F450077

General Info

Members Datasets Scaffolds Average Seq Length
468 209 936 290

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1190248|Ga0436364_1190248_1807_2814
Length 335
Sequence MDRVSTGGVGPSGPPPGFRPAPTKHPSPSQRSPLRNLAEFLLVFFVLKSLEWSPLPLAHRLARGYFRLLDLLLPRLRNIAARNLAVALPELSPEKREAIIAGVFRSIARLAVTMAKFPSIQRENIVRWIRFEGYEHFEAALRAGRGVLFATAHLGNWELSAYAHALCAEPMNVVVRPLDNPLLDSLIARRRQLCGNRVISKRDPIRPILKALAANEAVGILIDQNVSSDAVFVDFFGIPAAAASGFARLAAHSGAAVIPGFALWSEPERRYVLRFYPPVPITGDAVRDTQTIQTVLEGVIRAYPDQWLWIHRRWKTRPPGALPVYEVAPVRSNTV

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
117 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
118 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
119 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
149 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 1.07
Rhizosphere 91.24
Stem 0
Stem Tuber 0
Unclassified 16.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_1190248 3300037853 Unclassified 3609
2 Ga0070658_10023937 3300005327 Bacteria 4899
3 Ga0070658_10039050 3300005327 Bacteria 3829
4 Ga0070683_100004185 3300005329 Bacteria 11830
5 Ga0070683_100151603 3300005329 Bacteria 2198
6 Ga0070683_100181982 3300005329 Bacteria 1995
7 Ga0070683_100341953 3300005329 Unclassified 1425
8 Ga0068869_100366776 3300005334 Unclassified 1177
9 Ga0070666_10001216 3300005335 Bacteria 15542
10 Ga0070680_100133221 3300005336 Bacteria 2080
11 Ga0068868_100014924 3300005338 Bacteria 5735
12 Ga0070660_100016895 3300005339 Bacteria 5309
13 Ga0070689_100035832 3300005340 Bacteria 3792
14 Ga0070661_100004454 3300005344 Bacteria 9657
15 Ga0070671_100062168 3300005355 Bacteria 3110
16 Ga0070673_100103610 3300005364 Bacteria 2348
17 Ga0070673_100162879 3300005364 Bacteria 1898
18 Ga0070688_100060103 3300005365 Bacteria 2399
19 Ga0070659_100020609 3300005366 Bacteria 5011
20 Ga0070667_100014117 3300005367 Bacteria 6600
21 Ga0070714_100000466 3300005435 Bacteria 29384
22 Ga0070714_100236375 3300005435 Bacteria 1685
23 Ga0070713_100050114 3300005436 Bacteria 3447
24 Ga0070713_100069971 3300005436 Bacteria 2961
25 Ga0070711_100035437 3300005439 Bacteria 3337
26 Ga0070711_100079581 3300005439 Unclassified 2331
27 Ga0070663_100031635 3300005455 Bacteria 3638
28 Ga0070678_100058141 3300005456 Unclassified 2837
29 Ga0070678_100190465 3300005456 Bacteria 1686
30 Ga0070678_100208066 3300005456 Bacteria 1619
31 Ga0070681_10003750 3300005458 Bacteria 14266
32 Ga0070681_10057910 3300005458 Bacteria 3855
33 Ga0070681_10076188 3300005458 Bacteria 3313
34 Ga0070681_10167108 3300005458 Bacteria 2122
35 Ga0070681_10168655 3300005458 Bacteria 2111
36 Ga0070681_10181872 3300005458 Bacteria 2024
37 Ga0068867_100155932 3300005459 Bacteria 1797
38 Ga0070706_100153361 3300005467 Bacteria 2151
39 Ga0070706_100493618 3300005467 Bacteria 1139
40 Ga0070699_100177925 3300005518 Unclassified 1887
41 Ga0070679_100009067 3300005530 Bacteria 9386
42 Ga0070679_100045021 3300005530 Bacteria 4397
43 Ga0070684_100003472 3300005535 Bacteria 11830
44 Ga0070684_100025397 3300005535 Bacteria 4980
45 Ga0070684_100053642 3300005535 Bacteria 3511
46 Ga0070684_100173122 3300005535 Bacteria 1961
47 Ga0070697_100057484 3300005536 Bacteria 3165
48 Ga0070697_100270580 3300005536 Bacteria 1456
49 Ga0068853_100089196 3300005539 Unclassified 2708
50 Ga0068853_100285655 3300005539 Bacteria 1522
51 Ga0070686_100181348 3300005544 Bacteria 1496
52 Ga0070696_100002960 3300005546 Bacteria 11288
53 Ga0070665_100379222 3300005548 Unclassified 1421
54 Ga0068855_100006182 3300005563 Bacteria 14597
55 Ga0068855_100007115 3300005563 Bacteria 13572
56 Ga0068855_100011731 3300005563 Bacteria 10593
57 Ga0068855_100012079 3300005563 Bacteria 10436
58 Ga0068855_100068165 3300005563 Bacteria 4142
59 Ga0068855_100075132 3300005563 Bacteria 3924
60 Ga0068855_100258263 3300005563 Bacteria 1942
61 Ga0068855_100311963 3300005563 Bacteria 1740
62 Ga0068855_100422270 3300005563 Unclassified 1458
63 Ga0070664_100287734 3300005564 Bacteria 1483
64 Ga0068857_100042008 3300005577 Bacteria 4054
65 Ga0068857_100044035 3300005577 Bacteria 3958
66 Ga0068856_100007745 3300005614 Bacteria 10491
67 Ga0068856_100017457 3300005614 Bacteria 6954
68 Ga0068856_100078134 3300005614 Bacteria 3281
69 Ga0068856_100113021 3300005614 Unclassified 2714
70 Ga0068852_100236810 3300005616 Bacteria 1743
71 Ga0068859_100287841 3300005617 Bacteria 1736
72 Ga0068859_100555121 3300005617 Bacteria 1243
73 Ga0068866_10117744 3300005718 Bacteria 1492
74 Ga0068863_100022659 3300005841 Bacteria 5999
