F450072

General Info

Members Datasets Scaffolds Average Seq Length
468 207 936 216

Family's Representative Sequence

Representative Sequence 3300035170|Ga0373943_0036499|Ga0373943_0036499_1188_1955
Length 255
Sequence MLEFRRREQSVSFAWVPNKERFRLEGISRQTRVRQAGMTQIFAPAADTWLRLFLAGGLALLGGGLVGVIGFAHSAYMTSTDFRPQQPVPFSHKHHAGELGIDCRYCHSGVETGPQAGLPPTTTCMTXXXQIWTNAAMLEPVRQSLAQQKPIAWTRVAKLPDYVFFRHDIHVAKGVGCETCHGRIDTMPLTYRAKAFTMEFCIDCHRDPAPNLRPQESITEMGWKTPSDAQKQGEAIAAHEGIRFGELTHCYVCHR

Samples

Sample ID Description Type Environment
1 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
61 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
116 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
127 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
128 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
146 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
147 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
148 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
151 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
152 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
170 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
171 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
194 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
195 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
196 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
197 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
198 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
199 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
200 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
201 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
202 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
203 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
204 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
205 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
206 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
207 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.01
Metatranscriptomes 0
Isolates 2.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 2.56
Rhizoplane 7.05
Rhizosphere 81.41
Stem 0
Stem Tuber 0
Unclassified 5.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373943_0036499 3300035170 Bacteria 2354
2 JGI24033J26618_1006767 3300002155 Bacteria 1293
3 rootH2_10064446 3300003320 Bacteria 4398
4 rootL2_10273162 3300003322 Bacteria 3397
5 Ga0065704_10109347 3300005289 Bacteria 2006
6 Ga0070658_10208875 3300005327 Bacteria 1649
7 Ga0070658_10280832 3300005327 Bacteria 1417
8 Ga0070658_10314686 3300005327 Bacteria 1336
9 Ga0070658_10426388 3300005327 Bacteria 1141
10 Ga0070658_10600066 3300005327 Bacteria 954
11 Ga0070683_100097354 3300005329 Bacteria 2768
12 Ga0070683_100510057 3300005329 Bacteria 1149
13 Ga0070683_100651604 3300005329 Bacteria 1008
14 Ga0070670_100746222 3300005331 Bacteria 882
15 Ga0070666_10249582 3300005335 Unclassified 1256
16 Ga0070680_100002269 3300005336 Bacteria 14213
17 Ga0070680_100263301 3300005336 Bacteria 1459
18 Ga0070660_100000495 3300005339 Bacteria 26212
19 Ga0070660_100161347 3300005339 Bacteria 1806
20 Ga0070661_100000286 3300005344 Bacteria 40815
21 Ga0070668_100048364 3300005347 Unclassified 3270
22 Ga0070671_100001618 3300005355 Bacteria 16970
23 Ga0070671_100063469 3300005355 Bacteria 3076
24 Ga0070659_100001748 3300005366 Bacteria 15598
25 Ga0070659_100072472 3300005366 Bacteria 2741
26 Ga0070667_100059567 3300005367 Unclassified 3230
27 Ga0070667_100253764 3300005367 Bacteria 1573
28 Ga0070714_100012582 3300005435 Bacteria 6760
29 Ga0070713_100017465 3300005436 Bacteria 5427
30 Ga0070713_100023205 3300005436 Bacteria 4810
31 Ga0070713_100126813 3300005436 Bacteria 2246
32 Ga0070713_100247803 3300005436 Bacteria 1624
33 Ga0070700_100000050 3300005441 Bacteria 88421
34 Ga0070694_100175584 3300005444 Bacteria 1581
35 Ga0070663_100870960 3300005455 Bacteria 776
36 Ga0070678_100054316 3300005456 Bacteria 2918
37 Ga0070662_100000071 3300005457 Bacteria 55762
38 Ga0070662_100002862 3300005457 Bacteria 10699
39 Ga0070662_100009722 3300005457 Bacteria 6294
40 Ga0070681_10098777 3300005458 Bacteria 2865
41 Ga0070681_10165500 3300005458 Bacteria 2134
42 Ga0070681_10490787 3300005458 Bacteria 1141
43 Ga0070681_10496081 3300005458 Bacteria 1134
44 Ga0070685_10028801 3300005466 Bacteria 3081
45 Ga0070679_100001065 3300005530 Bacteria 23946
46 Ga0070679_100002568 3300005530 Bacteria 16485
47 Ga0070679_100073730 3300005530 Bacteria 3404
48 Ga0070679_100157267 3300005530 Bacteria 2247
