F450061

General Info

Members Datasets Scaffolds Average Seq Length
468 241 936 310

Family's Representative Sequence

Representative Sequence 3300031911|Ga0307412_10265709|Ga0307412_102657091
Length 326
Sequence MYIKRPGVRLSSMADKVNPETPALFEIVAREDFSDATFLLEVRHPLMSRAARPGQFVIAMSHPEGERIPLTLADFDPRTGTITLVVQAVGKTTREMQQACKAGTRLHALVGPMGVPSQIVKTSGSAKKVACVGGGLGVAPMFPQARAYQQAGAYVIGIVGFRTRELVFWEQKFRSVCDELILCTNDGSAGVRGIVTDGLRICLEKNPDLNEVVAIGPPVMMKACAEATRARGVKTMVSVNPVMVDGTGMCGGCRVKIGGKVKFACVDGPDFDGHQVDFDDLMARLKRFAEQEKAAMQRWSESCRMKEPPPEPPLELPDPFEEVRGG

Samples

Sample ID Description Type Environment
1 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
133 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
137 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
141 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
154 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
155 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
156 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
165 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
168 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
169 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
170 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
171 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
172 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
173 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.21
Rhizosphere 96.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307412_10265709 3300031911 Bacteria 1340
2 Ga0065712_10017240 3300005290 Bacteria 2587
3 Ga0065715_10121232 3300005293 Bacteria 2236
4 Ga0070676_10004850 3300005328 Bacteria 7119
5 Ga0070676_10007926 3300005328 Bacteria 5709
6 Ga0070690_100002195 3300005330 Bacteria 10438
7 Ga0070670_100010558 3300005331 Bacteria 7886
8 Ga0070670_100157300 3300005331 Bacteria 1969
9 Ga0070670_100189684 3300005331 Bacteria 1785
10 Ga0070677_10031024 3300005333 Bacteria 2039
11 Ga0068869_100017934 3300005334 Bacteria 4811
12 Ga0068869_100046358 3300005334 Bacteria 3134
13 Ga0068869_100113453 3300005334 Bacteria 2064
14 Ga0070666_10001365 3300005335 Bacteria 14828
15 Ga0070666_10009573 3300005335 Bacteria 6046
16 Ga0070666_10029168 3300005335 Bacteria 3625
17 Ga0070666_10128979 3300005335 Bacteria 1756
18 Ga0068868_100008747 3300005338 Bacteria 7252
19 Ga0068868_100008974 3300005338 Bacteria 7175
20 Ga0068868_100011217 3300005338 Bacteria 6526
21 Ga0068868_100187877 3300005338 Bacteria 1717
22 Ga0070660_100084503 3300005339 Bacteria 2494
23 Ga0070689_100185720 3300005340 Bacteria 1691
24 Ga0070689_100244201 3300005340 Bacteria 1480
25 Ga0070687_100033865 3300005343 Bacteria 2525
26 Ga0070661_100030609 3300005344 Bacteria 3888
27 Ga0070668_100002083 3300005347 Bacteria 14621
28 Ga0070668_100044515 3300005347 Bacteria 3405
29 Ga0070668_100057690 3300005347 Bacteria 3001
30 Ga0070669_100003165 3300005353 Bacteria 11835
31 Ga0070669_100063143 3300005353 Bacteria 2725
32 Ga0070669_100223202 3300005353 Bacteria 1490
33 Ga0070675_100001529 3300005354 Bacteria 17099
34 Ga0070675_100017652 3300005354 Bacteria 5674
35 Ga0070675_100023804 3300005354 Bacteria 4900
36 Ga0070675_100197328 3300005354 Bacteria 1746
37 Ga0070671_100001043 3300005355 Bacteria 20414
38 Ga0070671_100095181 3300005355 Bacteria 2496
