F450072
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 468 | 207 | 936 | 216 |
Family's Representative Sequence
| Representative Sequence | 3300035170|Ga0373943_0036499|Ga0373943_0036499_1188_1955 |
| Length | 255 |
| Sequence | MLEFRRREQSVSFAWVPNKERFRLEGISRQTRVRQAGMTQIFAPAADTWLRLFLAGGLALLGGGLVGVIGFAHSAYMTSTDFRPQQPVPFSHKHHAGELGIDCRYCHSGVETGPQAGLPPTTTCMTXXXQIWTNAAMLEPVRQSLAQQKPIAWTRVAKLPDYVFFRHDIHVAKGVGCETCHGRIDTMPLTYRAKAFTMEFCIDCHRDPAPNLRPQESITEMGWKTPSDAQKQGEAIAAHEGIRFGELTHCYVCHR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 2 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 43 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 61 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 62 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 63 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 98 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 102 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 103 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 104 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 105 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 106 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 107 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 108 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 109 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 110 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 111 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 112 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 113 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 114 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 115 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 116 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 117 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 118 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 119 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 120 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 121 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 122 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 130 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 132 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 133 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 134 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 135 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 136 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 137 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 140 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 141 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 142 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 143 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 144 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 145 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 146 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 147 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 148 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 149 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 150 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 151 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 152 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 153 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 154 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 188 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 194 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 195 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 196 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 197 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 198 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 199 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 200 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 201 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 202 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 203 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 204 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 205 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 206 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 207 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.01 |
| Metatranscriptomes | 0 |
| Isolates | 2.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.85 |
| Nodule | 2.56 |
| Rhizoplane | 7.05 |
| Rhizosphere | 81.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373943_0036499 | 3300035170 | Bacteria | 2354 |
| 2 | JGI24033J26618_1006767 | 3300002155 | Bacteria | 1293 |
| 3 | rootH2_10064446 | 3300003320 | Bacteria | 4398 |
| 4 | rootL2_10273162 | 3300003322 | Bacteria | 3397 |
| 5 | Ga0065704_10109347 | 3300005289 | Bacteria | 2006 |
| 6 | Ga0070658_10208875 | 3300005327 | Bacteria | 1649 |
| 7 | Ga0070658_10280832 | 3300005327 | Bacteria | 1417 |
| 8 | Ga0070658_10314686 | 3300005327 | Bacteria | 1336 |
| 9 | Ga0070658_10426388 | 3300005327 | Bacteria | 1141 |
| 10 | Ga0070658_10600066 | 3300005327 | Bacteria | 954 |
| 11 | Ga0070683_100097354 | 3300005329 | Bacteria | 2768 |
| 12 | Ga0070683_100510057 | 3300005329 | Bacteria | 1149 |
| 13 | Ga0070683_100651604 | 3300005329 | Bacteria | 1008 |
| 14 | Ga0070670_100746222 | 3300005331 | Bacteria | 882 |
| 15 | Ga0070666_10249582 | 3300005335 | Unclassified | 1256 |
| 16 | Ga0070680_100002269 | 3300005336 | Bacteria | 14213 |
| 17 | Ga0070680_100263301 | 3300005336 | Bacteria | 1459 |
| 18 | Ga0070660_100000495 | 3300005339 | Bacteria | 26212 |
| 19 | Ga0070660_100161347 | 3300005339 | Bacteria | 1806 |
| 20 | Ga0070661_100000286 | 3300005344 | Bacteria | 40815 |
| 21 | Ga0070668_100048364 | 3300005347 | Unclassified | 3270 |
| 22 | Ga0070671_100001618 | 3300005355 | Bacteria | 16970 |
| 23 | Ga0070671_100063469 | 3300005355 | Bacteria | 3076 |
| 24 | Ga0070659_100001748 | 3300005366 | Bacteria | 15598 |
| 25 | Ga0070659_100072472 | 3300005366 | Bacteria | 2741 |
| 26 | Ga0070667_100059567 | 3300005367 | Unclassified | 3230 |
| 27 | Ga0070667_100253764 | 3300005367 | Bacteria | 1573 |
| 28 | Ga0070714_100012582 | 3300005435 | Bacteria | 6760 |