49 Ga0070684_100041694 3300005535 Bacteria 3959
50 Ga0070684_100180879 3300005535 Bacteria 1917
51 Ga0068853_100000412 3300005539 Bacteria 29460
52 Ga0068853_100459591 3300005539 Bacteria 1198
53 Ga0068853_100665282 3300005539 Bacteria 992
54 Ga0070686_100193094 3300005544 Bacteria 1454
55 Ga0070665_100001223 3300005548 Bacteria 31260
56 Ga0070665_100002567 3300005548 Bacteria 19910
57 Ga0068855_100000970 3300005563 Bacteria 35729
58 Ga0068855_100212919 3300005563 Bacteria 2170
59 Ga0068855_100391230 3300005563 Bacteria 1525
60 Ga0068855_101008866 3300005563 Bacteria 874
61 Ga0068854_100002427 3300005578 Bacteria 11512
62 Ga0068854_100061887 3300005578 Bacteria 2712
63 Ga0068856_100003912 3300005614 Bacteria 14932
64 Ga0068856_100347701 3300005614 Bacteria 1501
65 Ga0070702_100178868 3300005615 Bacteria 1386
66 Ga0068852_100778486 3300005616 Bacteria 970
67 Ga0068852_100848206 3300005616 Bacteria 929
68 Ga0068863_100166213 3300005841 Bacteria 2116
69 Ga0068858_100588670 3300005842 Bacteria 1079
70 Ga0068860_100069797 3300005843 Unclassified 3340
71 Ga0068862_100060369 3300005844 Bacteria 3257
72 Ga0070717_10222322 3300006028 Bacteria 1660
73 Ga0097621_100823684 3300006237 Bacteria 861
74 Ga0068871_100471347 3300006358 Bacteria 1128
75 Ga0105251_10004452 3300009011 Bacteria 9529
76 Ga0105240_10176628 3300009093 Bacteria 2524
77 Ga0111539_10000022 3300009094 Bacteria 240838
78 Ga0105247_10085586 3300009101 Unclassified 1994
79 Ga0114129_10189766 3300009147 Bacteria 2791
80 Ga0105241_10183365 3300009174 Bacteria 1738
81 Ga0105241_10581603 3300009174 Unclassified 1009
82 Ga0105248_10006383 3300009177 Bacteria 12942
83 Ga0105237_10115718 3300009545 Bacteria 2675
84 Ga0105238_10053507 3300009551 Bacteria 4056
85 Ga0105238_10136644 3300009551 Bacteria 2429
86 Ga0105238_10265548 3300009551 Bacteria 1696
87 Ga0105239_10430249 3300010375 Bacteria 1496
88 Ga0105246_10000140 3300011119 Bacteria 33633
89 Ga0157373_10011413 3300013100 Bacteria 6534
90 Ga0157373_10031124 3300013100 Bacteria 3840
91 Ga0157371_10001293 3300013102 Bacteria 26356
92 Ga0157371_10023143 3300013102 Bacteria 4543
93 Ga0157371_10340513 3300013102 Bacteria 1091
94 Ga0157370_10000991 3300013104 Bacteria 35836
95 Ga0157370_10443754 3300013104 Bacteria 1193
96 Ga0157369_10025428 3300013105 Bacteria 6575
97 Ga0157372_10000946 3300013307 Bacteria 31733
98 Ga0157372_10537576 3300013307 Bacteria 1362
99 Ga0157375_10142644 3300013308 Bacteria 2523
100 Ga0157375_10517447 3300013308 Bacteria 1357
101 Ga0213872_10006301 3300021361 Bacteria 5981
102 Ga0213874_10061066 3300021377 Bacteria 1180
103 Ga0213876_10069899 3300021384 Bacteria 1855
104 Ga0213876_10076934 3300021384 Bacteria 1762
105 Ga0213876_10249058 3300021384 Bacteria 944
106 Ga0213876_10256005 3300021384 Bacteria 930
107 Ga0213876_10335349 3300021384 Bacteria 804
108 Ga0209677_101747 3300025253 Bacteria 9025
109 Ga0209455_1001581 3300025272 Bacteria 10032
110 Ga0209455_1003093 3300025272 Bacteria 6073
111 Ga0207713_1007410 3300025735 Bacteria 6479
112 Ga0207692_10052693 3300025898 Bacteria 2069
113 Ga0207680_10147027 3300025903 Bacteria 1568
114 Ga0207699_10396307 3300025906 Bacteria 982
115 Ga0207705_10183921 3300025909 Bacteria 1578
116 Ga0207705_10369466 3300025909 Bacteria 1107
117 Ga0207707_10000438 3300025912 Bacteria 43316
118 Ga0207707_10137763 3300025912 Bacteria 2134
119 Ga0207707_10154134 3300025912 Bacteria 2009
120 Ga0207671_10268044 3300025914 Bacteria 1345
121 Ga0207657_10098215 3300025919 Bacteria 2434
122 Ga0207652_10003966 3300025921 Bacteria 12099
123 Ga0207652_10014003 3300025921 Bacteria 6494
124 Ga0207652_10024967 3300025921 Bacteria 4963
125 Ga0207652_10117758 3300025921 Bacteria 2360
126 Ga0207652_10207486 3300025921 Bacteria 1764
127 Ga0207694_10037591 3300025924 Bacteria 3719
128 Ga0207694_10497061 3300025924 Bacteria 1021
129 Ga0207650_10324797 3300025925 Bacteria 1261
130 Ga0207659_10159043 3300025926 Bacteria 1772
131 Ga0207687_10280980 3300025927 Bacteria 1334
132 Ga0207700_10587082 3300025928 Bacteria 991
133 Ga0207664_10019360 3300025929 Bacteria 5029
134 Ga0207644_10001525 3300025931 Bacteria 14937
135 Ga0207644_10318409 3300025931 Bacteria 1257
136 Ga0207690_10505975 3300025932 Bacteria 977
137 Ga0207706_10015910 3300025933 Bacteria 6798
138 Ga0207706_10083322 3300025933 Bacteria 2811
139 Ga0207711_10003400 3300025941 Bacteria 13775
140 Ga0207661_10581430 3300025944 Bacteria 1027
141 Ga0207661_10628701 3300025944 Bacteria 986
142 Ga0207667_10215481 3300025949 Bacteria 1968