39 Ga0070671_100183373 3300005355 Bacteria 1772
40 Ga0070671_100233884 3300005355 Bacteria 1559
41 Ga0070671_100254655 3300005355 Bacteria 1491
42 Ga0070674_100012303 3300005356 Bacteria 5251
43 Ga0070674_100013158 3300005356 Bacteria 5105
44 Ga0070674_100079297 3300005356 Bacteria 2342
45 Ga0070674_100110139 3300005356 Bacteria 2020
46 Ga0070674_100122879 3300005356 Bacteria 1924
47 Ga0070674_100230891 3300005356 Bacteria 1444
48 Ga0070673_100003599 3300005364 Bacteria 9686
49 Ga0070673_100056017 3300005364 Bacteria 3108
50 Ga0070673_100155257 3300005364 Bacteria 1942
51 Ga0070673_100276597 3300005364 Bacteria 1471
52 Ga0070659_100175803 3300005366 Bacteria 1755
53 Ga0070667_100001752 3300005367 Bacteria 19380
54 Ga0070667_100007590 3300005367 Bacteria 8994
55 Ga0070667_100067920 3300005367 Bacteria 3032
56 Ga0070667_100069860 3300005367 Bacteria 2989
57 Ga0070667_100177673 3300005367 Bacteria 1882
58 Ga0070701_10011589 3300005438 Bacteria 3949
59 Ga0070705_100200363 3300005440 Bacteria 1368
60 Ga0070700_100024387 3300005441 Bacteria 3551
61 Ga0070700_100119305 3300005441 Bacteria 1765
62 Ga0070694_100151084 3300005444 Bacteria 1696
63 Ga0070663_100050949 3300005455 Bacteria 2947
64 Ga0070678_100022029 3300005456 Bacteria 4213
65 Ga0070678_100390482 3300005456 Bacteria 1206
66 Ga0070662_100001716 3300005457 Bacteria 13476
67 Ga0070662_100010587 3300005457 Bacteria 6061
68 Ga0070662_100110597 3300005457 Bacteria 2093
69 Ga0068867_100010371 3300005459 Bacteria 6574
70 Ga0068867_100043723 3300005459 Bacteria 3280
71 Ga0068867_100158803 3300005459 Bacteria 1781
72 Ga0068853_100346200 3300005539 Bacteria 1382
73 Ga0070672_100008271 3300005543 Bacteria 7111
74 Ga0070672_100029111 3300005543 Bacteria 4139
75 Ga0070672_100151449 3300005543 Bacteria 1919
76 Ga0070672_100170019 3300005543 Bacteria 1812
77 Ga0070672_100192024 3300005543 Bacteria 1705
78 Ga0070672_100463603 3300005543 Bacteria 1092
79 Ga0070686_100085380 3300005544 Bacteria 2099
80 Ga0070686_100203808 3300005544 Bacteria 1420
81 Ga0070693_100367380 3300005547 Bacteria 989
82 Ga0070665_100101368 3300005548 Bacteria 2883
83 Ga0068855_100227563 3300005563 Bacteria 2089
84 Ga0070664_100222117 3300005564 Bacteria 1690
85 Ga0070702_100013096 3300005615 Bacteria 4178
86 Ga0070702_100163264 3300005615 Bacteria 1442
87 Ga0068852_100035948 3300005616 Bacteria 4139
88 Ga0068852_100040403 3300005616 Bacteria 3935
89 Ga0068852_100354351 3300005616 Bacteria 1434
90 Ga0068859_100002602 3300005617 Bacteria 18362
91 Ga0068859_100007470 3300005617 Bacteria 11094
92 Ga0068859_100031674 3300005617 Bacteria 5310
93 Ga0068859_100220672 3300005617 Bacteria 1983
94 Ga0068864_100001134 3300005618 Bacteria 22292
95 Ga0068864_100018264 3300005618 Bacteria 5856
96 Ga0068864_100037343 3300005618 Bacteria 4145
97 Ga0068864_100074777 3300005618 Bacteria 2956
98 Ga0068866_10000487 3300005718 Bacteria 18226
99 Ga0068861_100004681 3300005719 Bacteria 9193
100 Ga0068861_100362133 3300005719 Bacteria 1276
101 Ga0068861_100441682 3300005719 Bacteria 1164
102 Ga0068863_100003115 3300005841 Bacteria 16368
103 Ga0068863_100010509 3300005841 Bacteria 8993
104 Ga0068863_100018283 3300005841 Bacteria 6712
105 Ga0068863_100063822 3300005841 Bacteria 3483
106 Ga0068863_100266059 3300005841 Bacteria 1658