75 Ga0068863_100029155 3300005841 Bacteria 5269
76 Ga0068858_100007077 3300005842 Bacteria 10888
77 Ga0068858_100100663 3300005842 Bacteria 2695
78 Ga0068860_100017361 3300005843 Bacteria 7011
79 Ga0068862_100314713 3300005844 Unclassified 1443
80 Ga0081455_10021567 3300005937 Bacteria 6038
81 Ga0070717_10020123 3300006028 Bacteria 5245
82 Ga0070717_10191700 3300006028 Unclassified 1786
83 Ga0097621_100005171 3300006237 Bacteria 9169
84 Ga0097621_100007782 3300006237 Bacteria 7688
85 Ga0097621_100037857 3300006237 Bacteria 3869
86 Ga0097621_100176696 3300006237 Unclassified 1843
87 Ga0068871_100012234 3300006358 Bacteria 6318
88 Ga0068871_100022119 3300006358 Bacteria 4900
89 Ga0068871_100453483 3300006358 Unclassified 1150
90 Ga0075430_100031547 3300006846 Bacteria 4498
91 Ga0075431_100002093 3300006847 Bacteria 19065
92 Ga0075431_100020038 3300006847 Bacteria 6829
93 Ga0075434_100412272 3300006871 Bacteria 1372
94 Ga0075434_100519730 3300006871 Bacteria 1211
95 Ga0068865_100006713 3300006881 Bacteria 7039
96 Ga0068865_100303868 3300006881 Bacteria 1278
97 Ga0075436_100001102 3300006914 Bacteria 18242
98 Ga0075436_100148030 3300006914 Bacteria 1651
99 Ga0075436_100245419 3300006914 Bacteria 1274
100 Ga0097620_100035984 3300006931 Bacteria 4968
101 Ga0097620_100287843 3300006931 Bacteria 1736
102 Ga0097620_100555198 3300006931 Bacteria 1243
103 Ga0105240_10000438 3300009093 Bacteria 76903
104 Ga0105240_10001298 3300009093 Bacteria 43175
105 Ga0105240_10002380 3300009093 Bacteria 30325
106 Ga0105240_10006036 3300009093 Bacteria 17911
107 Ga0105240_10134068 3300009093 Bacteria 2967
108 Ga0105240_10136637 3300009093 Bacteria 2935
109 Ga0105240_10349729 3300009093 Unclassified 1677
110 Ga0105240_10600270 3300009093 Unclassified 1212
111 Ga0105245_10004645 3300009098 Bacteria 12134
112 Ga0105245_10011492 3300009098 Bacteria 7711
113 Ga0105245_10139230 3300009098 Bacteria 2284
114 Ga0105245_10170665 3300009098 Bacteria 2071
115 Ga0105245_10559140 3300009098 Bacteria 1167
116 Ga0114129_10190332 3300009147 Bacteria 2787
117 Ga0114129_10207124 3300009147 Bacteria 2653
118 Ga0105243_10060486 3300009148 Bacteria 3026
119 Ga0105241_10009077 3300009174 Bacteria 7315
120 Ga0105241_10160137 3300009174 Bacteria 1849
121 Ga0105242_10021182 3300009176 Bacteria 5103
122 Ga0105242_10146846 3300009176 Bacteria 2052
123 Ga0105242_10162931 3300009176 Bacteria 1954
124 Ga0105242_10369926 3300009176 Bacteria 1329
125 Ga0105248_10011338 3300009177 Bacteria 9824
126 Ga0105248_10014487 3300009177 Bacteria 8680
127 Ga0105248_10086844 3300009177 Bacteria 3520
128 Ga0105248_10090378 3300009177 Unclassified 3448
129 Ga0105248_10172521 3300009177 Bacteria 2438
130 Ga0105248_10190498 3300009177 Bacteria 2311
131 Ga0105248_10212800 3300009177 Bacteria 2178
132 Ga0105248_10843926 3300009177 Unclassified 1034
133 Ga0105237_10014903 3300009545 Bacteria 8107
134 Ga0105237_10020070 3300009545 Bacteria 6898
135 Ga0105237_10035223 3300009545 Bacteria 5066
136 Ga0105237_10043120 3300009545 Bacteria 4547
137 Ga0105238_10054930 3300009551 Bacteria 3999
138 Ga0105238_10212077 3300009551 Bacteria 1913
139 Ga0105239_10021580 3300010375 Bacteria 7101
140 Ga0105239_10043698 3300010375 Bacteria 4913
141 Ga0105239_10207896 3300010375 Bacteria 2193
142 Ga0157371_10155636 3300013102 Unclassified 1631
143 Ga0157371_10295588 3300013102 Bacteria 1172
144 Ga0157371_10422844 3300013102 Unclassified 977
145 Ga0157370_10008793 3300013104 Bacteria 10849
146 Ga0157370_10033507 3300013104 Bacteria 5008
147 Ga0157370_10147608 3300013104 Unclassified 2189
148 Ga0157370_10226846 3300013104 Bacteria 1729
149 Ga0157370_10379854 3300013104 Bacteria 1301
150 Ga0157369_10002980 3300013105 Bacteria 20260
151 Ga0157369_10008243 3300013105 Bacteria 11946
152 Ga0157369_10018191 3300013105 Bacteria 7881
153 Ga0157369_10090967 3300013105 Bacteria 3258
154 Ga0157369_10156947 3300013105 Bacteria 2403
155 Ga0157369_10467608 3300013105 Bacteria 1305
156 Ga0157374_10028553 3300013296 Bacteria 5041
157 Ga0157374_10094234 3300013296 Bacteria 2861
158 Ga0157374_10166838 3300013296 Unclassified 2146
159 Ga0157374_10263217 3300013296 Bacteria 1699
160 Ga0157378_10709628 3300013297 Bacteria 1026
161 Ga0163162_10117749 3300013306 Bacteria 2758
162 Ga0163162_10274815 3300013306 Bacteria 1817
163 Ga0157372_10087034 3300013307 Bacteria 3544
164 Ga0157372_10110563 3300013307 Bacteria 3148
165 Ga0157372_10523705 3300013307 Unclassified 1382
166 Ga0157372_10567687 3300013307 Unclassified 1323
167 Ga0157372_10642051 3300013307 Unclassified 1236