| 29 | Ga0070713_100017465 | 3300005436 | Bacteria | 5427 |
| 30 | Ga0070713_100023205 | 3300005436 | Bacteria | 4810 |
| 31 | Ga0070713_100126813 | 3300005436 | Bacteria | 2246 |
| 32 | Ga0070713_100247803 | 3300005436 | Bacteria | 1624 |
| 33 | Ga0070700_100000050 | 3300005441 | Bacteria | 88421 |
| 34 | Ga0070694_100175584 | 3300005444 | Bacteria | 1581 |
| 35 | Ga0070663_100870960 | 3300005455 | Bacteria | 776 |
| 36 | Ga0070678_100054316 | 3300005456 | Bacteria | 2918 |
| 37 | Ga0070662_100000071 | 3300005457 | Bacteria | 55762 |
| 38 | Ga0070662_100002862 | 3300005457 | Bacteria | 10699 |
| 39 | Ga0070662_100009722 | 3300005457 | Bacteria | 6294 |
| 40 | Ga0070681_10098777 | 3300005458 | Bacteria | 2865 |
| 41 | Ga0070681_10165500 | 3300005458 | Bacteria | 2134 |
| 42 | Ga0070681_10490787 | 3300005458 | Bacteria | 1141 |
| 43 | Ga0070681_10496081 | 3300005458 | Bacteria | 1134 |
| 44 | Ga0070685_10028801 | 3300005466 | Bacteria | 3081 |
| 45 | Ga0070679_100001065 | 3300005530 | Bacteria | 23946 |
| 46 | Ga0070679_100002568 | 3300005530 | Bacteria | 16485 |
| 47 | Ga0070679_100073730 | 3300005530 | Bacteria | 3404 |
| 48 | Ga0070679_100157267 | 3300005530 | Bacteria | 2247 |
| 49 | Ga0070684_100041694 | 3300005535 | Bacteria | 3959 |
| 50 | Ga0070684_100180879 | 3300005535 | Bacteria | 1917 |
| 51 | Ga0068853_100000412 | 3300005539 | Bacteria | 29460 |
| 52 | Ga0068853_100459591 | 3300005539 | Bacteria | 1198 |
| 53 | Ga0068853_100665282 | 3300005539 | Bacteria | 992 |
| 54 | Ga0070686_100193094 | 3300005544 | Bacteria | 1454 |
| 55 | Ga0070665_100001223 | 3300005548 | Bacteria | 31260 |
| 56 | Ga0070665_100002567 | 3300005548 | Bacteria | 19910 |
| 57 | Ga0068855_100000970 | 3300005563 | Bacteria | 35729 |
| 58 | Ga0068855_100212919 | 3300005563 | Bacteria | 2170 |
| 59 | Ga0068855_100391230 | 3300005563 | Bacteria | 1525 |
| 60 | Ga0068855_101008866 | 3300005563 | Bacteria | 874 |
| 61 | Ga0068854_100002427 | 3300005578 | Bacteria | 11512 |
| 62 | Ga0068854_100061887 | 3300005578 | Bacteria | 2712 |
| 63 | Ga0068856_100003912 | 3300005614 | Bacteria | 14932 |
| 64 | Ga0068856_100347701 | 3300005614 | Bacteria | 1501 |
| 65 | Ga0070702_100178868 | 3300005615 | Bacteria | 1386 |
| 66 | Ga0068852_100778486 | 3300005616 | Bacteria | 970 |
| 67 | Ga0068852_100848206 | 3300005616 | Bacteria | 929 |
| 68 | Ga0068863_100166213 | 3300005841 | Bacteria | 2116 |
| 69 | Ga0068858_100588670 | 3300005842 | Bacteria | 1079 |
| 70 | Ga0068860_100069797 | 3300005843 | Unclassified | 3340 |
| 71 | Ga0068862_100060369 | 3300005844 | Bacteria | 3257 |
| 72 | Ga0070717_10222322 | 3300006028 | Bacteria | 1660 |
| 73 | Ga0097621_100823684 | 3300006237 | Bacteria | 861 |
| 74 | Ga0068871_100471347 | 3300006358 | Bacteria | 1128 |
| 75 | Ga0105251_10004452 | 3300009011 | Bacteria | 9529 |
| 76 | Ga0105240_10176628 | 3300009093 | Bacteria | 2524 |
| 77 | Ga0111539_10000022 | 3300009094 | Bacteria | 240838 |
| 78 | Ga0105247_10085586 | 3300009101 | Unclassified | 1994 |
| 79 | Ga0114129_10189766 | 3300009147 | Bacteria | 2791 |
| 80 | Ga0105241_10183365 | 3300009174 | Bacteria | 1738 |
| 81 | Ga0105241_10581603 | 3300009174 | Unclassified | 1009 |
| 82 | Ga0105248_10006383 | 3300009177 | Bacteria | 12942 |
| 83 | Ga0105237_10115718 | 3300009545 | Bacteria | 2675 |
| 84 | Ga0105238_10053507 | 3300009551 | Bacteria | 4056 |
| 85 | Ga0105238_10136644 | 3300009551 | Bacteria | 2429 |
| 86 | Ga0105238_10265548 | 3300009551 | Bacteria | 1696 |
| 87 | Ga0105239_10430249 | 3300010375 | Bacteria | 1496 |
| 88 | Ga0105246_10000140 | 3300011119 | Bacteria | 33633 |
| 89 | Ga0157373_10011413 | 3300013100 | Bacteria | 6534 |
| 90 | Ga0157373_10031124 | 3300013100 | Bacteria | 3840 |
| 91 | Ga0157371_10001293 | 3300013102 | Bacteria | 26356 |
| 92 | Ga0157371_10023143 | 3300013102 | Bacteria | 4543 |
| 93 | Ga0157371_10340513 | 3300013102 | Bacteria | 1091 |
| 94 | Ga0157370_10000991 | 3300013104 | Bacteria | 35836 |
| 95 | Ga0157370_10443754 | 3300013104 | Bacteria | 1193 |
| 96 | Ga0157369_10025428 | 3300013105 | Bacteria | 6575 |
| 97 | Ga0157372_10000946 | 3300013307 | Bacteria | 31733 |
| 98 | Ga0157372_10537576 | 3300013307 | Bacteria | 1362 |
| 99 | Ga0157375_10142644 | 3300013308 | Bacteria | 2523 |
| 100 | Ga0157375_10517447 | 3300013308 | Bacteria | 1357 |
| 101 | Ga0213872_10006301 | 3300021361 | Bacteria | 5981 |
| 102 | Ga0213874_10061066 | 3300021377 | Bacteria | 1180 |
| 103 | Ga0213876_10069899 | 3300021384 | Bacteria | 1855 |
| 104 | Ga0213876_10076934 | 3300021384 | Bacteria | 1762 |
| 105 | Ga0213876_10249058 | 3300021384 | Bacteria | 944 |
| 106 | Ga0213876_10256005 | 3300021384 | Bacteria | 930 |
| 107 | Ga0213876_10335349 | 3300021384 | Bacteria | 804 |
| 108 | Ga0209677_101747 | 3300025253 | Bacteria | 9025 |
| 109 | Ga0209455_1001581 | 3300025272 | Bacteria | 10032 |
| 110 | Ga0209455_1003093 | 3300025272 | Bacteria | 6073 |
| 111 | Ga0207713_1007410 | 3300025735 | Bacteria | 6479 |
| 112 | Ga0207692_10052693 | 3300025898 | Bacteria | 2069 |
| 113 | Ga0207680_10147027 | 3300025903 | Bacteria | 1568 |
| 114 | Ga0207699_10396307 | 3300025906 | Bacteria | 982 |
| 115 | Ga0207705_10183921 | 3300025909 | Bacteria | 1578 |
| 116 | Ga0207705_10369466 | 3300025909 | Bacteria | 1107 |
| 117 | Ga0207707_10000438 | 3300025912 | Bacteria | 43316 |
| 118 | Ga0207707_10137763 | 3300025912 | Bacteria | 2134 |
| 119 | Ga0207707_10154134 | 3300025912 | Bacteria | 2009 |
| 120 | Ga0207671_10268044 | 3300025914 | Bacteria | 1345 |
| 121 | Ga0207657_10098215 | 3300025919 | Bacteria | 2434 |
| 122 | Ga0207652_10003966 | 3300025921 | Bacteria | 12099 |
| 123 | Ga0207652_10014003 | 3300025921 | Bacteria | 6494 |
| 124 | Ga0207652_10024967 | 3300025921 | Bacteria | 4963 |
| 125 | Ga0207652_10117758 | 3300025921 | Bacteria | 2360 |
| 126 | Ga0207652_10207486 | 3300025921 | Bacteria | 1764 |
| 127 | Ga0207694_10037591 | 3300025924 | Bacteria | 3719 |
| 128 | Ga0207694_10497061 | 3300025924 | Bacteria | 1021 |
| 129 | Ga0207650_10324797 | 3300025925 | Bacteria | 1261 |
| 130 | Ga0207659_10159043 | 3300025926 | Bacteria | 1772 |