107 Ga0068858_100000473 3300005842 Bacteria 41857
108 Ga0068858_100004867 3300005842 Bacteria 13171
109 Ga0068858_100035983 3300005842 Bacteria 4591
110 Ga0068860_100020125 3300005843 Bacteria 6465
111 Ga0068860_100102322 3300005843 Bacteria 2733
112 Ga0068860_100275045 3300005843 Bacteria 1644
113 Ga0068860_100523330 3300005843 Bacteria 1186
114 Ga0068862_100005793 3300005844 Bacteria 10300
115 Ga0068862_100112102 3300005844 Bacteria 2395
116 Ga0068862_100172348 3300005844 Bacteria 1938
117 Ga0097621_100004267 3300006237 Bacteria 9930
118 Ga0097621_100004452 3300006237 Bacteria 9754
119 Ga0068871_100009229 3300006358 Bacteria 7135
120 Ga0068871_100051009 3300006358 Bacteria 3348
121 Ga0068871_100082795 3300006358 Bacteria 2661
122 Ga0068871_100250550 3300006358 Bacteria 1542
123 Ga0075428_100077430 3300006844 Bacteria 3630
124 Ga0075430_100198734 3300006846 Bacteria 1665
125 Ga0075431_100038843 3300006847 Bacteria 4904
126 Ga0075431_100166866 3300006847 Bacteria 2263
127 Ga0075434_100111065 3300006871 Bacteria 2752
128 Ga0075429_100012332 3300006880 Bacteria 7415
129 Ga0068865_100005673 3300006881 Bacteria 7579
130 Ga0068865_100018311 3300006881 Bacteria 4518
131 Ga0075436_100069043 3300006914 Bacteria 2442
132 Ga0075436_100085543 3300006914 Bacteria 2189
133 Ga0097620_100002602 3300006931 Bacteria 18362
134 Ga0097620_100007470 3300006931 Bacteria 11094
135 Ga0097620_100031674 3300006931 Bacteria 5310
136 Ga0097620_100220667 3300006931 Bacteria 1983
137 Ga0075435_100100263 3300007076 Bacteria 2399
138 Ga0075435_100127376 3300007076 Bacteria 2129
139 Ga0111539_10000290 3300009094 Bacteria 60602
140 Ga0111539_10006198 3300009094 Bacteria 15433
141 Ga0111539_10121487 3300009094 Bacteria 3060
142 Ga0111539_10427627 3300009094 Bacteria 1542
143 Ga0105245_10366541 3300009098 Bacteria 1431
144 Ga0105245_10403024 3300009098 Bacteria 1367
145 Ga0114129_10026258 3300009147 Bacteria 8248
146 Ga0114129_10619746 3300009147 Bacteria 1400
147 Ga0105243_10009107 3300009148 Bacteria 7581
148 Ga0105242_10022356 3300009176 Bacteria 4971
149 Ga0105248_10002972 3300009177 Bacteria 18792
150 Ga0105248_10044451 3300009177 Bacteria 4980
151 Ga0105248_10048131 3300009177 Bacteria 4782
152 Ga0105248_10241050 3300009177 Bacteria 2035
153 Ga0105248_10565207 3300009177 Bacteria 1283
154 Ga0105249_10012851 3300009553 Bacteria 7389
155 Ga0105249_10058330 3300009553 Bacteria 3538
156 Ga0105239_10132556 3300010375 Bacteria 2773
157 Ga0157371_10067691 3300013102 Bacteria 2527
158 Ga0157369_10111420 3300013105 Bacteria 2908
159 Ga0157369_10293700 3300013105 Bacteria 1692
160 Ga0157374_10217902 3300013296 Bacteria 1872
161 Ga0157374_10564089 3300013296 Bacteria 1147
162 Ga0157378_10059229 3300013297 Bacteria 3417
163 Ga0163162_10005741 3300013306 Bacteria 12002
164 Ga0163162_10005909 3300013306 Bacteria 11842
165 Ga0163162_10416451 3300013306 Bacteria 1476
166 Ga0157372_10043685 3300013307 Bacteria 4963
167 Ga0157375_10011295 3300013308 Bacteria 7886
168 Ga0157375_10162579 3300013308 Bacteria 2375
169 Ga0157375_10188821 3300013308 Bacteria 2215
170 Ga0163163_10000891 3300014325 Bacteria 25414
171 Ga0163163_10022468 3300014325 Bacteria 5974
172 Ga0163163_10331463 3300014325 Bacteria 1576
173 Ga0163163_10348331 3300014325 Bacteria 1537