168 Ga0157375_10005506 3300013308 Bacteria 11018
169 Ga0157375_10365794 3300013308 Bacteria 1608
170 Ga0163163_10007738 3300014325 Bacteria 9496
171 Ga0163163_10030037 3300014325 Bacteria 5231
172 Ga0163163_10060399 3300014325 Unclassified 3754
173 Ga0163163_10215808 3300014325 Bacteria 1967
174 Ga0163163_10262804 3300014325 Bacteria 1777
175 Ga0157379_10002170 3300014968 Bacteria 16310
176 Ga0157376_10124542 3300014969 Bacteria 2289
177 Ga0157376_10298534 3300014969 Bacteria 1524
178 Ga0213872_10000182 3300021361 Bacteria 56427
179 Ga0213876_10001101 3300021384 Bacteria 17298
180 Ga0213876_10012915 3300021384 Bacteria 4441
181 Ga0213876_10017670 3300021384 Bacteria 3763
182 Ga0213876_10033868 3300021384 Bacteria 2693
183 Ga0213875_10000002 3300021388 Bacteria 921066
184 Ga0213875_10000112 3300021388 Bacteria 91961
185 Ga0213875_10002433 3300021388 Bacteria 11139
186 Ga0213875_10010594 3300021388 Unclassified 4613
187 Ga0213875_10019453 3300021388 Bacteria 3266
188 Ga0213875_10027672 3300021388 Bacteria 2698
189 Ga0213875_10030734 3300021388 Unclassified 2542
190 Ga0213875_10064972 3300021388 Bacteria 1705
191 Ga0213875_10072014 3300021388 Unclassified 1613
192 Ga0213875_10141472 3300021388 Bacteria 1126
193 Ga0207685_10130120 3300025905 Bacteria 1116
194 Ga0207705_10004239 3300025909 Bacteria 10862
195 Ga0207705_10251052 3300025909 Bacteria 1349
196 Ga0207654_10071147 3300025911 Bacteria 2067
197 Ga0207654_10092098 3300025911 Bacteria 1850
198 Ga0207654_10094372 3300025911 Bacteria 1831
199 Ga0207707_10005115 3300025912 Bacteria 11497
200 Ga0207707_10007242 3300025912 Bacteria 9653
201 Ga0207707_10018406 3300025912 Bacteria 6090
202 Ga0207707_10070907 3300025912 Bacteria 3036
203 Ga0207707_10100247 3300025912 Bacteria 2531
204 Ga0207695_10001643 3300025913 Bacteria 36050
205 Ga0207695_10004872 3300025913 Bacteria 18104
206 Ga0207695_10011537 3300025913 Bacteria 10692
207 Ga0207695_10021488 3300025913 Bacteria 7361
208 Ga0207695_10189756 3300025913 Bacteria 1973
209 Ga0207695_10203491 3300025913 Unclassified 1893
210 Ga0207671_10013835 3300025914 Bacteria 6408
211 Ga0207671_10031873 3300025914 Bacteria 3925
212 Ga0207671_10036999 3300025914 Bacteria 3619
213 Ga0207671_10133008 3300025914 Unclassified 1910
214 Ga0207663_10041403 3300025916 Bacteria 2807
215 Ga0207663_10095369 3300025916 Unclassified 1984
216 Ga0207660_10087717 3300025917 Bacteria 2299
217 Ga0207660_10120501 3300025917 Unclassified 1986
218 Ga0207660_10322488 3300025917 Bacteria 1234
219 Ga0207657_10006856 3300025919 Bacteria 11750
220 Ga0207657_10210593 3300025919 Bacteria 1560
221 Ga0207652_10051504 3300025921 Bacteria 3530
222 Ga0207652_10162651 3300025921 Unclassified 2001
223 Ga0207694_10021690 3300025924 Bacteria 4867
224 Ga0207694_10113398 3300025924 Bacteria 2158
225 Ga0207687_10006599 3300025927 Bacteria 7654
226 Ga0207687_10059356 3300025927 Bacteria 2695
227 Ga0207687_10090667 3300025927 Bacteria 2228
228 Ga0207700_10006266 3300025928 Bacteria 7176
229 Ga0207700_10025071 3300025928 Bacteria 4135
230 Ga0207700_10151176 3300025928 Bacteria 1919
231 Ga0207664_10009750 3300025929 Bacteria 6754
232 Ga0207644_10056471 3300025931 Bacteria 2833
233 Ga0207686_10044422 3300025934 Bacteria 2728
234 Ga0207686_10097490 3300025934 Bacteria 1956
235 Ga0207709_10049941 3300025935 Bacteria 2555
236 Ga0207709_10410129 3300025935 Bacteria 1038
237 Ga0207670_10384823 3300025936 Unclassified 1118
238 Ga0207704_10039779 3300025938 Bacteria 2742
239 Ga0207704_10268234 3300025938 Bacteria 1291
240 Ga0207665_10086356 3300025939 Bacteria 2167
241 Ga0207711_10010896 3300025941 Bacteria 7556
242 Ga0207711_10016663 3300025941 Bacteria 6102
243 Ga0207711_10060297 3300025941 Bacteria 3269
244 Ga0207711_10120653 3300025941 Bacteria 2340
245 Ga0207711_10175039 3300025941 Bacteria 1949
246 Ga0207711_10263841 3300025941 Bacteria 1583
247 Ga0207689_10356429 3300025942 Bacteria 1216
248 Ga0207661_10002898 3300025944 Bacteria 11851
249 Ga0207661_10045282 3300025944 Bacteria 3482
250 Ga0207661_10071628 3300025944 Bacteria 2833
251 Ga0207661_10328995 3300025944 Unclassified 1375
252 Ga0207667_10002897 3300025949 Bacteria 21302
253 Ga0207667_10007403 3300025949 Bacteria 13200
254 Ga0207667_10015382 3300025949 Bacteria 8696
255 Ga0207667_10053542 3300025949 Bacteria 4246
256 Ga0207667_10058921 3300025949 Bacteria 4025
257 Ga0207667_10076171 3300025949 Unclassified 3482
258 Ga0207651_10080175 3300025960 Bacteria 2348
259 Ga0207651_10128700 3300025960 Bacteria 1934