143 Ga0207667_10510953 3300025949 Bacteria 1218
144 Ga0207667_10820549 3300025949 Bacteria 926
145 Ga0207651_10162085 3300025960 Bacteria 1754
146 Ga0207668_10004323 3300025972 Bacteria 8339
147 Ga0207640_10063919 3300025981 Bacteria 2448
148 Ga0207658_10007705 3300025986 Bacteria 7333
149 Ga0207703_10350084 3300026035 Bacteria 1360
150 Ga0207678_10202085 3300026067 Bacteria 1699
151 Ga0207678_10295111 3300026067 Bacteria 1392
152 Ga0207702_10460130 3300026078 Bacteria 1236
153 Ga0207641_10000986 3300026088 Bacteria 29083
154 Ga0207674_10319143 3300026116 Bacteria 1503
155 Ga0207683_10153437 3300026121 Bacteria 2079
156 Ga0207698_10342232 3300026142 Bacteria 1409
157 Ga0207428_10000030 3300027907 Bacteria 240846
158 Ga0268266_10001277 3300028379 Bacteria 30750
159 Ga0268266_10009653 3300028379 Bacteria 8486
160 Ga0268265_10027609 3300028380 Bacteria 4053
161 Ga0268264_10009245 3300028381 Bacteria 8161
162 Ga0265325_10001061 3300031241 Bacteria 19772
163 Ga0265340_10018668 3300031247 Bacteria 3576
164 Ga0373954_0308384 3300035118 Bacteria 781
165 Ga0373931_0222731 3300035691 Bacteria 1136
166 Ga0373925_0052905 3300037068 Bacteria 3034
167 Ga0395899_0000666 3300037312 Bacteria 34912
168 Ga0395899_0028038 3300037312 Bacteria 4241
169 Ga0395899_0035399 3300037312 Bacteria 3748
170 Ga0395900_0000016 3300037418 Bacteria 382407
171 Ga0395900_0011893 3300037418 Bacteria 8897
172 Ga0395898_0002730 3300037466 Bacteria 20361
173 Ga0395898_0023416 3300037466 Bacteria 6241
174 Ga0395898_0026631 3300037466 Bacteria 5815
175 Ga0395898_0036472 3300037466 Bacteria 4882
176 Ga0395905_0006525 3300037471 Bacteria 11733
177 Ga0395905_0418392 3300037471 Bacteria 1236
178 Ga0436364_0985720 3300037853 Bacteria 1003
179 Ga0436364_1565160 3300037853 Bacteria 827
180 Ga0395901_0000022 3300038443 Bacteria 296356
181 Ga0395901_0003226 3300038443 Bacteria 16405
182 Ga0395901_0042548 3300038443 Bacteria 4710
183 Ga0395901_0149686 3300038443 Bacteria 2453
184 Ga0395901_0311300 3300038443 Bacteria 1631
185 Ga0436365_0106371 3300039437 Bacteria 1890
186 Ga0436365_0922842 3300039437 Bacteria 1812
187 Ga0436365_1138685 3300039437 Bacteria 1180
188 Ga0436365_1649283 3300039437 Unclassified 2225
189 Ga0436365_1850675 3300039437 Bacteria 16914
190 Ga0436361_0306530 3300039447 Bacteria 30241
191 Ga0436363_0186689 3300039450 Bacteria 891
192 Ga0436363_0742585 3300039450 Bacteria 2847
193 Ga0436363_1099119 3300039450 Bacteria 1878
194 Ga0436362_1058008 3300039453 Bacteria 3134
195 Ga0439448_0172612 3300042005 Bacteria 754
196 Ga0466966_0143536 3300044684 Bacteria 1458
197 Ga0466957_0113418 3300044842 Bacteria 1721
198 Ga0451576_0732747 3300045051 Bacteria 1038
199 Ga0466958_0889624 3300045836 Bacteria 581
200 Ga0466967_0048210 3300045976 Bacteria 3719
201 Ga0466967_0323794 3300045976 Bacteria 1487
202 Ga0495603_0036713 3300046455 Bacteria 2942
203 Ga0495651_0113067 3300046462 Bacteria 2005
204 Ga0495628_0132582 3300046516 Bacteria 1905
205 Ga0495640_0131344 3300046533 Bacteria 1621
206 Ga0495646_0064253 3300046680 Bacteria 2176
207 Ga0495624_0118058 3300046690 Bacteria 1630
208 Ga0495581_0049264 3300047315 Bacteria 2432
209 Ga0496100_0112054 3300048903 Bacteria 1897
210 Ga0496101_0009883 3300048904 Bacteria 6286
211 Ga0496101_0872962 3300048904 Bacteria 709
212 Ga0496102_0004215 3300048905 Bacteria 12156
213 Ga0496102_0187064 3300048905 Bacteria 1952
214 Ga0496103_0022442 3300048906 Bacteria 3800
215 Ga0496104_0007908 3300048907 Bacteria 9428
216 Ga0496104_0316688 3300048907 Bacteria 1473
217 Ga0496105_0090751 3300048908 Bacteria 2523
218 Ga0496106_0002322 3300048909 Bacteria 14177
219 Ga0496106_0199332 3300048909 Bacteria 1593
220 Ga0496106_0298242 3300048909 Bacteria 1292
221 Ga0496106_0422824 3300048909 Bacteria 1071
222 Ga0496106_0475083 3300048909 Bacteria 1004
223 Ga0496107_0123108 3300048910 Bacteria 1911
224 Ga0496107_0691691 3300048910 Bacteria 750
225 Ga0496108_0001632 3300048911 Bacteria 17771
226 Ga0496109_0003738 3300048912 Bacteria 12720
227 Ga0496109_0030753 3300048912 Bacteria 4812
228 Ga0496110_0008560 3300048913 Bacteria 8236
229 Ga0496110_0097068 3300048913 Bacteria 2641
230 Ga0496111_0016726 3300048914 Bacteria 5059
231 Ga0496112_0004450 3300048915 Bacteria 11876
232 Ga0496112_0022022 3300048915 Bacteria 6067
233 Ga0496112_0093334 3300048915 Bacteria 2980
234 Ga0496112_0632173 3300048915 Bacteria 1001
235 Ga0496113_0033723 3300048916 Bacteria 3730
236 Ga0496113_0097574 3300048916 Bacteria 2274
237 Ga0496113_0525818 3300048916 Bacteria 949
238 Ga0496114_0017787 3300048917 Bacteria 5745