174 Ga0157380_10005692 3300014326 Bacteria 8716
175 Ga0157380_10007534 3300014326 Bacteria 7733
176 Ga0157380_10024291 3300014326 Bacteria 4586
177 Ga0157380_10063754 3300014326 Bacteria 2956
178 Ga0157377_10061690 3300014745 Bacteria 2143
179 Ga0157379_10000427 3300014968 Bacteria 33957
180 Ga0157379_10018988 3300014968 Bacteria 6069
181 Ga0157376_10002954 3300014969 Bacteria 11663
182 Ga0157376_10008778 3300014969 Bacteria 7311
183 Ga0157376_10014990 3300014969 Bacteria 5842
184 Ga0157376_10186620 3300014969 Bacteria 1899
185 Ga0157376_10236828 3300014969 Bacteria 1699
186 Ga0163161_10019654 3300017792 Bacteria 4738
187 Ga0207697_10024769 3300025315 Bacteria 2455
188 Ga0207697_10030867 3300025315 Bacteria 2193
189 Ga0207682_10000804 3300025893 Bacteria 14510
190 Ga0207682_10006260 3300025893 Bacteria 4806
191 Ga0207682_10019844 3300025893 Bacteria 2635
192 Ga0207642_10005276 3300025899 Bacteria 4210
193 Ga0207680_10001889 3300025903 Bacteria 9822
194 Ga0207680_10005602 3300025903 Bacteria 6008
195 Ga0207645_10006570 3300025907 Bacteria 8321
196 Ga0207645_10017340 3300025907 Bacteria 4754
197 Ga0207645_10030295 3300025907 Bacteria 3486
198 Ga0207643_10011273 3300025908 Bacteria 4828
199 Ga0207671_10070087 3300025914 Bacteria 2613
200 Ga0207662_10057110 3300025918 Bacteria 2332
201 Ga0207662_10168470 3300025918 Bacteria 1403
202 Ga0207657_10070148 3300025919 Bacteria 2971
203 Ga0207681_10004500 3300025923 Bacteria 8584
204 Ga0207681_10076163 3300025923 Bacteria 2355
205 Ga0207681_10091969 3300025923 Bacteria 2168
206 Ga0207650_10016567 3300025925 Bacteria 5154
207 Ga0207650_10078462 3300025925 Bacteria 2498
208 Ga0207659_10001180 3300025926 Bacteria 15612
209 Ga0207659_10003962 3300025926 Bacteria 8933
210 Ga0207659_10017175 3300025926 Bacteria 4724
211 Ga0207659_10029603 3300025926 Bacteria 3734
212 Ga0207659_10098140 3300025926 Bacteria 2202
213 Ga0207687_10030478 3300025927 Bacteria 3637
214 Ga0207687_10094305 3300025927 Bacteria 2190
215 Ga0207644_10011211 3300025931 Bacteria 5925
216 Ga0207644_10091740 3300025931 Bacteria 2265
217 Ga0207644_10105399 3300025931 Bacteria 2124
218 Ga0207690_10105598 3300025932 Bacteria 2020
219 Ga0207706_10014795 3300025933 Bacteria 7063
220 Ga0207706_10014909 3300025933 Bacteria 7038
221 Ga0207706_10032074 3300025933 Bacteria 4679
222 Ga0207706_10120747 3300025933 Bacteria 2304
223 Ga0207686_10050384 3300025934 Bacteria 2589
224 Ga0207686_10090416 3300025934 Bacteria 2020
225 Ga0207709_10001799 3300025935 Bacteria 14360
226 Ga0207670_10233399 3300025936 Bacteria 1414
227 Ga0207669_10000448 3300025937 Bacteria 17941
228 Ga0207669_10042182 3300025937 Bacteria 2661
229 Ga0207669_10095541 3300025937 Bacteria 1948
230 Ga0207669_10429054 3300025937 Bacteria 1042
231 Ga0207669_10468860 3300025937 Bacteria 1001
232 Ga0207704_10010417 3300025938 Bacteria 4536
233 Ga0207691_10016360 3300025940 Bacteria 7041
234 Ga0207691_10026570 3300025940 Bacteria 5431
235 Ga0207691_10031021 3300025940 Bacteria 4992
236 Ga0207691_10061714 3300025940 Bacteria 3404
237 Ga0207691_10076542 3300025940 Bacteria 3015
238 Ga0207691_10172715 3300025940 Bacteria 1892
239 Ga0207711_10002634 3300025941 Bacteria 15888
240 Ga0207711_10006101 3300025941 Bacteria 10176
241 Ga0207711_10007856 3300025941 Bacteria 8918