260 Ga0207658_10286479 3300025986 Bacteria 1414
261 Ga0207677_10013085 3300026023 Bacteria 4796
262 Ga0207703_10032063 3300026035 Bacteria 4157
263 Ga0207639_10071858 3300026041 Unclassified 2708
264 Ga0207639_10268384 3300026041 Bacteria 1496
265 Ga0207639_10429448 3300026041 Bacteria 1196
266 Ga0207702_10046537 3300026078 Unclassified 3653
267 Ga0207702_10073066 3300026078 Bacteria 2956
268 Ga0207702_10095606 3300026078 Bacteria 2611
269 Ga0207702_10110808 3300026078 Unclassified 2440
270 Ga0207702_10146814 3300026078 Bacteria 2141
271 Ga0207641_10152713 3300026088 Bacteria 2092
272 Ga0207641_10206911 3300026088 Unclassified 1812
273 Ga0207641_10416349 3300026088 Bacteria 1293
274 Ga0207648_10342903 3300026089 Bacteria 1346
275 Ga0207674_10000915 3300026116 Bacteria 38455
276 Ga0207674_10003947 3300026116 Bacteria 18047
277 Ga0207674_10039864 3300026116 Bacteria 4867
278 Ga0207683_10095240 3300026121 Unclassified 2654
279 Ga0207683_10324153 3300026121 Bacteria 1411
280 Ga0207698_10538264 3300026142 Bacteria 1142
281 Ga0268265_10189884 3300028380 Bacteria 1773
282 Ga0268264_10012279 3300028381 Bacteria 7049
283 Ga0265323_10000134 3300028653 Bacteria 42370
284 Ga0265338_10104265 3300028800 Unclassified 2301
285 Ga0265330_10072275 3300031235 Bacteria 1492
286 Ga0265332_10034732 3300031238 Bacteria 2190
287 Ga0265328_10005285 3300031239 Bacteria 5546
288 Ga0265320_10000647 3300031240 Bacteria 26595
289 Ga0265325_10040510 3300031241 Bacteria 2446
290 Ga0265339_10048793 3300031249 Unclassified 2321
291 Ga0265331_10026752 3300031250 Unclassified 2896
292 Ga0265331_10032071 3300031250 Bacteria 2606
293 Ga0265327_10127010 3300031251 Unclassified 1203
294 Ga0265316_10002494 3300031344 Bacteria 19058
295 Ga0265316_10002556 3300031344 Bacteria 18804
296 Ga0265316_10007312 3300031344 Bacteria 10417
297 Ga0265316_10051195 3300031344 Bacteria 3245
298 Ga0265316_10069771 3300031344 Bacteria 2712
299 Ga0265316_10103536 3300031344 Bacteria 2161
300 Ga0265316_10118307 3300031344 Bacteria 2002
301 Ga0265313_10121876 3300031595 Unclassified 1136
302 Ga0265314_10003430 3300031711 Bacteria 15320
303 Ga0265314_10004067 3300031711 Bacteria 13797
304 Ga0265314_10007627 3300031711 Bacteria 9365
305 Ga0265314_10056536 3300031711 Bacteria 2700
306 Ga0265314_10169291 3300031711 Bacteria 1320
307 Ga0265342_10008795 3300031712 Bacteria 7195
308 Ga0373923_0036566 3300035111 Unclassified 2005
309 Ga0373955_0091102 3300035172 Bacteria 1738
310 Ga0373961_0103773 3300035241 Bacteria 923
311 Ga0373935_0041804 3300035692 Unclassified 2881
312 Ga0373935_0152538 3300035692 Bacteria 1569
313 Ga0373935_0244315 3300035692 Bacteria 1254
314 Ga0373935_0470262 3300035692 Unclassified 910
315 Ga0373927_0001152 3300035695 Bacteria 20006
316 Ga0373927_0002176 3300035695 Bacteria 14391
317 Ga0373927_0021009 3300035695 Bacteria 4279
318 Ga0373927_0063960 3300035695 Bacteria 2380
319 Ga0373933_0290008 3300035724 Bacteria 1058
320 Ga0373947_0000440 3300035725 Bacteria 23586
321 Ga0373947_0048032 3300035725 Bacteria 2560
322 Ga0373947_0339258 3300035725 Unclassified 1007
323 Ga0373937_0004941 3300036401 Bacteria 11335
324 Ga0373937_0031410 3300036401 Bacteria 4813
325 Ga0373937_0171804 3300036401 Bacteria 2034
326 Ga0373937_0178704 3300036401 Unclassified 1993
327 Ga0373937_0243085 3300036401 Unclassified 1696
328 Ga0373937_0579710 3300036401 Bacteria 1065
329 Ga0373925_0000291 3300037068 Bacteria 52433
330 Ga0373925_0038328 3300037068 Bacteria 3543
331 Ga0373925_0102937 3300037068 Bacteria 2197
332 Ga0373925_0122619 3300037068 Bacteria 2019
333 Ga0373925_0198034 3300037068 Bacteria 1596
334 Ga0436364_0160423 3300037853 Bacteria 5256
335 Ga0436364_0323484 3300037853 Bacteria 2519
336 Ga0436364_0417184 3300037853 Bacteria 3004
337 Ga0436364_0462115 3300037853 Unclassified 1299
338 Ga0436364_0517360 3300037853 Bacteria 13526
339 Ga0436364_0602871 3300037853 Bacteria 4426
340 Ga0436364_0612043 3300037853 Bacteria 326330
341 Ga0436364_0749502 3300037853 Bacteria 105484
342 Ga0436364_0885924 3300037853 Unclassified 1613
343 Ga0436364_0919396 3300037853 Bacteria 13386
344 Ga0436364_1074929 3300037853 Bacteria 14867
345 Ga0436364_1199688 3300037853 Unclassified 1624
346 Ga0436364_1275864 3300037853 Bacteria 1975
347 Ga0436364_1320403 3300037853 Bacteria 5756
348 Ga0436364_1350595 3300037853 Bacteria 8723
349 Ga0436365_0041310 3300039437 Bacteria 28215
350 Ga0436365_0188047 3300039437 Bacteria 7244
351 Ga0436365_0781995 3300039437 Bacteria 6534
352 Ga0436365_1556319 3300039437 Bacteria 3994