239 Ga0496115_0053502 3300048918 Bacteria 3240
240 Ga0496115_0160417 3300048918 Bacteria 1858
241 Ga0496116_0064052 3300048919 Unclassified 2364
242 Ga0496117_0011504 3300048920 Bacteria 7921
243 Ga0496117_0042390 3300048920 Bacteria 3322
244 Ga0496118_0007103 3300048921 Bacteria 12020
245 Ga0496118_0048911 3300048921 Bacteria 3260
246 Ga0496119_0100782 3300048922 Bacteria 1622
247 Ga0496119_0108528 3300048922 Unclassified 1545
248 Ga0496121_0013034 3300048924 Bacteria 8979
249 Ga0496121_0022044 3300048924 Bacteria 6202
250 Ga0496121_0082590 3300048924 Bacteria 2539
251 Ga0496121_0144183 3300048924 Unclassified 1762
252 Ga0496123_0110482 3300048926 Unclassified 1573
253 Ga0496124_0010621 3300048927 Bacteria 9302
254 Ga0496124_0027848 3300048927 Bacteria 5063
255 Ga0496124_0068079 3300048927 Bacteria 2960
256 Ga0496124_0478139 3300048927 Bacteria 842
257 Ga0496125_0052659 3300048928 Bacteria 3345
258 Ga0496126_0254712 3300048929 Unclassified 1461
259 Ga0496126_0450251 3300048929 Bacteria 1036
260 Ga0495682_0046819 3300049460 Bacteria 1578
261 Ga0501031_0016392 3300049568 Bacteria 4812
262 Ga0501032_0000026 3300049569 Bacteria 136472
263 Ga0501032_0000055 3300049569 Bacteria 99207
264 Ga0501032_0026531 3300049569 Bacteria 3982
265 Ga0501032_0035196 3300049569 Bacteria 3425
266 Ga0501032_0077346 3300049569 Bacteria 2215
267 Ga0501032_0093955 3300049569 Bacteria 1988
268 Ga0501032_0373992 3300049569 Bacteria 916
269 Ga0501033_0000163 3300049570 Bacteria 63913
270 Ga0501033_0001033 3300049570 Bacteria 25328
271 Ga0501033_0004474 3300049570 Bacteria 11180
272 Ga0501033_0005801 3300049570 Bacteria 9718
273 Ga0501033_0023569 3300049570 Bacteria 4642
274 Ga0501033_0028449 3300049570 Bacteria 4198
275 Ga0501033_0458597 3300049570 Bacteria 885
276 Ga0501034_0000054 3300049571 Bacteria 206373
277 Ga0501034_0001317 3300049571 Bacteria 33620
278 Ga0501034_0013063 3300049571 Bacteria 8558
279 Ga0501034_0014890 3300049571 Bacteria 7998
280 Ga0501034_0018723 3300049571 Bacteria 7096
281 Ga0501034_0049515 3300049571 Bacteria 4239
282 Ga0501034_0129179 3300049571 Bacteria 2510
283 Ga0501034_0157883 3300049571 Unclassified 2241
284 Ga0501034_0175999 3300049571 Bacteria 2105
285 Ga0501034_0322489 3300049571 Bacteria 1477
286 Ga0501034_0750233 3300049571 Bacteria 871
287 Ga0501034_0905616 3300049571 Bacteria 770
288 Ga0501036_0000021 3300049572 Bacteria 114136
289 Ga0501036_0000363 3300049572 Bacteria 31929
290 Ga0501036_0006474 3300049572 Bacteria 9514
291 Ga0501036_0014463 3300049572 Bacteria 6575
292 Ga0501036_0018737 3300049572 Bacteria 5806
293 Ga0501036_0029293 3300049572 Bacteria 4653
294 Ga0501036_0031822 3300049572 Bacteria 4457
295 Ga0501036_0055983 3300049572 Viruses 3340
296 Ga0501036_0072979 3300049572 Bacteria 2901
297 Ga0501036_0211003 3300049572 Bacteria 1632
298 Ga0501036_0347093 3300049572 Bacteria 1239
299 Ga0501037_0000032 3300049573 Bacteria 132863
300 Ga0501037_0000314 3300049573 Bacteria 41093
301 Ga0501037_0029232 3300049573 Bacteria 4071
302 Ga0501037_0045969 3300049573 Bacteria 3203
303 Ga0501037_0097556 3300049573 Unclassified 2123
304 Ga0501037_0116137 3300049573 Unclassified 1926
305 Ga0501037_0130088 3300049573 Bacteria 1805
306 Ga0501038_0000070 3300049574 Bacteria 84371
307 Ga0501038_0000151 3300049574 Bacteria 59383
308 Ga0501038_0006295 3300049574 Bacteria 10978
309 Ga0501038_0008898 3300049574 Bacteria 9213
310 Ga0501038_0015690 3300049574 Bacteria 6884
311 Ga0501038_0153594 3300049574 Bacteria 1875
312 Ga0501038_0282843 3300049574 Bacteria 1305
313 Ga0501039_0000018 3300049575 Bacteria 176187
314 Ga0501039_0000213 3300049575 Bacteria 42565
315 Ga0501039_0034632 3300049575 Bacteria 3896
316 Ga0501039_0051628 3300049575 Bacteria 3181
317 Ga0501039_0052531 3300049575 Bacteria 3153
318 Ga0501039_0140626 3300049575 Bacteria 1896
319 Ga0501039_0187656 3300049575 Bacteria 1626
320 Ga0501039_0205728 3300049575 Bacteria 1547
321 Ga0501039_0299407 3300049575 Bacteria 1264
322 Ga0501040_0380990 3300049576 Bacteria 1012
323 Ga0501042_0061103 3300049578 Bacteria 2692
324 Ga0501042_0106780 3300049578 Bacteria 2015
325 Ga0501042_0114295 3300049578 Bacteria 1944
326 Ga0501042_0648592 3300049578 Bacteria 767
327 Ga0501043_0000173 3300049579 Bacteria 57881
328 Ga0501043_0000297 3300049579 Bacteria 44905
329 Ga0501043_0010379 3300049579 Bacteria 7299
330 Ga0501043_0012904 3300049579 Bacteria 6530
331 Ga0501043_0013048 3300049579 Bacteria 6494
332 Ga0501043_0024534 3300049579 Bacteria 4731
333 Ga0501043_0433925 3300049579 Bacteria 989