242 Ga0207711_10022993 3300025941 Bacteria 5217
243 Ga0207689_10011240 3300025942 Bacteria 7684
244 Ga0207689_10015201 3300025942 Bacteria 6519
245 Ga0207689_10016920 3300025942 Bacteria 6169
246 Ga0207679_10047078 3300025945 Bacteria 3131
247 Ga0207667_10517091 3300025949 Bacteria 1209
248 Ga0207651_10002443 3300025960 Bacteria 8890
249 Ga0207651_10301732 3300025960 Bacteria 1332
250 Ga0207712_10016117 3300025961 Bacteria 4833
251 Ga0207712_10069686 3300025961 Bacteria 2524
252 Ga0207668_10019012 3300025972 Bacteria 4333
253 Ga0207668_10060120 3300025972 Bacteria 2666
254 Ga0207668_10085711 3300025972 Bacteria 2299
255 Ga0207658_10002524 3300025986 Bacteria 13320
256 Ga0207658_10003546 3300025986 Bacteria 11015
257 Ga0207658_10064350 3300025986 Bacteria 2751
258 Ga0207677_10000601 3300026023 Bacteria 22219
259 Ga0207677_10041159 3300026023 Bacteria 3053
260 Ga0207677_10147292 3300026023 Bacteria 1811
261 Ga0207703_10000556 3300026035 Bacteria 38283
262 Ga0207703_10003678 3300026035 Bacteria 12781
263 Ga0207703_10145189 3300026035 Bacteria 2063
264 Ga0207703_10257069 3300026035 Bacteria 1577
265 Ga0207678_10021665 3300026067 Bacteria 5636
266 Ga0207708_10038585 3300026075 Bacteria 3638
267 Ga0207641_10001540 3300026088 Bacteria 22554
268 Ga0207641_10053017 3300026088 Bacteria 3436
269 Ga0207641_10230376 3300026088 Bacteria 1721
270 Ga0207648_10010099 3300026089 Bacteria 8978
271 Ga0207648_10034567 3300026089 Bacteria 4455
272 Ga0207648_10301450 3300026089 Bacteria 1437
273 Ga0207648_10406920 3300026089 Bacteria 1234
274 Ga0207676_10002338 3300026095 Bacteria 13577
275 Ga0207676_10051402 3300026095 Bacteria 3217
276 Ga0207675_100005585 3300026118 Bacteria 12036
277 Ga0207675_100006107 3300026118 Bacteria 11459
278 Ga0207675_100009571 3300026118 Bacteria 9064
279 Ga0207675_100103562 3300026118 Bacteria 2682
280 Ga0207675_100120767 3300026118 Bacteria 2479
281 Ga0207683_10003819 3300026121 Bacteria 13054
282 Ga0207683_10040509 3300026121 Bacteria 4065
283 Ga0207683_10069885 3300026121 Bacteria 3101
284 Ga0207683_10118455 3300026121 Bacteria 2375
285 Ga0207683_10212171 3300026121 Bacteria 1763
286 Ga0207698_10011061 3300026142 Bacteria 5834
287 Ga0209981_1001205 3300027378 Bacteria 3277
288 Ga0209996_1002921 3300027395 Bacteria 2132
289 Ga0210000_1004786 3300027462 Bacteria 1960
290 Ga0209995_1005322 3300027471 Bacteria 2067
291 Ga0209968_1018659 3300027526 Bacteria 1113
292 Ga0209971_1007219 3300027682 Bacteria 2636
293 Ga0209966_1010129 3300027695 Bacteria 1694
294 Ga0209974_10041766 3300027876 Bacteria 1527
295 Ga0207428_10005393 3300027907 Bacteria 11929
296 Ga0207428_10076172 3300027907 Bacteria 2627
297 Ga0268266_10077310 3300028379 Bacteria 2893
298 Ga0268265_10005256 3300028380 Bacteria 8862
299 Ga0268265_10074667 3300028380 Bacteria 2653
300 Ga0268264_10015781 3300028381 Bacteria 6185
301 Ga0268264_10137985 3300028381 Bacteria 2171
302 Ga0265330_10006123 3300031235 Bacteria 5958
303 Ga0265320_10068545 3300031240 Bacteria 1676
304 Ga0265331_10061089 3300031250 Bacteria 1779
305 Ga0265316_10079831 3300031344 Bacteria 2510
306 Ga0316575_10014083 3300031665 Bacteria 2998
307 Ga0316575_10017579 3300031665 Bacteria 2717
308 Ga0316575_10020021 3300031665 Bacteria 2563
309 Ga0316575_10023264 3300031665 Bacteria 2394