353 Ga0436360_0083056 3300039438 Bacteria 3383
354 Ga0436360_0386665 3300039438 Unclassified 2411
355 Ga0436361_0126076 3300039447 Bacteria 97470
356 Ga0436363_0946280 3300039450 Bacteria 2355
357 Ga0436362_0107282 3300039453 Unclassified 971
358 Ga0453684_0719470 3300044712 Bacteria 1083
359 Ga0451576_0027465 3300045051 Bacteria 6112
360 Ga0495651_0012820 3300046462 Bacteria 6473
361 Ga0495651_0013954 3300046462 Bacteria 6213
362 Ga0495653_0062251 3300046463 Bacteria 2820
363 Ga0495653_0351902 3300046463 Unclassified 947
364 Ga0495580_0000307 3300046472 Bacteria 39901
365 Ga0495580_0009214 3300046472 Bacteria 7779
366 Ga0495580_0092746 3300046472 Bacteria 2102
367 Ga0495580_0097462 3300046472 Bacteria 2045
368 Ga0495580_0114746 3300046472 Bacteria 1871
369 Ga0495580_0157241 3300046472 Bacteria 1574
370 Ga0495582_0170535 3300046473 Bacteria 1239
371 Ga0495662_0020034 3300046476 Bacteria 3237
372 Ga0495664_0001207 3300046477 Bacteria 13502
373 Ga0495594_0100623 3300046499 Bacteria 1626
374 Ga0495608_0098605 3300046511 Bacteria 1885
375 Ga0495618_0011534 3300046514 Bacteria 5362
376 Ga0495628_0060980 3300046516 Unclassified 2959
377 Ga0495628_0096927 3300046516 Bacteria 2278
378 Ga0495628_0153509 3300046516 Unclassified 1753
379 Ga0495630_0021418 3300046517 Bacteria 4773
380 Ga0495666_0121362 3300046526 Unclassified 1224
381 Ga0495652_0012517 3300046529 Bacteria 7650
382 Ga0495652_0222003 3300046529 Unclassified 1420
383 Ga0495665_0265394 3300046531 Unclassified 882
384 Ga0495640_0014385 3300046533 Bacteria 5991
385 Ga0495640_0305244 3300046533 Unclassified 988
386 Ga0495587_0060073 3300046536 Bacteria 2230
387 Ga0495587_0067703 3300046536 Bacteria 2081
388 Ga0495645_0001895 3300046543 Bacteria 14223
389 Ga0495645_0052350 3300046543 Unclassified 2970
390 Ga0495645_0254639 3300046543 Unclassified 1165
391 Ga0495667_0017192 3300046559 Bacteria 4885
392 Ga0495667_0055543 3300046559 Bacteria 2604
393 Ga0495667_0096555 3300046559 Unclassified 1913
394 Ga0495667_0120381 3300046559 Unclassified 1695
395 Ga0495667_0254309 3300046559 Bacteria 1118
396 Ga0495634_0324998 3300046642 Bacteria 925
397 Ga0495635_0387461 3300046663 Unclassified 929
398 Ga0495657_0090832 3300046675 Unclassified 1960
399 Ga0495599_0254758 3300046678 Unclassified 1067
400 Ga0495599_0276675 3300046678 Bacteria 1017
401 Ga0495623_0008815 3300046679 Bacteria 6545
402 Ga0495623_0129573 3300046679 Unclassified 1512
403 Ga0495623_0150502 3300046679 Bacteria 1376
404 Ga0495646_0003605 3300046680 Bacteria 9667
405 Ga0495613_0149147 3300046689 Bacteria 1669
406 Ga0495624_0118277 3300046690 Bacteria 1628
407 Ga0495600_0029021 3300046809 Bacteria 3581
408 Ga0495600_0288351 3300046809 Unclassified 1038
409 Ga0495604_0134157 3300047317 Bacteria 1776
410 Ga0495604_0201921 3300047317 Bacteria 1378
411 Ga0495604_0209313 3300047317 Unclassified 1348
412 Ga0495674_0021714 3300047319 Bacteria 5935
413 Ga0495674_0051736 3300047319 Bacteria 3620
414 Ga0495674_0085631 3300047319 Bacteria 2699
415 Ga0495680_0050172 3300047322 Bacteria 3264
416 Ga0495680_0059986 3300047322 Bacteria 2935
417 Ga0495675_0026271 3300047444 Bacteria 3713
418 Ga0495675_0046610 3300047444 Bacteria 2759
419 Ga0495675_0149789 3300047444 Unclassified 1442
420 Ga0495675_0233069 3300047444 Bacteria 1110
421 Ga0495684_0001076 3300047471 Bacteria 22103
422 Ga0495684_0059530 3300047471 Bacteria 2909
423 Ga0495684_0329103 3300047471 Bacteria 1090
424 Ga0495602_0058118 3300048088 Bacteria 3388
425 Ga0495602_0202928 3300048088 Bacteria 1511
426 Ga0496101_0448541 3300048904 Bacteria 1018
427 Ga0496112_0280315 3300048915 Bacteria 1614
428 Ga0496114_0346075 3300048917 Bacteria 1315
429 Ga0496115_0041258 3300048918 Bacteria 3672
430 Ga0496115_0494068 3300048918 Bacteria 984
431 Ga0501031_0001243 3300049568 Bacteria 15625
432 Ga0501032_0000837 3300049569 Bacteria 25024
433 Ga0501033_0012592 3300049570 Bacteria 6454
434 Ga0501036_0004940 3300049572 Bacteria 10777
435 Ga0501037_0007636 3300049573 Bacteria 7917
436 Ga0501038_0018241 3300049574 Bacteria 6334
437 Ga0501038_0262861 3300049574 Bacteria 1363
438 Ga0501039_0005686 3300049575 Bacteria 9445
439 Ga0501040_0118464 3300049576 Unclassified 1857
440 Ga0501043_0003588 3300049579 Bacteria 12740
441 Ga0501046_0000591 3300049580 Bacteria 35671
442 Ga0501046_0179356 3300049580 Bacteria 1585
443 Ga0501047_0002992 3300049581 Bacteria 16028
444 Ga0501047_0039486 3300049581 Bacteria 4565
445 Ga0501047_0109908 3300049581 Bacteria 2640
446 Ga0501067_0005951 3300049583 Bacteria 6761