334 Ga0501046_0012520 3300049580 Bacteria 7218
335 Ga0501046_0037538 3300049580 Bacteria 3892
336 Ga0501046_0040300 3300049580 Bacteria 3733
337 Ga0501046_0057167 3300049580 Bacteria 3060
338 Ga0501046_0058268 3300049580 Bacteria 3028
339 Ga0501046_0066836 3300049580 Bacteria 2801
340 Ga0501046_0482263 3300049580 Bacteria 889
341 Ga0501047_0000136 3300049581 Bacteria 89236
342 Ga0501047_0000232 3300049581 Bacteria 66245
343 Ga0501047_0007330 3300049581 Bacteria 10374
344 Ga0501047_0011817 3300049581 Bacteria 8258
345 Ga0501047_0034057 3300049581 Bacteria 4917
346 Ga0501047_0062786 3300049581 Bacteria 3583
347 Ga0501047_0122606 3300049581 Bacteria 2480
348 Ga0501047_0160514 3300049581 Unclassified 2119
349 Ga0501047_0275915 3300049581 Bacteria 1527
350 Ga0501047_0384225 3300049581 Bacteria 1238
351 Ga0501047_0563053 3300049581 Bacteria 963
352 Ga0501048_0000549 3300049582 Bacteria 26486
353 Ga0501048_0001340 3300049582 Bacteria 18669
354 Ga0501048_0024351 3300049582 Bacteria 4419
355 Ga0501048_0114709 3300049582 Unclassified 1903
356 Ga0501067_0000177 3300049583 Bacteria 35936
357 Ga0501067_0013168 3300049583 Bacteria 4579
358 Ga0501067_0055515 3300049583 Bacteria 2195
359 Ga0501067_0143025 3300049583 Bacteria 1332
360 Ga0501068_0001111 3300049584 Bacteria 14242
361 Ga0501068_0015920 3300049584 Bacteria 4330
362 Ga0501068_0106885 3300049584 Bacteria 1737
363 Ga0501068_0107151 3300049584 Bacteria 1735
364 Ga0501068_0124609 3300049584 Bacteria 1608
365 Ga0501069_0003421 3300049585 Bacteria 8151
366 Ga0501069_0228266 3300049585 Bacteria 1083
367 Ga0501070_0005468 3300049586 Bacteria 10843
368 Ga0501070_0005643 3300049586 Bacteria 10672
369 Ga0501070_0066554 3300049586 Bacteria 2983
370 Ga0501070_0083319 3300049586 Bacteria 2647
371 Ga0501070_0117236 3300049586 Bacteria 2199
372 Ga0501070_0133331 3300049586 Bacteria 2051
373 Ga0501070_0135074 3300049586 Bacteria 2037
374 Ga0501070_0151685 3300049586 Unclassified 1912
375 Ga0501070_0225428 3300049586 Bacteria 1536
376 Ga0501071_0106557 3300049587 Bacteria 2069
377 Ga0501071_0110745 3300049587 Unclassified 2029
378 Ga0501072_0040544 3300049588 Bacteria 3656
379 Ga0501072_0131468 3300049588 Bacteria 1995
380 Ga0501072_0489352 3300049588 Bacteria 973
381 Ga0501073_0001892 3300049589 Bacteria 15598
382 Ga0501073_0022534 3300049589 Bacteria 4535
383 Ga0501073_0029396 3300049589 Bacteria 3928
384 Ga0501073_0037859 3300049589 Bacteria 3423
385 Ga0501073_0043275 3300049589 Bacteria 3175
386 Ga0501073_0230158 3300049589 Bacteria 1280
387 Ga0501073_0434688 3300049589 Bacteria 907
388 Ga0501074_0000704 3300049590 Bacteria 20903
389 Ga0501074_0047759 3300049590 Bacteria 3093
390 Ga0501074_0356843 3300049590 Unclassified 1037
391 Ga0501075_0387826 3300049591 Unclassified 1065
392 Ga0501076_0383513 3300049592 Unclassified 1155
393 Ga0501077_0168671 3300049593 Unclassified 1391
394 Ga0501079_0011681 3300049741 Bacteria 6708
395 Ga0501079_0011682 3300049741 Bacteria 6708
396 Ga0501079_0190051 3300049741 Bacteria 1602
397 Ga0501080_0000022 3300049742 Bacteria 90630
398 Ga0501080_0009885 3300049742 Bacteria 8713
399 Ga0501080_0017797 3300049742 Bacteria 6577
400 Ga0501080_0019442 3300049742 Bacteria 6291
401 Ga0501080_0020763 3300049742 Bacteria 6081
402 Ga0501080_0220618 3300049742 Bacteria 1735
403 Ga0501080_0565795 3300049742 Bacteria 1011
404 Ga0501081_0106470 3300049743 Bacteria 1988
405 Ga0501083_0000300 3300049744 Bacteria 31205
406 Ga0501083_0000780 3300049744 Bacteria 20915
407 Ga0501083_0027686 3300049744 Bacteria 3909
408 Ga0501083_0151718 3300049744 Unclassified 1517
409 Ga0501083_0408677 3300049744 Bacteria 883
410 Ga0501035_0000019 3300049822 Bacteria 241152
411 Ga0501035_0000120 3300049822 Bacteria 94532
412 Ga0501035_0004438 3300049822 Bacteria 13313
413 Ga0501035_0025647 3300049822 Bacteria 5403
414 Ga0501035_0041119 3300049822 Bacteria 4175
415 Ga0501035_0057895 3300049822 Bacteria 3454
416 Ga0501035_0079467 3300049822 Bacteria 2897
417 Ga0501035_0084143 3300049822 Bacteria 2806
418 Ga0501035_0176682 3300049822 Viruses 1841
419 Ga0501035_0197905 3300049822 Bacteria 1725
420 Ga0501035_0228779 3300049822 Bacteria 1585
421 Ga0501035_0488076 3300049822 Bacteria 1015
422 Ga0501044_0000179 3300049823 Bacteria 78633
423 Ga0501044_0004040 3300049823 Bacteria 16460
424 Ga0501044_0011930 3300049823 Bacteria 9417
425 Ga0501044_0017473 3300049823 Bacteria 7698
426 Ga0501044_0017954 3300049823 Bacteria 7586
427 Ga0501044_0025943 3300049823 Bacteria 6209
428 Ga0501044_0036303 3300049823 Bacteria 5157