| 131 | Ga0207687_10280980 | 3300025927 | Bacteria | 1334 |
| 132 | Ga0207700_10587082 | 3300025928 | Bacteria | 991 |
| 133 | Ga0207664_10019360 | 3300025929 | Bacteria | 5029 |
| 134 | Ga0207644_10001525 | 3300025931 | Bacteria | 14937 |
| 135 | Ga0207644_10318409 | 3300025931 | Bacteria | 1257 |
| 136 | Ga0207690_10505975 | 3300025932 | Bacteria | 977 |
| 137 | Ga0207706_10015910 | 3300025933 | Bacteria | 6798 |
| 138 | Ga0207706_10083322 | 3300025933 | Bacteria | 2811 |
| 139 | Ga0207711_10003400 | 3300025941 | Bacteria | 13775 |
| 140 | Ga0207661_10581430 | 3300025944 | Bacteria | 1027 |
| 141 | Ga0207661_10628701 | 3300025944 | Bacteria | 986 |
| 142 | Ga0207667_10215481 | 3300025949 | Bacteria | 1968 |
| 143 | Ga0207667_10510953 | 3300025949 | Bacteria | 1218 |
| 144 | Ga0207667_10820549 | 3300025949 | Bacteria | 926 |
| 145 | Ga0207651_10162085 | 3300025960 | Bacteria | 1754 |
| 146 | Ga0207668_10004323 | 3300025972 | Bacteria | 8339 |
| 147 | Ga0207640_10063919 | 3300025981 | Bacteria | 2448 |
| 148 | Ga0207658_10007705 | 3300025986 | Bacteria | 7333 |
| 149 | Ga0207703_10350084 | 3300026035 | Bacteria | 1360 |
| 150 | Ga0207678_10202085 | 3300026067 | Bacteria | 1699 |
| 151 | Ga0207678_10295111 | 3300026067 | Bacteria | 1392 |
| 152 | Ga0207702_10460130 | 3300026078 | Bacteria | 1236 |
| 153 | Ga0207641_10000986 | 3300026088 | Bacteria | 29083 |
| 154 | Ga0207674_10319143 | 3300026116 | Bacteria | 1503 |
| 155 | Ga0207683_10153437 | 3300026121 | Bacteria | 2079 |
| 156 | Ga0207698_10342232 | 3300026142 | Bacteria | 1409 |
| 157 | Ga0207428_10000030 | 3300027907 | Bacteria | 240846 |
| 158 | Ga0268266_10001277 | 3300028379 | Bacteria | 30750 |
| 159 | Ga0268266_10009653 | 3300028379 | Bacteria | 8486 |
| 160 | Ga0268265_10027609 | 3300028380 | Bacteria | 4053 |
| 161 | Ga0268264_10009245 | 3300028381 | Bacteria | 8161 |
| 162 | Ga0265325_10001061 | 3300031241 | Bacteria | 19772 |
| 163 | Ga0265340_10018668 | 3300031247 | Bacteria | 3576 |
| 164 | Ga0373954_0308384 | 3300035118 | Bacteria | 781 |
| 165 | Ga0373931_0222731 | 3300035691 | Bacteria | 1136 |
| 166 | Ga0373925_0052905 | 3300037068 | Bacteria | 3034 |
| 167 | Ga0395899_0000666 | 3300037312 | Bacteria | 34912 |
| 168 | Ga0395899_0028038 | 3300037312 | Bacteria | 4241 |
| 169 | Ga0395899_0035399 | 3300037312 | Bacteria | 3748 |
| 170 | Ga0395900_0000016 | 3300037418 | Bacteria | 382407 |
| 171 | Ga0395900_0011893 | 3300037418 | Bacteria | 8897 |
| 172 | Ga0395898_0002730 | 3300037466 | Bacteria | 20361 |
| 173 | Ga0395898_0023416 | 3300037466 | Bacteria | 6241 |
| 174 | Ga0395898_0026631 | 3300037466 | Bacteria | 5815 |
| 175 | Ga0395898_0036472 | 3300037466 | Bacteria | 4882 |
| 176 | Ga0395905_0006525 | 3300037471 | Bacteria | 11733 |
| 177 | Ga0395905_0418392 | 3300037471 | Bacteria | 1236 |
| 178 | Ga0436364_0985720 | 3300037853 | Bacteria | 1003 |
| 179 | Ga0436364_1565160 | 3300037853 | Bacteria | 827 |
| 180 | Ga0395901_0000022 | 3300038443 | Bacteria | 296356 |
| 181 | Ga0395901_0003226 | 3300038443 | Bacteria | 16405 |
| 182 | Ga0395901_0042548 | 3300038443 | Bacteria | 4710 |
| 183 | Ga0395901_0149686 | 3300038443 | Bacteria | 2453 |
| 184 | Ga0395901_0311300 | 3300038443 | Bacteria | 1631 |
| 185 | Ga0436365_0106371 | 3300039437 | Bacteria | 1890 |
| 186 | Ga0436365_0922842 | 3300039437 | Bacteria | 1812 |
| 187 | Ga0436365_1138685 | 3300039437 | Bacteria | 1180 |
| 188 | Ga0436365_1649283 | 3300039437 | Unclassified | 2225 |
| 189 | Ga0436365_1850675 | 3300039437 | Bacteria | 16914 |
| 190 | Ga0436361_0306530 | 3300039447 | Bacteria | 30241 |
| 191 | Ga0436363_0186689 | 3300039450 | Bacteria | 891 |
| 192 | Ga0436363_0742585 | 3300039450 | Bacteria | 2847 |
| 193 | Ga0436363_1099119 | 3300039450 | Bacteria | 1878 |
| 194 | Ga0436362_1058008 | 3300039453 | Bacteria | 3134 |
| 195 | Ga0439448_0172612 | 3300042005 | Bacteria | 754 |
| 196 | Ga0466966_0143536 | 3300044684 | Bacteria | 1458 |
| 197 | Ga0466957_0113418 | 3300044842 | Bacteria | 1721 |
| 198 | Ga0451576_0732747 | 3300045051 | Bacteria | 1038 |
| 199 | Ga0466958_0889624 | 3300045836 | Bacteria | 581 |
| 200 | Ga0466967_0048210 | 3300045976 | Bacteria | 3719 |
| 201 | Ga0466967_0323794 | 3300045976 | Bacteria | 1487 |
| 202 | Ga0495603_0036713 | 3300046455 | Bacteria | 2942 |
| 203 | Ga0495651_0113067 | 3300046462 | Bacteria | 2005 |
| 204 | Ga0495628_0132582 | 3300046516 | Bacteria | 1905 |
| 205 | Ga0495640_0131344 | 3300046533 | Bacteria | 1621 |
| 206 | Ga0495646_0064253 | 3300046680 | Bacteria | 2176 |
| 207 | Ga0495624_0118058 | 3300046690 | Bacteria | 1630 |
| 208 | Ga0495581_0049264 | 3300047315 | Bacteria | 2432 |
| 209 | Ga0496100_0112054 | 3300048903 | Bacteria | 1897 |
| 210 | Ga0496101_0009883 | 3300048904 | Bacteria | 6286 |
| 211 | Ga0496101_0872962 | 3300048904 | Bacteria | 709 |
| 212 | Ga0496102_0004215 | 3300048905 | Bacteria | 12156 |
| 213 | Ga0496102_0187064 | 3300048905 | Bacteria | 1952 |
| 214 | Ga0496103_0022442 | 3300048906 | Bacteria | 3800 |
| 215 | Ga0496104_0007908 | 3300048907 | Bacteria | 9428 |
| 216 | Ga0496104_0316688 | 3300048907 | Bacteria | 1473 |
| 217 | Ga0496105_0090751 | 3300048908 | Bacteria | 2523 |
| 218 | Ga0496106_0002322 | 3300048909 | Bacteria | 14177 |
| 219 | Ga0496106_0199332 | 3300048909 | Bacteria | 1593 |
| 220 | Ga0496106_0298242 | 3300048909 | Bacteria | 1292 |
| 221 | Ga0496106_0422824 | 3300048909 | Bacteria | 1071 |
| 222 | Ga0496106_0475083 | 3300048909 | Bacteria | 1004 |
| 223 | Ga0496107_0123108 | 3300048910 | Bacteria | 1911 |
| 224 | Ga0496107_0691691 | 3300048910 | Bacteria | 750 |
| 225 | Ga0496108_0001632 | 3300048911 | Bacteria | 17771 |
| 226 | Ga0496109_0003738 | 3300048912 | Bacteria | 12720 |
| 227 | Ga0496109_0030753 | 3300048912 | Bacteria | 4812 |
| 228 | Ga0496110_0008560 | 3300048913 | Bacteria | 8236 |
| 229 | Ga0496110_0097068 | 3300048913 | Bacteria | 2641 |
| 230 | Ga0496111_0016726 | 3300048914 | Bacteria | 5059 |
| 231 | Ga0496112_0004450 | 3300048915 | Bacteria | 11876 |
| 232 | Ga0496112_0022022 | 3300048915 | Bacteria | 6067 |