447 Ga0501069_0000329 3300049585 Bacteria 21365
448 Ga0501070_0010268 3300049586 Bacteria 7919
449 Ga0501072_0001356 3300049588 Bacteria 18370
450 Ga0501073_0003261 3300049589 Bacteria 12180
451 Ga0501077_0001401 3300049593 Bacteria 14499
452 Ga0501080_0000466 3300049742 Bacteria 31417
453 Ga0501080_0806598 3300049742 Bacteria 823
454 Ga0501083_0032300 3300049744 Bacteria 3590
455 Ga0501035_0542257 3300049822 Bacteria 953
456 Ga0501044_0010485 3300049823 Bacteria 10056
457 nmdc:mga05p37_270944_c1 3300050507 Bacteria 2028
458 nmdc:mga05p37_664719_c1 3300050507 Bacteria 1164
459 nmdc:mga09592_431077_c1 3300050508 Bacteria 1138
460 nmdc:mga0qj67_16078_c1 3300050509 Bacteria 5668
461 nmdc:mga06r32_2312_c1 3300050510 Bacteria 17061
462 nmdc:mga08x19_166722_c1 3300050514 Bacteria 1498
463 nmdc:mga08x19_1799_c1 3300050514 Bacteria 13172
464 nmdc:mga08x19_99120_c1 3300050514 Bacteria 1353
465 Ga0500568_0001026 3300053139 Bacteria 19117
466 Ga0501084_0006326 3300054114 Bacteria 9724
467 Ga0501082_0000628 3300060353 Bacteria 31112
468 Ga0501082_0026085 3300060353 Bacteria 5037
469 Ga0436364_1190248
470 Ga0070658_10023937
471 Ga0070658_10039050
472 Ga0070683_100004185
473 Ga0070683_100151603
474 Ga0070683_100181982
475 Ga0070683_100341953
476 Ga0068869_100366776
477 Ga0070666_10001216
478 Ga0070680_100133221
479 Ga0068868_100014924
480 Ga0070660_100016895
481 Ga0070689_100035832
482 Ga0070661_100004454
483 Ga0070671_100062168
484 Ga0070673_100103610
485 Ga0070673_100162879
486 Ga0070688_100060103
487 Ga0070659_100020609
488 Ga0070667_100014117
489 Ga0070714_100000466
490 Ga0070714_100236375
491 Ga0070713_100050114
492 Ga0070713_100069971
493 Ga0070711_100035437
494 Ga0070711_100079581
495 Ga0070663_100031635
496 Ga0070678_100058141
497 Ga0070678_100190465
498 Ga0070678_100208066
499 Ga0070681_10003750
500 Ga0070681_10057910
501 Ga0070681_10076188
502 Ga0070681_10167108
503 Ga0070681_10168655
504 Ga0070681_10181872
505 Ga0068867_100155932
506 Ga0070706_100153361
507 Ga0070706_100493618
508 Ga0070699_100177925
509 Ga0070679_100009067
510 Ga0070679_100045021
511 Ga0070684_100003472
512 Ga0070684_100025397
513 Ga0070684_100053642
514 Ga0070684_100173122
515 Ga0070697_100057484
516 Ga0070697_100270580
517 Ga0068853_100089196
518 Ga0068853_100285655
519 Ga0070686_100181348
520 Ga0070696_100002960
521 Ga0070665_100379222
522 Ga0068855_100006182
523 Ga0068855_100007115
524 Ga0068855_100011731
525 Ga0068855_100012079
526 Ga0068855_100068165
527 Ga0068855_100075132
528 Ga0068855_100258263
529 Ga0068855_100311963
530 Ga0068855_100422270
531 Ga0070664_100287734
532 Ga0068857_100042008
533 Ga0068857_100044035
534 Ga0068856_100007745
535 Ga0068856_100017457
536 Ga0068856_100078134
537 Ga0068856_100113021
538 Ga0068852_100236810
539 Ga0068859_100287841
540 Ga0068859_100555121
541 Ga0068866_10117744
542 Ga0068863_100022659
543 Ga0068863_100029155
544 Ga0068858_100007077
545 Ga0068858_100100663
546 Ga0068860_100017361
547 Ga0068862_100314713
548 Ga0081455_10021567
549 Ga0070717_10020123
550 Ga0070717_10191700
551 Ga0097621_100005171
552 Ga0097621_100007782
553 Ga0097621_100037857
554 Ga0097621_100176696
555 Ga0068871_100012234
556 Ga0068871_100022119
557 Ga0068871_100453483
558 Ga0075430_100031547
559 Ga0075431_100002093
560 Ga0075431_100020038
561 Ga0075434_100412272
562 Ga0075434_100519730
563 Ga0068865_100006713
564 Ga0068865_100303868
565 Ga0075436_100001102
566 Ga0075436_100148030
567 Ga0075436_100245419
568 Ga0097620_100035984
569 Ga0097620_100287843
570 Ga0097620_100555198
571 Ga0105240_10000438
572 Ga0105240_10001298
573 Ga0105240_10002380
574 Ga0105240_10006036
575 Ga0105240_10134068
576 Ga0105240_10136637
577 Ga0105240_10349729
578 Ga0105240_10600270
579 Ga0105245_10004645
580 Ga0105245_10011492
581 Ga0105245_10139230
582 Ga0105245_10170665
583 Ga0105245_10559140
584 Ga0114129_10190332
585 Ga0114129_10207124
586 Ga0105243_10060486
587 Ga0105241_10009077
588 Ga0105241_10160137
589 Ga0105242_10021182
590 Ga0105242_10146846
591 Ga0105242_10162931
592 Ga0105242_10369926
593 Ga0105248_10011338
594 Ga0105248_10014487
595 Ga0105248_10086844
596 Ga0105248_10090378
597 Ga0105248_10172521
598 Ga0105248_10190498
599 Ga0105248_10212800
600 Ga0105248_10843926
601 Ga0105237_10014903
602 Ga0105237_10020070
603 Ga0105237_10035223
604 Ga0105237_10043120
605 Ga0105238_10054930
606 Ga0105238_10212077
607 Ga0105239_10021580
608 Ga0105239_10043698
609 Ga0105239_10207896
610 Ga0157371_10155636
611 Ga0157371_10295588
612 Ga0157371_10422844
613 Ga0157370_10008793
614 Ga0157370_10033507