429 Ga0501044_0045084 3300049823 Bacteria 4572
430 Ga0501044_0096820 3300049823 Bacteria 2972
431 Ga0501044_0101579 3300049823 Bacteria 2893
432 Ga0501044_0168908 3300049823 Bacteria 2160
433 Ga0501044_0179856 3300049823 Bacteria 2082
434 Ga0501044_0198368 3300049823 Bacteria 1966
435 Ga0501044_0228416 3300049823 Bacteria 1809
436 Ga0501044_0229275 3300049823 Bacteria 1805
437 Ga0501044_0478362 3300049823 Bacteria 1149
438 Ga0501044_0503495 3300049823 Bacteria 1112
439 Ga0501045_0068065 3300049824 Bacteria 2615
440 Ga0501045_0195226 3300049824 Bacteria 1508
441 nmdc:mga07m45_3561_c2 3300050496 Bacteria 7086
442 nmdc:mga05p37_303128_c1 3300050507 Bacteria 1897
443 nmdc:mga08y16_24_c1 3300050511 Bacteria 240846
444 nmdc:mga08x19_504361_c1 3300050514 Bacteria 854
445 Ga0501084_0021644 3300054114 Bacteria 5361
446 Ga0501084_0192348 3300054114 Bacteria 1721
447 Ga0501084_0204927 3300054114 Viruses 1664
448 Ga0501084_0209000 3300054114 Bacteria 1647
449 Ga0501082_0002527 3300060353 Bacteria 16018
450 Ga0501082_0115197 3300060353 Bacteria 2328
451 Ga0501082_0118819 3300060353 Unclassified 2290
452 Ga0501082_0251353 3300060353 Bacteria 1538
453 Ga0501082_0369073 3300060353 Bacteria 1252
454 Ga0530510_0529736 3300061734 Unclassified 894
455 2513862481 2513237137 Bacteria 9558895
456 2671118292 2667528175 Bacteria 7532676
457 2903771109 2903768456 Bacteria 9749579
458 2932800238 2932794094 Bacteria 7915132
459 2935775989 2935769743 Bacteria 7878163
460 2935791607 2935785616 Bacteria 7962367
461 2935799919 2935793552 Bacteria 8012592
462 2941510113 2941507105 Bacteria 8166816
463 2941518800 2941515067 Bacteria 8166720
464 2941525512 2941523033 Bacteria 8169134
465 3005597737 3005594810 Bacteria 8716512
466 8016629851 8016622563 Bacteria 7999408
467 8019541516 8019538911 Bacteria 7872763
468 8019548789 8019547302 Bacteria 7996444
469 Ga0373943_0036499
470 JGI24033J26618_1006767
471 rootH2_10064446
472 rootL2_10273162
473 Ga0065704_10109347
474 Ga0070658_10208875
475 Ga0070658_10280832
476 Ga0070658_10314686
477 Ga0070658_10426388
478 Ga0070658_10600066
479 Ga0070683_100097354
480 Ga0070683_100510057
481 Ga0070683_100651604
482 Ga0070670_100746222
483 Ga0070666_10249582
484 Ga0070680_100002269
485 Ga0070680_100263301
486 Ga0070660_100000495
487 Ga0070660_100161347
488 Ga0070661_100000286
489 Ga0070668_100048364
490 Ga0070671_100001618
491 Ga0070671_100063469
492 Ga0070659_100001748
493 Ga0070659_100072472
494 Ga0070667_100059567
495 Ga0070667_100253764
496 Ga0070714_100012582
497 Ga0070713_100017465
498 Ga0070713_100023205
499 Ga0070713_100126813
500 Ga0070713_100247803
501 Ga0070700_100000050
502 Ga0070694_100175584
503 Ga0070663_100870960
504 Ga0070678_100054316
505 Ga0070662_100000071
506 Ga0070662_100002862
507 Ga0070662_100009722
508 Ga0070681_10098777
509 Ga0070681_10165500
510 Ga0070681_10490787
511 Ga0070681_10496081
512 Ga0070685_10028801
513 Ga0070679_100001065
514 Ga0070679_100002568
515 Ga0070679_100073730
516 Ga0070679_100157267
517 Ga0070684_100041694
518 Ga0070684_100180879
519 Ga0068853_100000412
520 Ga0068853_100459591
521 Ga0068853_100665282
522 Ga0070686_100193094
523 Ga0070665_100001223
524 Ga0070665_100002567
525 Ga0068855_100000970
526 Ga0068855_100212919
527 Ga0068855_100391230
528 Ga0068855_101008866
529 Ga0068854_100002427
530 Ga0068854_100061887
531 Ga0068856_100003912
532 Ga0068856_100347701
533 Ga0070702_100178868
534 Ga0068852_100778486
535 Ga0068852_100848206
536 Ga0068863_100166213
537 Ga0068858_100588670
538 Ga0068860_100069797
539 Ga0068862_100060369
540 Ga0070717_10222322
541 Ga0097621_100823684
542 Ga0068871_100471347
543 Ga0105251_10004452
544 Ga0105240_10176628
545 Ga0111539_10000022
546 Ga0105247_10085586
547 Ga0114129_10189766
548 Ga0105241_10183365
549 Ga0105241_10581603
550 Ga0105248_10006383
551 Ga0105237_10115718
552 Ga0105238_10053507
553 Ga0105238_10136644
554 Ga0105238_10265548
555 Ga0105239_10430249
556 Ga0105246_10000140
557 Ga0157373_10011413
558 Ga0157373_10031124
559 Ga0157371_10001293
560 Ga0157371_10023143
561 Ga0157371_10340513
562 Ga0157370_10000991
563 Ga0157370_10443754
564 Ga0157369_10025428
565 Ga0157372_10000946
566 Ga0157372_10537576
567 Ga0157375_10142644
568 Ga0157375_10517447
569 Ga0213872_10006301
570 Ga0213874_10061066
571 Ga0213876_10069899
572 Ga0213876_10076934
573 Ga0213876_10249058
574 Ga0213876_10256005
575 Ga0213876_10335349
576 Ga0209677_101747
577 Ga0209455_1001581
578 Ga0209455_1003093
579 Ga0207713_1007410
580 Ga0207692_10052693
581 Ga0207680_10147027
582 Ga0207699_10396307