| 233 | Ga0496112_0093334 | 3300048915 | Bacteria | 2980 |
| 234 | Ga0496112_0632173 | 3300048915 | Bacteria | 1001 |
| 235 | Ga0496113_0033723 | 3300048916 | Bacteria | 3730 |
| 236 | Ga0496113_0097574 | 3300048916 | Bacteria | 2274 |
| 237 | Ga0496113_0525818 | 3300048916 | Bacteria | 949 |
| 238 | Ga0496114_0017787 | 3300048917 | Bacteria | 5745 |
| 239 | Ga0496115_0053502 | 3300048918 | Bacteria | 3240 |
| 240 | Ga0496115_0160417 | 3300048918 | Bacteria | 1858 |
| 241 | Ga0496116_0064052 | 3300048919 | Unclassified | 2364 |
| 242 | Ga0496117_0011504 | 3300048920 | Bacteria | 7921 |
| 243 | Ga0496117_0042390 | 3300048920 | Bacteria | 3322 |
| 244 | Ga0496118_0007103 | 3300048921 | Bacteria | 12020 |
| 245 | Ga0496118_0048911 | 3300048921 | Bacteria | 3260 |
| 246 | Ga0496119_0100782 | 3300048922 | Bacteria | 1622 |
| 247 | Ga0496119_0108528 | 3300048922 | Unclassified | 1545 |
| 248 | Ga0496121_0013034 | 3300048924 | Bacteria | 8979 |
| 249 | Ga0496121_0022044 | 3300048924 | Bacteria | 6202 |
| 250 | Ga0496121_0082590 | 3300048924 | Bacteria | 2539 |
| 251 | Ga0496121_0144183 | 3300048924 | Unclassified | 1762 |
| 252 | Ga0496123_0110482 | 3300048926 | Unclassified | 1573 |
| 253 | Ga0496124_0010621 | 3300048927 | Bacteria | 9302 |
| 254 | Ga0496124_0027848 | 3300048927 | Bacteria | 5063 |
| 255 | Ga0496124_0068079 | 3300048927 | Bacteria | 2960 |
| 256 | Ga0496124_0478139 | 3300048927 | Bacteria | 842 |
| 257 | Ga0496125_0052659 | 3300048928 | Bacteria | 3345 |
| 258 | Ga0496126_0254712 | 3300048929 | Unclassified | 1461 |
| 259 | Ga0496126_0450251 | 3300048929 | Bacteria | 1036 |
| 260 | Ga0495682_0046819 | 3300049460 | Bacteria | 1578 |
| 261 | Ga0501031_0016392 | 3300049568 | Bacteria | 4812 |
| 262 | Ga0501032_0000026 | 3300049569 | Bacteria | 136472 |
| 263 | Ga0501032_0000055 | 3300049569 | Bacteria | 99207 |
| 264 | Ga0501032_0026531 | 3300049569 | Bacteria | 3982 |
| 265 | Ga0501032_0035196 | 3300049569 | Bacteria | 3425 |
| 266 | Ga0501032_0077346 | 3300049569 | Bacteria | 2215 |
| 267 | Ga0501032_0093955 | 3300049569 | Bacteria | 1988 |
| 268 | Ga0501032_0373992 | 3300049569 | Bacteria | 916 |
| 269 | Ga0501033_0000163 | 3300049570 | Bacteria | 63913 |
| 270 | Ga0501033_0001033 | 3300049570 | Bacteria | 25328 |
| 271 | Ga0501033_0004474 | 3300049570 | Bacteria | 11180 |
| 272 | Ga0501033_0005801 | 3300049570 | Bacteria | 9718 |
| 273 | Ga0501033_0023569 | 3300049570 | Bacteria | 4642 |
| 274 | Ga0501033_0028449 | 3300049570 | Bacteria | 4198 |
| 275 | Ga0501033_0458597 | 3300049570 | Bacteria | 885 |
| 276 | Ga0501034_0000054 | 3300049571 | Bacteria | 206373 |
| 277 | Ga0501034_0001317 | 3300049571 | Bacteria | 33620 |
| 278 | Ga0501034_0013063 | 3300049571 | Bacteria | 8558 |
| 279 | Ga0501034_0014890 | 3300049571 | Bacteria | 7998 |
| 280 | Ga0501034_0018723 | 3300049571 | Bacteria | 7096 |
| 281 | Ga0501034_0049515 | 3300049571 | Bacteria | 4239 |
| 282 | Ga0501034_0129179 | 3300049571 | Bacteria | 2510 |
| 283 | Ga0501034_0157883 | 3300049571 | Unclassified | 2241 |
| 284 | Ga0501034_0175999 | 3300049571 | Bacteria | 2105 |
| 285 | Ga0501034_0322489 | 3300049571 | Bacteria | 1477 |
| 286 | Ga0501034_0750233 | 3300049571 | Bacteria | 871 |
| 287 | Ga0501034_0905616 | 3300049571 | Bacteria | 770 |
| 288 | Ga0501036_0000021 | 3300049572 | Bacteria | 114136 |
| 289 | Ga0501036_0000363 | 3300049572 | Bacteria | 31929 |
| 290 | Ga0501036_0006474 | 3300049572 | Bacteria | 9514 |
| 291 | Ga0501036_0014463 | 3300049572 | Bacteria | 6575 |
| 292 | Ga0501036_0018737 | 3300049572 | Bacteria | 5806 |
| 293 | Ga0501036_0029293 | 3300049572 | Bacteria | 4653 |
| 294 | Ga0501036_0031822 | 3300049572 | Bacteria | 4457 |
| 295 | Ga0501036_0055983 | 3300049572 | Viruses | 3340 |
| 296 | Ga0501036_0072979 | 3300049572 | Bacteria | 2901 |
| 297 | Ga0501036_0211003 | 3300049572 | Bacteria | 1632 |
| 298 | Ga0501036_0347093 | 3300049572 | Bacteria | 1239 |
| 299 | Ga0501037_0000032 | 3300049573 | Bacteria | 132863 |
| 300 | Ga0501037_0000314 | 3300049573 | Bacteria | 41093 |
| 301 | Ga0501037_0029232 | 3300049573 | Bacteria | 4071 |
| 302 | Ga0501037_0045969 | 3300049573 | Bacteria | 3203 |
| 303 | Ga0501037_0097556 | 3300049573 | Unclassified | 2123 |
| 304 | Ga0501037_0116137 | 3300049573 | Unclassified | 1926 |
| 305 | Ga0501037_0130088 | 3300049573 | Bacteria | 1805 |
| 306 | Ga0501038_0000070 | 3300049574 | Bacteria | 84371 |
| 307 | Ga0501038_0000151 | 3300049574 | Bacteria | 59383 |
| 308 | Ga0501038_0006295 | 3300049574 | Bacteria | 10978 |
| 309 | Ga0501038_0008898 | 3300049574 | Bacteria | 9213 |
| 310 | Ga0501038_0015690 | 3300049574 | Bacteria | 6884 |
| 311 | Ga0501038_0153594 | 3300049574 | Bacteria | 1875 |
| 312 | Ga0501038_0282843 | 3300049574 | Bacteria | 1305 |
| 313 | Ga0501039_0000018 | 3300049575 | Bacteria | 176187 |
| 314 | Ga0501039_0000213 | 3300049575 | Bacteria | 42565 |
| 315 | Ga0501039_0034632 | 3300049575 | Bacteria | 3896 |
| 316 | Ga0501039_0051628 | 3300049575 | Bacteria | 3181 |
| 317 | Ga0501039_0052531 | 3300049575 | Bacteria | 3153 |
| 318 | Ga0501039_0140626 | 3300049575 | Bacteria | 1896 |
| 319 | Ga0501039_0187656 | 3300049575 | Bacteria | 1626 |
| 320 | Ga0501039_0205728 | 3300049575 | Bacteria | 1547 |
| 321 | Ga0501039_0299407 | 3300049575 | Bacteria | 1264 |
| 322 | Ga0501040_0380990 | 3300049576 | Bacteria | 1012 |
| 323 | Ga0501042_0061103 | 3300049578 | Bacteria | 2692 |
| 324 | Ga0501042_0106780 | 3300049578 | Bacteria | 2015 |
| 325 | Ga0501042_0114295 | 3300049578 | Bacteria | 1944 |
| 326 | Ga0501042_0648592 | 3300049578 | Bacteria | 767 |
| 327 | Ga0501043_0000173 | 3300049579 | Bacteria | 57881 |
| 328 | Ga0501043_0000297 | 3300049579 | Bacteria | 44905 |
| 329 | Ga0501043_0010379 | 3300049579 | Bacteria | 7299 |
| 330 | Ga0501043_0012904 | 3300049579 | Bacteria | 6530 |
| 331 | Ga0501043_0013048 | 3300049579 | Bacteria | 6494 |
| 332 | Ga0501043_0024534 | 3300049579 | Bacteria | 4731 |
| 333 | Ga0501043_0433925 | 3300049579 | Bacteria | 989 |
| 334 | Ga0501046_0012520 | 3300049580 | Bacteria | 7218 |
| 335 | Ga0501046_0037538 | 3300049580 | Bacteria | 3892 |
