_0465253
758 Ga0466967_1235039
759 Ga0495653_0194187
760 Ga0495608_0177006
761 Ga0495628_0613926
762 Ga0495652_0207272
763 Ga0495652_1038751
764 Ga0495645_0355566
765 Ga0495634_0069806
766 Ga0495635_0223573
767 Ga0495657_0746216
768 Ga0495600_0567180
769 Ga0495604_0810485
770 Ga0495674_1265237
771 Ga0495680_0395327
772 Ga0495680_0685891
773 Ga0495675_0673816
774 Ga0495684_0628110
775 Ga0495684_0816258
776 Ga0495593_0376299
777 Ga0495602_0670705
778 Ga0496100_0003140
779 Ga0496100_0409799
780 Ga0496100_0488779
781 Ga0496100_0909778
782 Ga0496101_0005451
783 Ga0496101_0250822
784 Ga0496101_0882498
785 Ga0496102_0052646
786 Ga0496102_0755131
787 Ga0496102_0920772
788 Ga0496102_0930997
789 Ga0496103_0035484
790 Ga0496103_0211746
791 Ga0496104_0000278
792 Ga0496104_0386068
793 Ga0496105_0139318
794 Ga0496105_0791462
795 Ga0496106_0196371
796 Ga0496107_0902367
797 Ga0496108_0002990
798 Ga0496108_0264804
799 Ga0496109_0009286
800 Ga0496109_1856818
801 Ga0496109_1893354
802 Ga0496110_0016483
803 Ga0496110_0297706
804 Ga0496110_1149491
805 Ga0496111_0008333
806 Ga0496112_0076295
807 Ga0496112_0384654
808 Ga0496113_0075358
809 Ga0496114_0133499
810 Ga0496114_0576667
811 Ga0496114_1172755
812 Ga0496115_0000616
813 Ga0501031_0010913
814 Ga0501031_0038088
815 Ga0501031_0453480
816 Ga0501031_0811598
817 Ga0501032_1061320
818 Ga0501033_0160590
819 Ga0501033_0599600
820 Ga0501036_0002524
821 Ga0501036_0047341
822 Ga0501036_0108780
823 Ga0501036_1083028
824 Ga0501037_0071912
825 Ga0501037_0098688
826 Ga0501037_0293173
827 Ga0501038_0014110
828 Ga0501038_0303573
829 Ga0501038_0379203
830 Ga0501039_0011222
831 Ga0501039_0020844
832 Ga0501039_0102954
833 Ga0501040_0000959
834 Ga0501040_0051137
835 Ga0501040_0095039
836 Ga0501041_0021465
837 Ga0501041_0055623
838 Ga0501042_0010114
839 Ga0501042_0011961
840 Ga0501042_0015103
841 Ga0501042_0151712
842 Ga0501042_0860808
843 Ga0501043_0170638
844 Ga0501046_0045585
845 Ga0501046_0188633
846 Ga0501048_0014367
847 Ga0501048_0016605
848 Ga0501048_0076854
849 Ga0501048_0887292
850 Ga0501048_0954305
851 Ga0501067_0024545
852 Ga0501067_0060413
853 Ga0501068_0006738
854 Ga0501068_0063187
855 Ga0501069_0037789
856 Ga0501069_0300699
857 Ga0501070_0560655
858 Ga0501071_0021135
859 Ga0501071_0021276
860 Ga0501071_1383884
861 Ga0501071_1454537
862 Ga0501072_0003784
863 Ga0501072_0009880
864 Ga0501073_0319930
865 Ga0501073_0489873
866 Ga0501074_0015108
867 Ga0501074_0018328
868 Ga0501075_0024962
869 Ga0501075_0038975
870 Ga0501075_0735535
871 Ga0501075_0998171
872 Ga0501075_1438077
873 Ga0501076_0003617
874 Ga0501076_0015559
875 Ga0501076_0041701
876 Ga0501076_0713451
877 Ga0501076_1090823
878 Ga0501076_1150136
879 Ga0501077_0013154
880 Ga0501077_0015744
881 Ga0501077_0032408
882 Ga0501079_0006065
883 Ga0501079_0094918
884 Ga0501079_0632545
885 Ga0501079_0715156
886 Ga0501079_1596653
887 Ga0501080_0081274