583 Ga0207705_10183921
584 Ga0207705_10369466
585 Ga0207707_10000438
586 Ga0207707_10137763
587 Ga0207707_10154134
588 Ga0207671_10268044
589 Ga0207657_10098215
590 Ga0207652_10003966
591 Ga0207652_10014003
592 Ga0207652_10024967
593 Ga0207652_10117758
594 Ga0207652_10207486
595 Ga0207694_10037591
596 Ga0207694_10497061
597 Ga0207650_10324797
598 Ga0207659_10159043
599 Ga0207687_10280980
600 Ga0207700_10587082
601 Ga0207664_10019360
602 Ga0207644_10001525
603 Ga0207644_10318409
604 Ga0207690_10505975
605 Ga0207706_10015910
606 Ga0207706_10083322
607 Ga0207711_10003400
608 Ga0207661_10581430
609 Ga0207661_10628701
610 Ga0207667_10215481
611 Ga0207667_10510953
612 Ga0207667_10820549
613 Ga0207651_10162085
614 Ga0207668_10004323
615 Ga0207640_10063919
616 Ga0207658_10007705
617 Ga0207703_10350084
618 Ga0207678_10202085
619 Ga0207678_10295111
620 Ga0207702_10460130
621 Ga0207641_10000986
622 Ga0207674_10319143
623 Ga0207683_10153437
624 Ga0207698_10342232
625 Ga0207428_10000030
626 Ga0268266_10001277
627 Ga0268266_10009653
628 Ga0268265_10027609
629 Ga0268264_10009245
630 Ga0265325_10001061
631 Ga0265340_10018668
632 Ga0373954_0308384
633 Ga0373931_0222731
634 Ga0373925_0052905
635 Ga0395899_0000666
636 Ga0395899_0028038
637 Ga0395899_0035399
638 Ga0395900_0000016
639 Ga0395900_0011893
640 Ga0395898_0002730
641 Ga0395898_0023416
642 Ga0395898_0026631
643 Ga0395898_0036472
644 Ga0395905_0006525
645 Ga0395905_0418392
646 Ga0436364_0985720
647 Ga0436364_1565160
648 Ga0395901_0000022
649 Ga0395901_0003226
650 Ga0395901_0042548
651 Ga0395901_0149686
652 Ga0395901_0311300
653 Ga0436365_0106371
654 Ga0436365_0922842
655 Ga0436365_1138685
656 Ga0436365_1649283
657 Ga0436365_1850675
658 Ga0436361_0306530
659 Ga0436363_0186689
660 Ga0436363_0742585
661 Ga0436363_1099119
662 Ga0436362_1058008
663 Ga0439448_0172612
664 Ga0466966_0143536
665 Ga0466957_0113418
666 Ga0451576_0732747
667 Ga0466958_0889624
668 Ga0466967_0048210
669 Ga0466967_0323794
670 Ga0495603_0036713
671 Ga0495651_0113067
672 Ga0495628_0132582
673 Ga0495640_0131344
674 Ga0495646_0064253
675 Ga0495624_0118058
676 Ga0495581_0049264
677 Ga0496100_0112054
678 Ga0496101_0009883
679 Ga0496101_0872962
680 Ga0496102_0004215
681 Ga0496102_0187064
682 Ga0496103_0022442
683 Ga0496104_0007908
684 Ga0496104_0316688
685 Ga0496105_0090751
686 Ga0496106_0002322
687 Ga0496106_0199332
688 Ga0496106_0298242
689 Ga0496106_0422824
690 Ga0496106_0475083
691 Ga0496107_0123108
692 Ga0496107_0691691
693 Ga0496108_0001632
694 Ga0496109_0003738
695 Ga0496109_0030753
696 Ga0496110_0008560
697 Ga0496110_0097068
698 Ga0496111_0016726
699 Ga0496112_0004450
700 Ga0496112_0022022
701 Ga0496112_0093334
702 Ga0496112_0632173
703 Ga0496113_0033723
704 Ga0496113_0097574
705 Ga0496113_0525818
706 Ga0496114_0017787
707 Ga0496115_0053502
708 Ga0496115_0160417
709 Ga0496116_0064052
710 Ga0496117_0011504
711 Ga0496117_0042390
712 Ga0496118_0007103
713 Ga0496118_0048911
714 Ga0496119_0100782
715 Ga0496119_0108528
716 Ga0496121_0013034
717 Ga0496121_0022044
718 Ga0496121_0082590
719 Ga0496121_0144183
720 Ga0496123_0110482
721 Ga0496124_0010621
722 Ga0496124_0027848
723 Ga0496124_0068079
724 Ga0496124_0478139
725 Ga0496125_0052659
726 Ga0496126_0254712
727 Ga0496126_0450251
728 Ga0495682_0046819
729 Ga0501031_0016392
730 Ga0501032_0000026
731 Ga0501032_0000055
732 Ga0501032_0026531
733 Ga0501032_0035196
734 Ga0501032_0077346
735 Ga0501032_0093955
736 Ga0501032_0373992
737 Ga0501033_0000163
738 Ga0501033_0001033
739 Ga0501033_0004474
740 Ga0501033_0005801
741 Ga0501033_0023569
742 Ga0501033_0028449
743 Ga0501033_0458597
744 Ga0501034_0000054
745 Ga0501034_0001317
746 Ga0501034_0013063
747 Ga0501034_0014890
748 Ga0501034_0018723
749 Ga0501034_0049515
750 Ga0501034_0129179
751 Ga0501034_0157883
752 Ga0501034_0175999
753 Ga0501034_0322489
754 Ga0501034_0750233
755 Ga0501034_0905616
756 Ga0501036_0000021
757 Ga0501036_0000363
758 Ga0501036_0006474
759 Ga0501036_0014463
760 Ga0501036_0018737
761 Ga0501036_0029293
762 Ga0501036_0031822
763 Ga0501036_0055983
764 Ga0501036_0072979
765 Ga0501036_0211003
766 Ga0501036_0347093
767 Ga0501037_0000032
768 Ga0501037_0000314
769 Ga0501037_0029232
770 Ga0501037_0045969
771 Ga0501037_0097556
772 Ga0501037_0116137
773 Ga0501037_0130088
774 Ga0501038_0000070
775 Ga0501038_0000151
776 Ga0501038_0006295
777 Ga0501038_0008898
778 Ga0501038_0015690
779 Ga0501038_0153594
780 Ga0501038_0282843
781 Ga0501039_0000018
782 Ga0501039_0000213
783 Ga0501039_0034632
784 Ga0501039_0051628
785 Ga0501039_0052531
786 Ga0501039_0140626