| 336 | Ga0501046_0040300 | 3300049580 | Bacteria | 3733 |
| 337 | Ga0501046_0057167 | 3300049580 | Bacteria | 3060 |
| 338 | Ga0501046_0058268 | 3300049580 | Bacteria | 3028 |
| 339 | Ga0501046_0066836 | 3300049580 | Bacteria | 2801 |
| 340 | Ga0501046_0482263 | 3300049580 | Bacteria | 889 |
| 341 | Ga0501047_0000136 | 3300049581 | Bacteria | 89236 |
| 342 | Ga0501047_0000232 | 3300049581 | Bacteria | 66245 |
| 343 | Ga0501047_0007330 | 3300049581 | Bacteria | 10374 |
| 344 | Ga0501047_0011817 | 3300049581 | Bacteria | 8258 |
| 345 | Ga0501047_0034057 | 3300049581 | Bacteria | 4917 |
| 346 | Ga0501047_0062786 | 3300049581 | Bacteria | 3583 |
| 347 | Ga0501047_0122606 | 3300049581 | Bacteria | 2480 |
| 348 | Ga0501047_0160514 | 3300049581 | Unclassified | 2119 |
| 349 | Ga0501047_0275915 | 3300049581 | Bacteria | 1527 |
| 350 | Ga0501047_0384225 | 3300049581 | Bacteria | 1238 |
| 351 | Ga0501047_0563053 | 3300049581 | Bacteria | 963 |
| 352 | Ga0501048_0000549 | 3300049582 | Bacteria | 26486 |
| 353 | Ga0501048_0001340 | 3300049582 | Bacteria | 18669 |
| 354 | Ga0501048_0024351 | 3300049582 | Bacteria | 4419 |
| 355 | Ga0501048_0114709 | 3300049582 | Unclassified | 1903 |
| 356 | Ga0501067_0000177 | 3300049583 | Bacteria | 35936 |
| 357 | Ga0501067_0013168 | 3300049583 | Bacteria | 4579 |
| 358 | Ga0501067_0055515 | 3300049583 | Bacteria | 2195 |
| 359 | Ga0501067_0143025 | 3300049583 | Bacteria | 1332 |
| 360 | Ga0501068_0001111 | 3300049584 | Bacteria | 14242 |
| 361 | Ga0501068_0015920 | 3300049584 | Bacteria | 4330 |
| 362 | Ga0501068_0106885 | 3300049584 | Bacteria | 1737 |
| 363 | Ga0501068_0107151 | 3300049584 | Bacteria | 1735 |
| 364 | Ga0501068_0124609 | 3300049584 | Bacteria | 1608 |
| 365 | Ga0501069_0003421 | 3300049585 | Bacteria | 8151 |
| 366 | Ga0501069_0228266 | 3300049585 | Bacteria | 1083 |
| 367 | Ga0501070_0005468 | 3300049586 | Bacteria | 10843 |
| 368 | Ga0501070_0005643 | 3300049586 | Bacteria | 10672 |
| 369 | Ga0501070_0066554 | 3300049586 | Bacteria | 2983 |
| 370 | Ga0501070_0083319 | 3300049586 | Bacteria | 2647 |
| 371 | Ga0501070_0117236 | 3300049586 | Bacteria | 2199 |
| 372 | Ga0501070_0133331 | 3300049586 | Bacteria | 2051 |
| 373 | Ga0501070_0135074 | 3300049586 | Bacteria | 2037 |
| 374 | Ga0501070_0151685 | 3300049586 | Unclassified | 1912 |
| 375 | Ga0501070_0225428 | 3300049586 | Bacteria | 1536 |
| 376 | Ga0501071_0106557 | 3300049587 | Bacteria | 2069 |
| 377 | Ga0501071_0110745 | 3300049587 | Unclassified | 2029 |
| 378 | Ga0501072_0040544 | 3300049588 | Bacteria | 3656 |
| 379 | Ga0501072_0131468 | 3300049588 | Bacteria | 1995 |
| 380 | Ga0501072_0489352 | 3300049588 | Bacteria | 973 |
| 381 | Ga0501073_0001892 | 3300049589 | Bacteria | 15598 |
| 382 | Ga0501073_0022534 | 3300049589 | Bacteria | 4535 |
| 383 | Ga0501073_0029396 | 3300049589 | Bacteria | 3928 |
| 384 | Ga0501073_0037859 | 3300049589 | Bacteria | 3423 |
| 385 | Ga0501073_0043275 | 3300049589 | Bacteria | 3175 |
| 386 | Ga0501073_0230158 | 3300049589 | Bacteria | 1280 |
| 387 | Ga0501073_0434688 | 3300049589 | Bacteria | 907 |
| 388 | Ga0501074_0000704 | 3300049590 | Bacteria | 20903 |
| 389 | Ga0501074_0047759 | 3300049590 | Bacteria | 3093 |
| 390 | Ga0501074_0356843 | 3300049590 | Unclassified | 1037 |
| 391 | Ga0501075_0387826 | 3300049591 | Unclassified | 1065 |
| 392 | Ga0501076_0383513 | 3300049592 | Unclassified | 1155 |
| 393 | Ga0501077_0168671 | 3300049593 | Unclassified | 1391 |
| 394 | Ga0501079_0011681 | 3300049741 | Bacteria | 6708 |
| 395 | Ga0501079_0011682 | 3300049741 | Bacteria | 6708 |
| 396 | Ga0501079_0190051 | 3300049741 | Bacteria | 1602 |
| 397 | Ga0501080_0000022 | 3300049742 | Bacteria | 90630 |
| 398 | Ga0501080_0009885 | 3300049742 | Bacteria | 8713 |
| 399 | Ga0501080_0017797 | 3300049742 | Bacteria | 6577 |
| 400 | Ga0501080_0019442 | 3300049742 | Bacteria | 6291 |
| 401 | Ga0501080_0020763 | 3300049742 | Bacteria | 6081 |
| 402 | Ga0501080_0220618 | 3300049742 | Bacteria | 1735 |
| 403 | Ga0501080_0565795 | 3300049742 | Bacteria | 1011 |
| 404 | Ga0501081_0106470 | 3300049743 | Bacteria | 1988 |
| 405 | Ga0501083_0000300 | 3300049744 | Bacteria | 31205 |
| 406 | Ga0501083_0000780 | 3300049744 | Bacteria | 20915 |
| 407 | Ga0501083_0027686 | 3300049744 | Bacteria | 3909 |
| 408 | Ga0501083_0151718 | 3300049744 | Unclassified | 1517 |
| 409 | Ga0501083_0408677 | 3300049744 | Bacteria | 883 |
| 410 | Ga0501035_0000019 | 3300049822 | Bacteria | 241152 |
| 411 | Ga0501035_0000120 | 3300049822 | Bacteria | 94532 |
| 412 | Ga0501035_0004438 | 3300049822 | Bacteria | 13313 |
| 413 | Ga0501035_0025647 | 3300049822 | Bacteria | 5403 |
| 414 | Ga0501035_0041119 | 3300049822 | Bacteria | 4175 |
| 415 | Ga0501035_0057895 | 3300049822 | Bacteria | 3454 |
| 416 | Ga0501035_0079467 | 3300049822 | Bacteria | 2897 |
| 417 | Ga0501035_0084143 | 3300049822 | Bacteria | 2806 |
| 418 | Ga0501035_0176682 | 3300049822 | Viruses | 1841 |
| 419 | Ga0501035_0197905 | 3300049822 | Bacteria | 1725 |
| 420 | Ga0501035_0228779 | 3300049822 | Bacteria | 1585 |
| 421 | Ga0501035_0488076 | 3300049822 | Bacteria | 1015 |
| 422 | Ga0501044_0000179 | 3300049823 | Bacteria | 78633 |
| 423 | Ga0501044_0004040 | 3300049823 | Bacteria | 16460 |
| 424 | Ga0501044_0011930 | 3300049823 | Bacteria | 9417 |
| 425 | Ga0501044_0017473 | 3300049823 | Bacteria | 7698 |
| 426 | Ga0501044_0017954 | 3300049823 | Bacteria | 7586 |
| 427 | Ga0501044_0025943 | 3300049823 | Bacteria | 6209 |
| 428 | Ga0501044_0036303 | 3300049823 | Bacteria | 5157 |
| 429 | Ga0501044_0045084 | 3300049823 | Bacteria | 4572 |
| 430 | Ga0501044_0096820 | 3300049823 | Bacteria | 2972 |
| 431 | Ga0501044_0101579 | 3300049823 | Bacteria | 2893 |
| 432 | Ga0501044_0168908 | 3300049823 | Bacteria | 2160 |
| 433 | Ga0501044_0179856 | 3300049823 | Bacteria | 2082 |
| 434 | Ga0501044_0198368 | 3300049823 | Bacteria | 1966 |
| 435 | Ga0501044_0228416 | 3300049823 | Bacteria | 1809 |
| 436 | Ga0501044_0229275 | 3300049823 | Bacteria | 1805 |
| 437 | Ga0501044_0478362 | 3300049823 | Bacteria | 1149 |
| 438 | Ga0501044_0503495 | 3300049823 | Bacteria | 1112 |