888 Ga0501080_0332643
889 Ga0501081_0015524
890 Ga0501081_0021810
891 Ga0501081_0037476
892 Ga0501081_0900756
893 Ga0501083_0063298
894 Ga0501273_097382
895 Ga0501035_0048076
896 Ga0501035_0057276
897 Ga0501035_0177956
898 Ga0501044_0475688
899 Ga0501045_0005803
900 Ga0501045_0019316
901 Ga0501045_0024513
902 nmdc:mga03n38_422983_c1
903 nmdc:mga00v17_11892_c1
904 nmdc:mga0yw44_295304_c1
905 nmdc:mga0yw44_5302_c1
906 nmdc:mga06z11_348262_c1
907 nmdc:mga06z11_54166_c1
908 nmdc:mga05p37_106964_c1
909 nmdc:mga05p37_1970528_c1
910 nmdc:mga09592_1007590_c1
911 nmdc:mga0qj67_410542_c1
912 nmdc:mga06r32_1289846_c1
913 nmdc:mga08y16_1683057_c1
914 nmdc:mga08y16_193507_c1
915 nmdc:mga08y16_33642_c1
916 nmdc:mga08y16_399047_c1
917 nmdc:mga0n895_866175_c1
918 nmdc:mga0rr50_463143_c1
919 nmdc:mga0rr50_871929_c1
920 Ga0495595_0078967
921 Ga0495619_0311079
922 Ga0495619_0666409
923 Ga0501084_0008866
924 Ga0501084_0030486
925 Ga0501084_0289360
926 Ga0501084_1092270
927 Ga0590071_056467
928 Ga0590075_025527
929 Ga0501082_0007521
930 Ga0501082_0126268
931 Ga0501082_0143228
932 Ga0466962_0168806
933 Ga0530510_0008919
934 Ga0530510_0014386
935 Ga0530510_0098694
936 Ga0530510_0869485

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wuq-assembly2.cif.gz_D crystal structure of sigw in complex with its anti-sigma rsiw, a zinc binding form 0.5685 28 74
3hug-assembly6.cif.gz_F crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.5406 30 72
2ouw-assembly1.cif.gz_B crystal structure of alkylhydroperoxidase ahpd core (yp_425393.1) from rhodospirillum rubrum atcc 11170 at 1.95 a resolution 0.5076 3 73
2ouw-assembly1.cif.gz_B crystal structure of alkylhydroperoxidase ahpd core (yp_425393.1) from rhodospirillum rubrum atcc 11170 at 1.95 a resolution 0.4758 3 73
3hug-assembly6.cif.gz_F crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.443 30 72
ID Description Score Start End Superfamily
af_Q5AAR0_149_292_1.20.930.10 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.5425 23 54 1.20.930.10
3hugF00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.5406 30 72 1.10.10.1320
af_A8JV07_554_695_1.20.930.10 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.5348 25 55 1.20.930.10
af_D3ZAI0_403_485_1.10.10.790 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Surp module 0.5017 1 74 1.10.10.790
af_D3ZAI0_403_485_1.10.10.790 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Surp module 0.4958 1 74 1.10.10.790
ID Description Score Start End GO Terms
AF-A0A7W1YN45-F1-model_v4 Zinc-finger domain-containing protein 0.9613 25 71
AF-A0A847FN81-F1-model_v4 Zinc-finger domain-containing protein 0.9393 18 73
AF-A0A1F8U7R0-F1-model_v4 Zinc-finger domain-containing protein 0.9391 19 74
AF-A0A6P2C7M5-F1-model_v4 Zf-HC2 domain-containing protein 0.9334 19 72
AF-A0A661W3Z6-F1-model_v4 Zinc-finger domain-containing protein 0.9319 17 69

Map