615 Ga0157370_10147608
616 Ga0157370_10226846
617 Ga0157370_10379854
618 Ga0157369_10002980
619 Ga0157369_10008243
620 Ga0157369_10018191
621 Ga0157369_10090967
622 Ga0157369_10156947
623 Ga0157369_10467608
624 Ga0157374_10028553
625 Ga0157374_10094234
626 Ga0157374_10166838
627 Ga0157374_10263217
628 Ga0157378_10709628
629 Ga0163162_10117749
630 Ga0163162_10274815
631 Ga0157372_10087034
632 Ga0157372_10110563
633 Ga0157372_10523705
634 Ga0157372_10567687
635 Ga0157372_10642051
636 Ga0157375_10005506
637 Ga0157375_10365794
638 Ga0163163_10007738
639 Ga0163163_10030037
640 Ga0163163_10060399
641 Ga0163163_10215808
642 Ga0163163_10262804
643 Ga0157379_10002170
644 Ga0157376_10124542
645 Ga0157376_10298534
646 Ga0213872_10000182
647 Ga0213876_10001101
648 Ga0213876_10012915
649 Ga0213876_10017670
650 Ga0213876_10033868
651 Ga0213875_10000002
652 Ga0213875_10000112
653 Ga0213875_10002433
654 Ga0213875_10010594
655 Ga0213875_10019453
656 Ga0213875_10027672
657 Ga0213875_10030734
658 Ga0213875_10064972
659 Ga0213875_10072014
660 Ga0213875_10141472
661 Ga0207685_10130120
662 Ga0207705_10004239
663 Ga0207705_10251052
664 Ga0207654_10071147
665 Ga0207654_10092098
666 Ga0207654_10094372
667 Ga0207707_10005115
668 Ga0207707_10007242
669 Ga0207707_10018406
670 Ga0207707_10070907
671 Ga0207707_10100247
672 Ga0207695_10001643
673 Ga0207695_10004872
674 Ga0207695_10011537
675 Ga0207695_10021488
676 Ga0207695_10189756
677 Ga0207695_10203491
678 Ga0207671_10013835
679 Ga0207671_10031873
680 Ga0207671_10036999
681 Ga0207671_10133008
682 Ga0207663_10041403
683 Ga0207663_10095369
684 Ga0207660_10087717
685 Ga0207660_10120501
686 Ga0207660_10322488
687 Ga0207657_10006856
688 Ga0207657_10210593
689 Ga0207652_10051504
690 Ga0207652_10162651
691 Ga0207694_10021690
692 Ga0207694_10113398
693 Ga0207687_10006599
694 Ga0207687_10059356
695 Ga0207687_10090667
696 Ga0207700_10006266
697 Ga0207700_10025071
698 Ga0207700_10151176
699 Ga0207664_10009750
700 Ga0207644_10056471
701 Ga0207686_10044422
702 Ga0207686_10097490
703 Ga0207709_10049941
704 Ga0207709_10410129
705 Ga0207670_10384823
706 Ga0207704_10039779
707 Ga0207704_10268234
708 Ga0207665_10086356
709 Ga0207711_10010896
710 Ga0207711_10016663
711 Ga0207711_10060297
712 Ga0207711_10120653
713 Ga0207711_10175039
714 Ga0207711_10263841
715 Ga0207689_10356429
716 Ga0207661_10002898
717 Ga0207661_10045282
718 Ga0207661_10071628
719 Ga0207661_10328995
720 Ga0207667_10002897
721 Ga0207667_10007403
722 Ga0207667_10015382
723 Ga0207667_10053542
724 Ga0207667_10058921
725 Ga0207667_10076171
726 Ga0207651_10080175
727 Ga0207651_10128700
728 Ga0207658_10286479
729 Ga0207677_10013085
730 Ga0207703_10032063
731 Ga0207639_10071858
732 Ga0207639_10268384
733 Ga0207639_10429448
734 Ga0207702_10046537
735 Ga0207702_10073066
736 Ga0207702_10095606
737 Ga0207702_10110808
738 Ga0207702_10146814
739 Ga0207641_10152713
740 Ga0207641_10206911
741 Ga0207641_10416349
742 Ga0207648_10342903
743 Ga0207674_10000915
744 Ga0207674_10003947
745 Ga0207674_10039864
746 Ga0207683_10095240
747 Ga0207683_10324153
748 Ga0207698_10538264
749 Ga0268265_10189884
750 Ga0268264_10012279
751 Ga0265323_10000134
752 Ga0265338_10104265
753 Ga0265330_10072275
754 Ga0265332_10034732
755 Ga0265328_10005285
756 Ga0265320_10000647
757 Ga0265325_10040510
758 Ga0265339_10048793
759 Ga0265331_10026752
760 Ga0265331_10032071
761 Ga0265327_10127010
762 Ga0265316_10002494
763 Ga0265316_10002556
764 Ga0265316_10007312
765 Ga0265316_10051195
766 Ga0265316_10069771
767 Ga0265316_10103536
768 Ga0265316_10118307
769 Ga0265313_10121876
770 Ga0265314_10003430
771 Ga0265314_10004067
772 Ga0265314_10007627
773 Ga0265314_10056536
774 Ga0265314_10169291
775 Ga0265342_10008795
776 Ga0373923_0036566
777 Ga0373955_0091102
778 Ga0373961_0103773
779 Ga0373935_0041804
780 Ga0373935_0152538
781 Ga0373935_0244315
782 Ga0373935_0470262
783 Ga0373927_0001152
784 Ga0373927_0002176
785 Ga0373927_0021009
786 Ga0373927_0063960
787 Ga0373933_0290008
788 Ga0373947_0000440
789 Ga0373947_0048032
790 Ga0373947_0339258
791 Ga0373937_0004941
792 Ga0373937_0031410
793 Ga0373937_0171804
794 Ga0373937_0178704
795 Ga0373937_0243085
796 Ga0373937_0579710
797 Ga0373925_0000291
798 Ga0373925_0038328
799 Ga0373925_0102937
800 Ga0373925_0122619
801 Ga0373925_0198034
802 Ga0436364_0160423
803 Ga0436364_0323484
804 Ga0436364_0417184
805 Ga0436364_0462115
806 Ga0436364_0517360
807 Ga0436364_0602871
808 Ga0436364_0612043
809 Ga0436364_0749502
810 Ga0436364_0885924
811 Ga0436364_0919396
812 Ga0436364_1074929