| 439 | Ga0501045_0068065 | 3300049824 | Bacteria | 2615 |
| 440 | Ga0501045_0195226 | 3300049824 | Bacteria | 1508 |
| 441 | nmdc:mga07m45_3561_c2 | 3300050496 | Bacteria | 7086 |
| 442 | nmdc:mga05p37_303128_c1 | 3300050507 | Bacteria | 1897 |
| 443 | nmdc:mga08y16_24_c1 | 3300050511 | Bacteria | 240846 |
| 444 | nmdc:mga08x19_504361_c1 | 3300050514 | Bacteria | 854 |
| 445 | Ga0501084_0021644 | 3300054114 | Bacteria | 5361 |
| 446 | Ga0501084_0192348 | 3300054114 | Bacteria | 1721 |
| 447 | Ga0501084_0204927 | 3300054114 | Viruses | 1664 |
| 448 | Ga0501084_0209000 | 3300054114 | Bacteria | 1647 |
| 449 | Ga0501082_0002527 | 3300060353 | Bacteria | 16018 |
| 450 | Ga0501082_0115197 | 3300060353 | Bacteria | 2328 |
| 451 | Ga0501082_0118819 | 3300060353 | Unclassified | 2290 |
| 452 | Ga0501082_0251353 | 3300060353 | Bacteria | 1538 |
| 453 | Ga0501082_0369073 | 3300060353 | Bacteria | 1252 |
| 454 | Ga0530510_0529736 | 3300061734 | Unclassified | 894 |
| 455 | 2513862481 | 2513237137 | Bacteria | 9558895 |
| 456 | 2671118292 | 2667528175 | Bacteria | 7532676 |
| 457 | 2903771109 | 2903768456 | Bacteria | 9749579 |
| 458 | 2932800238 | 2932794094 | Bacteria | 7915132 |
| 459 | 2935775989 | 2935769743 | Bacteria | 7878163 |
| 460 | 2935791607 | 2935785616 | Bacteria | 7962367 |
| 461 | 2935799919 | 2935793552 | Bacteria | 8012592 |
| 462 | 2941510113 | 2941507105 | Bacteria | 8166816 |
| 463 | 2941518800 | 2941515067 | Bacteria | 8166720 |
| 464 | 2941525512 | 2941523033 | Bacteria | 8169134 |
| 465 | 3005597737 | 3005594810 | Bacteria | 8716512 |
| 466 | 8016629851 | 8016622563 | Bacteria | 7999408 |
| 467 | 8019541516 | 8019538911 | Bacteria | 7872763 |
| 468 | 8019548789 | 8019547302 | Bacteria | 7996444 |
| 469 | Ga0373943_0036499 | |||
| 470 | JGI24033J26618_1006767 | |||
| 471 | rootH2_10064446 | |||
| 472 | rootL2_10273162 | |||
| 473 | Ga0065704_10109347 | |||
| 474 | Ga0070658_10208875 | |||
| 475 | Ga0070658_10280832 | |||
| 476 | Ga0070658_10314686 | |||
| 477 | Ga0070658_10426388 | |||
| 478 | Ga0070658_10600066 | |||
| 479 | Ga0070683_100097354 | |||
| 480 | Ga0070683_100510057 | |||
| 481 | Ga0070683_100651604 | |||
| 482 | Ga0070670_100746222 | |||
| 483 | Ga0070666_10249582 | |||
| 484 | Ga0070680_100002269 | |||
| 485 | Ga0070680_100263301 | |||
| 486 | Ga0070660_100000495 | |||
| 487 | Ga0070660_100161347 | |||
| 488 | Ga0070661_100000286 | |||
| 489 | Ga0070668_100048364 | |||
| 490 | Ga0070671_100001618 | |||
| 491 | Ga0070671_100063469 | |||
| 492 | Ga0070659_100001748 | |||
| 493 | Ga0070659_100072472 | |||
| 494 | Ga0070667_100059567 | |||
| 495 | Ga0070667_100253764 | |||
| 496 | Ga0070714_100012582 | |||
| 497 | Ga0070713_100017465 | |||
| 498 | Ga0070713_100023205 | |||
| 499 | Ga0070713_100126813 | |||
| 500 | Ga0070713_100247803 | |||
| 501 | Ga0070700_100000050 | |||
| 502 | Ga0070694_100175584 | |||
| 503 | Ga0070663_100870960 | |||
| 504 | Ga0070678_100054316 | |||
| 505 | Ga0070662_100000071 | |||
| 506 | Ga0070662_100002862 | |||
| 507 | Ga0070662_100009722 | |||
| 508 | Ga0070681_10098777 | |||
| 509 | Ga0070681_10165500 | |||
| 510 | Ga0070681_10490787 | |||
| 511 | Ga0070681_10496081 | |||
| 512 | Ga0070685_10028801 | |||
| 513 | Ga0070679_100001065 | |||
| 514 | Ga0070679_100002568 | |||
| 515 | Ga0070679_100073730 | |||
| 516 | Ga0070679_100157267 | |||
| 517 | Ga0070684_100041694 | |||
| 518 | Ga0070684_100180879 | |||
| 519 | Ga0068853_100000412 | |||
| 520 | Ga0068853_100459591 | |||
| 521 | Ga0068853_100665282 | |||
| 522 | Ga0070686_100193094 | |||
| 523 | Ga0070665_100001223 | |||
| 524 | Ga0070665_100002567 | |||
| 525 | Ga0068855_100000970 | |||
| 526 | Ga0068855_100212919 | |||
| 527 | Ga0068855_100391230 | |||
| 528 | Ga0068855_101008866 | |||
| 529 | Ga0068854_100002427 | |||
| 530 | Ga0068854_100061887 | |||
| 531 | Ga0068856_100003912 | |||
| 532 | Ga0068856_100347701 | |||
| 533 | Ga0070702_100178868 | |||
| 534 | Ga0068852_100778486 | |||
| 535 | Ga0068852_100848206 | |||
| 536 | Ga0068863_100166213 | |||
| 537 | Ga0068858_100588670 | |||
| 538 | Ga0068860_100069797 | |||
| 539 | Ga0068862_100060369 | |||
| 540 | Ga0070717_10222322 | |||
| 541 | Ga0097621_100823684 | |||
| 542 | Ga0068871_100471347 | |||
| 543 | Ga0105251_10004452 | |||
| 544 | Ga0105240_10176628 | |||
| 545 | Ga0111539_10000022 | |||
| 546 | Ga0105247_10085586 | |||
| 547 | Ga0114129_10189766 | |||
| 548 | Ga0105241_10183365 | |||
| 549 | Ga0105241_10581603 | |||
| 550 | Ga0105248_10006383 | |||
| 551 | Ga0105237_10115718 | |||
| 552 | Ga0105238_10053507 | |||
| 553 | Ga0105238_10136644 | |||
| 554 | Ga0105238_10265548 | |||
| 555 | Ga0105239_10430249 | |||
| 556 | Ga0105246_10000140 | |||
| 557 | Ga0157373_10011413 | |||
| 558 | Ga0157373_10031124 | |||
| 559 | Ga0157371_10001293 | |||
| 560 | Ga0157371_10023143 | |||
| 561 | Ga0157371_10340513 | |||
| 562 | Ga0157370_10000991 | |||
| 563 | Ga0157370_10443754 | |||
| 564 | Ga0157369_10025428 | |||
| 565 | Ga0157372_10000946 | |||
| 566 | Ga0157372_10537576 | |||
| 567 | Ga0157375_10142644 | |||
| 568 | Ga0157375_10517447 | |||
| 569 | Ga0213872_10006301 | |||
| 570 | Ga0213874_10061066 | |||
| 571 | Ga0213876_10069899 | |||
| 572 | Ga0213876_10076934 | |||
| 573 | Ga0213876_10249058 | |||
| 574 | Ga0213876_10256005 | |||
| 575 | Ga0213876_10335349 | |||
| 576 | Ga0209677_101747 | |||
| 577 | Ga0209455_1001581 | |||
| 578 | Ga0209455_1003093 | |||
| 579 | Ga0207713_1007410 | |||
| 580 | Ga0207692_10052693 | |||
| 581 | Ga0207680_10147027 | |||
| 582 | Ga0207699_10396307 | |||
| 583 | Ga0207705_10183921 | |||
| 584 | Ga0207705_10369466 | |||
| 585 | Ga0207707_10000438 | |||
| 586 | Ga0207707_10137763 | |||
| 587 | Ga0207707_10154134 | |||
| 588 | Ga0207671_10268044 | |||
| 589 | Ga0207657_10098215 | |||
| 590 | Ga0207652_10003966 | |||
| 591 | Ga0207652_10014003 | |||
| 592 | Ga0207652_10024967 | |||
| 593 | Ga0207652_10117758 | |||
| 594 | Ga0207652_10207486 | |||
| 595 | Ga0207694_10037591 | |||
| 596 | Ga0207694_10497061 | |||
| 597 | Ga0207650_10324797 | |||
| 598 | Ga0207659_10159043 | |||
| 599 | Ga0207687_10280980 | |||