787 Ga0501039_0187656
788 Ga0501039_0205728
789 Ga0501039_0299407
790 Ga0501040_0380990
791 Ga0501042_0061103
792 Ga0501042_0106780
793 Ga0501042_0114295
794 Ga0501042_0648592
795 Ga0501043_0000173
796 Ga0501043_0000297
797 Ga0501043_0010379
798 Ga0501043_0012904
799 Ga0501043_0013048
800 Ga0501043_0024534
801 Ga0501043_0433925
802 Ga0501046_0012520
803 Ga0501046_0037538
804 Ga0501046_0040300
805 Ga0501046_0057167
806 Ga0501046_0058268
807 Ga0501046_0066836
808 Ga0501046_0482263
809 Ga0501047_0000136
810 Ga0501047_0000232
811 Ga0501047_0007330
812 Ga0501047_0011817
813 Ga0501047_0034057
814 Ga0501047_0062786
815 Ga0501047_0122606
816 Ga0501047_0160514
817 Ga0501047_0275915
818 Ga0501047_0384225
819 Ga0501047_0563053
820 Ga0501048_0000549
821 Ga0501048_0001340
822 Ga0501048_0024351
823 Ga0501048_0114709
824 Ga0501067_0000177
825 Ga0501067_0013168
826 Ga0501067_0055515
827 Ga0501067_0143025
828 Ga0501068_0001111
829 Ga0501068_0015920
830 Ga0501068_0106885
831 Ga0501068_0107151
832 Ga0501068_0124609
833 Ga0501069_0003421
834 Ga0501069_0228266
835 Ga0501070_0005468
836 Ga0501070_0005643
837 Ga0501070_0066554
838 Ga0501070_0083319
839 Ga0501070_0117236
840 Ga0501070_0133331
841 Ga0501070_0135074
842 Ga0501070_0151685
843 Ga0501070_0225428
844 Ga0501071_0106557
845 Ga0501071_0110745
846 Ga0501072_0040544
847 Ga0501072_0131468
848 Ga0501072_0489352
849 Ga0501073_0001892
850 Ga0501073_0022534
851 Ga0501073_0029396
852 Ga0501073_0037859
853 Ga0501073_0043275
854 Ga0501073_0230158
855 Ga0501073_0434688
856 Ga0501074_0000704
857 Ga0501074_0047759
858 Ga0501074_0356843
859 Ga0501075_0387826
860 Ga0501076_0383513
861 Ga0501077_0168671
862 Ga0501079_0011681
863 Ga0501079_0011682
864 Ga0501079_0190051
865 Ga0501080_0000022
866 Ga0501080_0009885
867 Ga0501080_0017797
868 Ga0501080_0019442
869 Ga0501080_0020763
870 Ga0501080_0220618
871 Ga0501080_0565795
872 Ga0501081_0106470
873 Ga0501083_0000300
874 Ga0501083_0000780
875 Ga0501083_0027686
876 Ga0501083_0151718
877 Ga0501083_0408677
878 Ga0501035_0000019
879 Ga0501035_0000120
880 Ga0501035_0004438
881 Ga0501035_0025647
882 Ga0501035_0041119
883 Ga0501035_0057895
884 Ga0501035_0079467
885 Ga0501035_0084143
886 Ga0501035_0176682
887 Ga0501035_0197905
888 Ga0501035_0228779
889 Ga0501035_0488076
890 Ga0501044_0000179
891 Ga0501044_0004040
892 Ga0501044_0011930
893 Ga0501044_0017473
894 Ga0501044_0017954
895 Ga0501044_0025943
896 Ga0501044_0036303
897 Ga0501044_0045084
898 Ga0501044_0096820
899 Ga0501044_0101579
900 Ga0501044_0168908
901 Ga0501044_0179856
902 Ga0501044_0198368
903 Ga0501044_0228416
904 Ga0501044_0229275
905 Ga0501044_0478362
906 Ga0501044_0503495
907 Ga0501045_0068065
908 Ga0501045_0195226
909 nmdc:mga07m45_3561_c2
910 nmdc:mga05p37_303128_c1
911 nmdc:mga08y16_24_c1
912 nmdc:mga08x19_504361_c1
913 Ga0501084_0021644
914 Ga0501084_0192348
915 Ga0501084_0204927
916 Ga0501084_0209000
917 Ga0501082_0002527
918 Ga0501082_0115197
919 Ga0501082_0118819
920 Ga0501082_0251353
921 Ga0501082_0369073
922 Ga0530510_0529736
923 2513862481
924 2671118292
925 2903771109
926 2932800238
927 2935775989
928 2935791607
929 2935799919
930 2941510113
931 2941518800
932 2941525512
933 3005597737
934 8016629851
935 8019541516
936 8019548789

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6f0k-assembly1.cif.gz_A alternative complex iii 0.4205 5 215
6f0k-assembly1.cif.gz_A alternative complex iii 0.4186 5 215
6loe-assembly1.cif.gz_A cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.4132 3 215
6loe-assembly1.cif.gz_A cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.4076 3 215
8i9p-assembly1.cif.gz_LT cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state mak16 0.1939 83 157
ID Description Score Start End Superfamily
5xymO01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.2705 152 205 3.30.420.100
1j3sA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.2184 131 203 1.10.760.10
af_A0A1D6EWS0_235_361_1.10.8.480 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.2141 104 207 1.10.8.480
af_A4I515_256_374_1.10.8.480 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.1818 85 207 1.10.8.480
5xymO01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.1767 152 205 3.30.420.100
ID Description Score Start End GO Terms
AF-A0A1I2GTL6-F1-model_v4 deleted 0.9259 135 215
AF-A0A846FGH2-F1-model_v4 deleted 0.9096 135 215
AF-A0A2V5XVR8-F1-model_v4 Cytochrome C 0.9014 126 215
AF-A0A435XU15-F1-model_v4 Cytochrome C 0.8896 122 215
AF-A0A7V5ERI5-F1-model_v4 Cytochrome C 0.8865 133 215 GO:0030313

Map