813 Ga0436364_1199688
814 Ga0436364_1275864
815 Ga0436364_1320403
816 Ga0436364_1350595
817 Ga0436365_0041310
818 Ga0436365_0188047
819 Ga0436365_0781995
820 Ga0436365_1556319
821 Ga0436360_0083056
822 Ga0436360_0386665
823 Ga0436361_0126076
824 Ga0436363_0946280
825 Ga0436362_0107282
826 Ga0453684_0719470
827 Ga0451576_0027465
828 Ga0495651_0012820
829 Ga0495651_0013954
830 Ga0495653_0062251
831 Ga0495653_0351902
832 Ga0495580_0000307
833 Ga0495580_0009214
834 Ga0495580_0092746
835 Ga0495580_0097462
836 Ga0495580_0114746
837 Ga0495580_0157241
838 Ga0495582_0170535
839 Ga0495662_0020034
840 Ga0495664_0001207
841 Ga0495594_0100623
842 Ga0495608_0098605
843 Ga0495618_0011534
844 Ga0495628_0060980
845 Ga0495628_0096927
846 Ga0495628_0153509
847 Ga0495630_0021418
848 Ga0495666_0121362
849 Ga0495652_0012517
850 Ga0495652_0222003
851 Ga0495665_0265394
852 Ga0495640_0014385
853 Ga0495640_0305244
854 Ga0495587_0060073
855 Ga0495587_0067703
856 Ga0495645_0001895
857 Ga0495645_0052350
858 Ga0495645_0254639
859 Ga0495667_0017192
860 Ga0495667_0055543
861 Ga0495667_0096555
862 Ga0495667_0120381
863 Ga0495667_0254309
864 Ga0495634_0324998
865 Ga0495635_0387461
866 Ga0495657_0090832
867 Ga0495599_0254758
868 Ga0495599_0276675
869 Ga0495623_0008815
870 Ga0495623_0129573
871 Ga0495623_0150502
872 Ga0495646_0003605
873 Ga0495613_0149147
874 Ga0495624_0118277
875 Ga0495600_0029021
876 Ga0495600_0288351
877 Ga0495604_0134157
878 Ga0495604_0201921
879 Ga0495604_0209313
880 Ga0495674_0021714
881 Ga0495674_0051736
882 Ga0495674_0085631
883 Ga0495680_0050172
884 Ga0495680_0059986
885 Ga0495675_0026271
886 Ga0495675_0046610
887 Ga0495675_0149789
888 Ga0495675_0233069
889 Ga0495684_0001076
890 Ga0495684_0059530
891 Ga0495684_0329103
892 Ga0495602_0058118
893 Ga0495602_0202928
894 Ga0496101_0448541
895 Ga0496112_0280315
896 Ga0496114_0346075
897 Ga0496115_0041258
898 Ga0496115_0494068
899 Ga0501031_0001243
900 Ga0501032_0000837
901 Ga0501033_0012592
902 Ga0501036_0004940
903 Ga0501037_0007636
904 Ga0501038_0018241
905 Ga0501038_0262861
906 Ga0501039_0005686
907 Ga0501040_0118464
908 Ga0501043_0003588
909 Ga0501046_0000591
910 Ga0501046_0179356
911 Ga0501047_0002992
912 Ga0501047_0039486
913 Ga0501047_0109908
914 Ga0501067_0005951
915 Ga0501069_0000329
916 Ga0501070_0010268
917 Ga0501072_0001356
918 Ga0501073_0003261
919 Ga0501077_0001401
920 Ga0501080_0000466
921 Ga0501080_0806598
922 Ga0501083_0032300
923 Ga0501035_0542257
924 Ga0501044_0010485
925 nmdc:mga05p37_270944_c1
926 nmdc:mga05p37_664719_c1
927 nmdc:mga09592_431077_c1
928 nmdc:mga0qj67_16078_c1
929 nmdc:mga06r32_2312_c1
930 nmdc:mga08x19_166722_c1
931 nmdc:mga08x19_1799_c1
932 nmdc:mga08x19_99120_c1
933 Ga0500568_0001026
934 Ga0501084_0006326
935 Ga0501082_0000628
936 Ga0501082_0026085

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03279

Lip_A_acyltrans

Bacterial lipid A biosynthesis acyltransferase

25

316

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f34-assembly1.cif.gz_A crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group 0.8956 52 288
5f34-assembly1.cif.gz_A crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group 0.8392 52 288
5knk-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii with catalytic residue substitution (e127a) 0.8358 25 292
5kn7-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii 0.8138 17 289
5knk-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii with catalytic residue substitution (e127a) 0.752 25 292
ID Description Score Start End Superfamily
af_Q54I12_580_724_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.6208 106 211 3.40.50.620
5l3rC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6046 119 194 3.40.50.300
af_P31119_15_138_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.5857 114 233 3.40.1010.10
af_Q2FXJ7_19_144_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.5806 114 233 3.40.50.2000
af_Q2FXJ7_19_144_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.5377 114 233 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A7C3DGD9-F1-model_v4 Lipid A biosynthesis acyltransferase 0.979 1 299 GO:0005886
GO:0009247
GO:0016746
AF-A0A7C3DGD9-F1-model_v4 Lipid A biosynthesis acyltransferase 0.9758 1 299 GO:0005886
GO:0009247
GO:0016746
AF-A0A372IUT9-F1-model_v4 Lipid A biosynthesis acyltransferase 0.9635 8 299 GO:0005886
GO:0009247
GO:0016746
AF-A0A7W0XF88-F1-model_v4 Lysophospholipid acyltransferase family protein 0.9574 1 298 GO:0005886
GO:0009247
GO:0016746
AF-A0A348W4E7-F1-model_v4 deleted 0.9566 71 296

Map