| 600 | Ga0207700_10587082 | |||
| 601 | Ga0207664_10019360 | |||
| 602 | Ga0207644_10001525 | |||
| 603 | Ga0207644_10318409 | |||
| 604 | Ga0207690_10505975 | |||
| 605 | Ga0207706_10015910 | |||
| 606 | Ga0207706_10083322 | |||
| 607 | Ga0207711_10003400 | |||
| 608 | Ga0207661_10581430 | |||
| 609 | Ga0207661_10628701 | |||
| 610 | Ga0207667_10215481 | |||
| 611 | Ga0207667_10510953 | |||
| 612 | Ga0207667_10820549 | |||
| 613 | Ga0207651_10162085 | |||
| 614 | Ga0207668_10004323 | |||
| 615 | Ga0207640_10063919 | |||
| 616 | Ga0207658_10007705 | |||
| 617 | Ga0207703_10350084 | |||
| 618 | Ga0207678_10202085 | |||
| 619 | Ga0207678_10295111 | |||
| 620 | Ga0207702_10460130 | |||
| 621 | Ga0207641_10000986 | |||
| 622 | Ga0207674_10319143 | |||
| 623 | Ga0207683_10153437 | |||
| 624 | Ga0207698_10342232 | |||
| 625 | Ga0207428_10000030 | |||
| 626 | Ga0268266_10001277 | |||
| 627 | Ga0268266_10009653 | |||
| 628 | Ga0268265_10027609 | |||
| 629 | Ga0268264_10009245 | |||
| 630 | Ga0265325_10001061 | |||
| 631 | Ga0265340_10018668 | |||
| 632 | Ga0373954_0308384 | |||
| 633 | Ga0373931_0222731 | |||
| 634 | Ga0373925_0052905 | |||
| 635 | Ga0395899_0000666 | |||
| 636 | Ga0395899_0028038 | |||
| 637 | Ga0395899_0035399 | |||
| 638 | Ga0395900_0000016 | |||
| 639 | Ga0395900_0011893 | |||
| 640 | Ga0395898_0002730 | |||
| 641 | Ga0395898_0023416 | |||
| 642 | Ga0395898_0026631 | |||
| 643 | Ga0395898_0036472 | |||
| 644 | Ga0395905_0006525 | |||
| 645 | Ga0395905_0418392 | |||
| 646 | Ga0436364_0985720 | |||
| 647 | Ga0436364_1565160 | |||
| 648 | Ga0395901_0000022 | |||
| 649 | Ga0395901_0003226 | |||
| 650 | Ga0395901_0042548 | |||
| 651 | Ga0395901_0149686 | |||
| 652 | Ga0395901_0311300 | |||
| 653 | Ga0436365_0106371 | |||
| 654 | Ga0436365_0922842 | |||
| 655 | Ga0436365_1138685 | |||
| 656 | Ga0436365_1649283 | |||
| 657 | Ga0436365_1850675 | |||
| 658 | Ga0436361_0306530 | |||
| 659 | Ga0436363_0186689 | |||
| 660 | Ga0436363_0742585 | |||
| 661 | Ga0436363_1099119 | |||
| 662 | Ga0436362_1058008 | |||
| 663 | Ga0439448_0172612 | |||
| 664 | Ga0466966_0143536 | |||
| 665 | Ga0466957_0113418 | |||
| 666 | Ga0451576_0732747 | |||
| 667 | Ga0466958_0889624 | |||
| 668 | Ga0466967_0048210 | |||
| 669 | Ga0466967_0323794 | |||
| 670 | Ga0495603_0036713 | |||
| 671 | Ga0495651_0113067 | |||
| 672 | Ga0495628_0132582 | |||
| 673 | Ga0495640_0131344 | |||
| 674 | Ga0495646_0064253 | |||
| 675 | Ga0495624_0118058 | |||
| 676 | Ga0495581_0049264 | |||
| 677 | Ga0496100_0112054 | |||
| 678 | Ga0496101_0009883 | |||
| 679 | Ga0496101_0872962 | |||
| 680 | Ga0496102_0004215 | |||
| 681 | Ga0496102_0187064 | |||
| 682 | Ga0496103_0022442 | |||
| 683 | Ga0496104_0007908 | |||
| 684 | Ga0496104_0316688 | |||
| 685 | Ga0496105_0090751 | |||
| 686 | Ga0496106_0002322 | |||
| 687 | Ga0496106_0199332 | |||
| 688 | Ga0496106_0298242 | |||
| 689 | Ga0496106_0422824 | |||
| 690 | Ga0496106_0475083 | |||
| 691 | Ga0496107_0123108 | |||
| 692 | Ga0496107_0691691 | |||
| 693 | Ga0496108_0001632 | |||
| 694 | Ga0496109_0003738 | |||
| 695 | Ga0496109_0030753 | |||
| 696 | Ga0496110_0008560 | |||
| 697 | Ga0496110_0097068 | |||
| 698 | Ga0496111_0016726 | |||
| 699 | Ga0496112_0004450 | |||
| 700 | Ga0496112_0022022 | |||
| 701 | Ga0496112_0093334 | |||
| 702 | Ga0496112_0632173 | |||
| 703 | Ga0496113_0033723 | |||
| 704 | Ga0496113_0097574 | |||
| 705 | Ga0496113_0525818 | |||
| 706 | Ga0496114_0017787 | |||
| 707 | Ga0496115_0053502 | |||
| 708 | Ga0496115_0160417 | |||
| 709 | Ga0496116_0064052 | |||
| 710 | Ga0496117_0011504 | |||
| 711 | Ga0496117_0042390 | |||
| 712 | Ga0496118_0007103 | |||
| 713 | Ga0496118_0048911 | |||
| 714 | Ga0496119_0100782 | |||
| 715 | Ga0496119_0108528 | |||
| 716 | Ga0496121_0013034 | |||
| 717 | Ga0496121_0022044 | |||
| 718 | Ga0496121_0082590 | |||
| 719 | Ga0496121_0144183 | |||
| 720 | Ga0496123_0110482 | |||
| 721 | Ga0496124_0010621 | |||
| 722 | Ga0496124_0027848 | |||
| 723 | Ga0496124_0068079 | |||
| 724 | Ga0496124_0478139 | |||
| 725 | Ga0496125_0052659 | |||
| 726 | Ga0496126_0254712 | |||
| 727 | Ga0496126_0450251 | |||
| 728 | Ga0495682_0046819 | |||
| 729 | Ga0501031_0016392 | |||
| 730 | Ga0501032_0000026 | |||
| 731 | Ga0501032_0000055 | |||
| 732 | Ga0501032_0026531 | |||
| 733 | Ga0501032_0035196 | |||
| 734 | Ga0501032_0077346 | |||
| 735 | Ga0501032_0093955 | |||
| 736 | Ga0501032_0373992 | |||
| 737 | Ga0501033_0000163 | |||
| 738 | Ga0501033_0001033 | |||
| 739 | Ga0501033_0004474 | |||
| 740 | Ga0501033_0005801 | |||
| 741 | Ga0501033_0023569 | |||
| 742 | Ga0501033_0028449 | |||
| 743 | Ga0501033_0458597 | |||
| 744 | Ga0501034_0000054 | |||
| 745 | Ga0501034_0001317 | |||
| 746 | Ga0501034_0013063 | |||
| 747 | Ga0501034_0014890 | |||
| 748 | Ga0501034_0018723 | |||
| 749 | Ga0501034_0049515 | |||
| 750 | Ga0501034_0129179 | |||
| 751 | Ga0501034_0157883 | |||
| 752 | Ga0501034_0175999 | |||
| 753 | Ga0501034_0322489 | |||
| 754 | Ga0501034_0750233 | |||
| 755 | Ga0501034_0905616 | |||
| 756 | Ga0501036_0000021 | |||
| 757 | Ga0501036_0000363 | |||
| 758 | Ga0501036_0006474 | |||
| 759 | Ga0501036_0014463 | |||
| 760 | Ga0501036_0018737 | |||
| 761 | Ga0501036_0029293 | |||
| 762 | Ga0501036_0031822 | |||
| 763 | Ga0501036_0055983 | |||
| 764 | Ga0501036_0072979 | |||
| 765 | Ga0501036_0211003 | |||
| 766 | Ga0501036_0347093 | |||
| 767 | Ga0501037_0000032 | |||
| 768 | Ga0501037_0000314 | |||
| 769 | Ga0501037_0029232 | |||
| 770 | Ga0501037_0045969 | |||
| 771 | Ga0501037_0097556 | |||
| 772 | Ga0501037_0116137 | |||
| 773 | Ga0501037_0130088 | |||
| 774 | Ga0501038_0000070 | |||
| 775 | Ga0501038_0000151 | |||
| 776 | Ga0501038_0006295 | |||
| 777 | Ga0501038_0008898 | |||
| 778 | Ga0501038_0015690 | |||
| 779 | Ga0501038_0153594 | |||
| 780 | Ga0501038_0282843 | |||
| 781 | Ga0501039_0000018 | |||
| 782 | Ga0501039_0000213 | |||
| 783 | Ga0501039_0034632 | |||
| 784 | Ga0501039_0051628 | |||
| 785 | Ga0501039_0052531 | |||
| 786 | Ga0501039_0140626 | |||
| 787 | Ga0501039_0187656 | |||
| 788 | Ga0501039_0205728 | |||
| 789 | Ga0501039_0299407 | |||
| 790 | Ga0501040_0380990 | |||
| 791 | Ga0501042_0061103 | |||
| 792 | Ga0501042_0106780 | |||
| 793 | Ga0501042_0114295 | |||
| 794 | Ga0501042_0648592 | |||
| 795 | Ga0501043_0000173 | |||
| 796 | Ga0501043_0000297 | |||
| 797 | Ga0501043_0010379 | |||
| 798 | Ga0501043_0012904 | |||
| 799 | Ga0501043_0013048 | |||
| 800 | Ga0501043_0024534 | |||
| 801 | Ga0501043_0433925 | |||
| 802 | Ga0501046_0012520 | |||
| 803 | Ga0501046_0037538 | |||
| 804 | Ga0501046_0040300 | |||
| 805 | Ga0501046_0057167 | |||
| 806 | Ga0501046_0058268 | |||
| 807 | Ga0501046_0066836 | |||
| 808 | Ga0501046_0482263 | |||
| 809 | Ga0501047_0000136 | |||
| 810 | Ga0501047_0000232 | |||
| 811 | Ga0501047_0007330 | |||
| 812 | Ga0501047_0011817 | |||
| 813 | Ga0501047_0034057 | |||
| 814 | Ga0501047_0062786 | |||
| 815 | Ga0501047_0122606 | |||
| 816 | Ga0501047_0160514 | |||
| 817 | Ga0501047_0275915 | |||
| 818 | Ga0501047_0384225 | |||
| 819 | Ga0501047_0563053 | |||
| 820 | Ga0501048_0000549 | |||
| 821 | Ga0501048_0001340 | |||
| 822 | Ga0501048_0024351 | |||
| 823 | Ga0501048_0114709 | |||
| 824 | Ga0501067_0000177 | |||
| 825 | Ga0501067_0013168 | |||
| 826 | Ga0501067_0055515 | |||
| 827 | Ga0501067_0143025 | |||
| 828 | Ga0501068_0001111 | |||
| 829 | Ga0501068_0015920 | |||
| 830 | Ga0501068_0106885 | |||
| 831 | Ga0501068_0107151 | |||
| 832 | Ga0501068_0124609 | |||
| 833 | Ga0501069_0003421 | |||
| 834 | Ga0501069_0228266 | |||
| 835 | Ga0501070_0005468 | |||
| 836 | Ga0501070_0005643 | |||
| 837 | Ga0501070_0066554 | |||
| 838 | Ga0501070_0083319 | |||
| 839 | Ga0501070_0117236 | |||
| 840 | Ga0501070_0133331 | |||
| 841 | Ga0501070_0135074 | |||
| 842 | Ga0501070_0151685 | |||
| 843 | Ga0501070_0225428 | |||
| 844 | Ga0501071_0106557 | |||
| 845 | Ga0501071_0110745 | |||
| 846 | Ga0501072_0040544 | |||
| 847 | Ga0501072_0131468 | |||
| 848 | Ga0501072_0489352 | |||
| 849 | Ga0501073_0001892 | |||
| 850 | Ga0501073_0022534 | |||
| 851 | Ga0501073_0029396 | |||
| 852 | Ga0501073_0037859 | |||
| 853 | Ga0501073_0043275 | |||
| 854 | Ga0501073_0230158 | |||
| 855 | Ga0501073_0434688 | |||
| 856 | Ga0501074_0000704 | |||
| 857 | Ga0501074_0047759 | |||
| 858 | Ga0501074_0356843 | |||
| 859 | Ga0501075_0387826 | |||
| 860 | Ga0501076_0383513 | |||
| 861 | Ga0501077_0168671 | |||
| 862 | Ga0501079_0011681 | |||
| 863 | Ga0501079_0011682 | |||
| 864 | Ga0501079_0190051 | |||
| 865 | Ga0501080_0000022 | |||
| 866 | Ga0501080_0009885 | |||
| 867 | Ga0501080_0017797 | |||
| 868 | Ga0501080_0019442 | |||
| 869 | Ga0501080_0020763 | |||
| 870 | Ga0501080_0220618 | |||
| 871 | Ga0501080_0565795 | |||
| 872 | Ga0501081_0106470 | |||
| 873 | Ga0501083_0000300 | |||
| 874 | Ga0501083_0000780 | |||
| 875 | Ga0501083_0027686 | |||
| 876 | Ga0501083_0151718 | |||
| 877 | Ga0501083_0408677 | |||
| 878 | Ga0501035_0000019 | |||
| 879 | Ga0501035_0000120 | |||
| 880 | Ga0501035_0004438 | |||
| 881 | Ga0501035_0025647 | |||
| 882 | Ga0501035_0041119 | |||
| 883 | Ga0501035_0057895 | |||
| 884 | Ga0501035_0079467 | |||
| 885 | Ga0501035_0084143 | |||
| 886 | Ga0501035_0176682 | |||
| 887 | Ga0501035_0197905 | |||
| 888 | Ga0501035_0228779 | |||
| 889 | Ga0501035_0488076 | |||
| 890 | Ga0501044_0000179 | |||
| 891 | Ga0501044_0004040 | |||
| 892 | Ga0501044_0011930 | |||
| 893 | Ga0501044_0017473 | |||
| 894 | Ga0501044_0017954 | |||
| 895 | Ga0501044_0025943 | |||
| 896 | Ga0501044_0036303 | |||
| 897 | Ga0501044_0045084 | |||
| 898 | Ga0501044_0096820 | |||
| 899 | Ga0501044_0101579 | |||
| 900 | Ga0501044_0168908 | |||
| 901 | Ga0501044_0179856 | |||
| 902 | Ga0501044_0198368 | |||
| 903 | Ga0501044_0228416 | |||
| 904 | Ga0501044_0229275 | |||
| 905 | Ga0501044_0478362 | |||
| 906 | Ga0501044_0503495 | |||
| 907 | Ga0501045_0068065 | |||
| 908 | Ga0501045_0195226 | |||
| 909 | nmdc:mga07m45_3561_c2 | |||
| 910 | nmdc:mga05p37_303128_c1 | |||
| 911 | nmdc:mga08y16_24_c1 | |||
| 912 | nmdc:mga08x19_504361_c1 | |||
| 913 | Ga0501084_0021644 | |||
| 914 | Ga0501084_0192348 | |||
| 915 | Ga0501084_0204927 | |||
| 916 | Ga0501084_0209000 | |||
| 917 | Ga0501082_0002527 | |||
| 918 | Ga0501082_0115197 | |||
| 919 | Ga0501082_0118819 | |||
| 920 | Ga0501082_0251353 | |||
| 921 | Ga0501082_0369073 | |||
| 922 | Ga0530510_0529736 | |||
| 923 | 2513862481 | |||
| 924 | 2671118292 | |||
| 925 | 2903771109 | |||
| 926 | 2932800238 | |||
| 927 | 2935775989 | |||
| 928 | 2935791607 | |||
| 929 | 2935799919 | |||
| 930 | 2941510113 | |||
| 931 | 2941518800 | |||
| 932 | 2941525512 | |||
| 933 | 3005597737 | |||
| 934 | 8016629851 | |||
| 935 | 8019541516 | |||
| 936 | 8019548789 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6f0k-assembly1.cif.gz_A | alternative complex iii | 0.4205 | 5 | 215 |
| 6f0k-assembly1.cif.gz_A | alternative complex iii | 0.4186 | 5 | 215 |
| 6loe-assembly1.cif.gz_A | cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii | 0.4132 | 3 | 215 |
| 6loe-assembly1.cif.gz_A | cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii | 0.4076 | 3 | 215 |
| 8i9p-assembly1.cif.gz_LT | cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state mak16 | 0.1939 | 83 | 157 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5xymO01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.2705 | 152 | 205 | 3.30.420.100 |
| 1j3sA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.2184 | 131 | 203 | 1.10.760.10 |
| af_A0A1D6EWS0_235_361_1.10.8.480 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.2141 | 104 | 207 | 1.10.8.480 |
| af_A4I515_256_374_1.10.8.480 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.1818 | 85 | 207 | 1.10.8.480 |
| 5xymO01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.1767 | 152 | 205 | 3.30.420.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I2GTL6-F1-model_v4 | deleted | 0.9259 | 135 | 215 |
|
| AF-A0A846FGH2-F1-model_v4 | deleted | 0.9096 | 135 | 215 |
|
| AF-A0A2V5XVR8-F1-model_v4 | Cytochrome C | 0.9014 | 126 | 215 |
|
| AF-A0A435XU15-F1-model_v4 | Cytochrome C | 0.8896 | 122 | 215 |
|
| AF-A0A7V5ERI5-F1-model_v4 | Cytochrome C | 0.8865 | 133 | 215 |
GO:0030313
|