310 Ga0316575_10048109 3300031665 Bacteria 1695
311 Ga0316579_10001133 3300031691 Bacteria 9471
312 Ga0316579_10046557 3300031691 Bacteria 2024
313 Ga0265314_10048912 3300031711 Bacteria 2963
314 Ga0265314_10053133 3300031711 Bacteria 2811
315 Ga0265342_10128388 3300031712 Bacteria 1422
316 Ga0316576_10011050 3300031727 Bacteria 5895
317 Ga0316576_10016945 3300031727 Bacteria 4938
318 Ga0316576_10018786 3300031727 Bacteria 4727
319 Ga0316576_10036799 3300031727 Bacteria 3499
320 Ga0316576_10097921 3300031727 Bacteria 2190
321 Ga0316576_10120729 3300031727 Bacteria 1968
322 Ga0316576_10214471 3300031727 Bacteria 1448
323 Ga0316576_10248707 3300031727 Bacteria 1335
324 Ga0316578_10013849 3300031728 Bacteria 4287
325 Ga0316578_10032270 3300031728 Bacteria 2991
326 Ga0316578_10086644 3300031728 Bacteria 1867
327 Ga0307405_10014501 3300031731 Bacteria 4239
328 Ga0307405_10323858 3300031731 Bacteria 1178
329 Ga0316577_10004619 3300031733 Bacteria 7137
330 Ga0307413_10002439 3300031824 Bacteria 7556
331 Ga0307410_10230120 3300031852 Bacteria 1431
332 Ga0307406_10003161 3300031901 Bacteria 8960
333 Ga0307407_10019471 3300031903 Bacteria 3457
334 Ga0307412_10030101 3300031911 Bacteria 3413
335 Ga0307409_100058338 3300031995 Bacteria 2997
336 Ga0307416_100425392 3300032002 Bacteria 1373
337 Ga0307414_10254273 3300032004 Bacteria 1462
338 Ga0307411_10005708 3300032005 Bacteria 6149
339 Ga0307411_10354792 3300032005 Bacteria 1197
340 Ga0307415_100014804 3300032126 Bacteria 4599
341 Ga0307415_100109058 3300032126 Bacteria 2050
342 Ga0316585_10006858 3300032137 Bacteria 3267
343 Ga0316585_10007649 3300032137 Bacteria 3122
344 Ga0316580_10003076 3300032139 Bacteria 4701
345 Ga0316580_10011638 3300032139 Bacteria 2673
346 Ga0373926_0086748 3300035083 Bacteria 1162
347 Ga0373949_0044830 3300035090 Bacteria 1098
348 Ga0373923_0118677 3300035111 Bacteria 1180
349 Ga0373946_0019347 3300035171 Bacteria 2624
350 Ga0373946_0110004 3300035171 Bacteria 1246
351 Ga0373955_0093842 3300035172 Bacteria 1714
352 Ga0316574_0000327 3300035398 Bacteria 18235
353 Ga0316574_0004554 3300035398 Bacteria 7279
354 Ga0316574_0009455 3300035398 Bacteria 5463
355 Ga0316574_0093434 3300035398 Bacteria 1920
356 Ga0316574_0132794 3300035398 Bacteria 1602
357 Ga0373931_0006052 3300035691 Bacteria 5634
358 Ga0373927_0008583 3300035695 Bacteria 6865
359 Ga0373927_0121057 3300035695 Bacteria 1708
360 Ga0373937_0159898 3300036401 Bacteria 2112
361 Ga0373937_0174890 3300036401 Bacteria 2015
362 Ga0373937_0332068 3300036401 Bacteria 1439
363 Ga0316582_0001896 3300036647 Bacteria 9511
364 Ga0316582_0080046 3300036647 Bacteria 2131
365 Ga0316584_0124394 3300036712 Bacteria 1926
366 Ga0316584_0125528 3300036712 Bacteria 1917
367 Ga0316584_0161371 3300036712 Bacteria 1665
368 Ga0373925_0012516 3300037068 Bacteria 6146
369 Ga0316581_0009618 3300037588 Bacteria 2663
370 Ga0400486_10986 3300038742 Bacteria 1751
371 Ga0400487_04427 3300039110 Bacteria 1481
372 Ga0439461_0000313 3300041410 Bacteria 6825
373 Ga0439434_0003854 3300042435 Bacteria 4382
374 Ga0439435_0000007 3300042436 Bacteria 22484
375 Ga0439444_0000290 3300042437 Bacteria 5169
376 Ga0451577_0004361 3300042876 Bacteria 14966
377 Ga0451577_0013737 3300042876 Bacteria 7569
378 Ga0451577_0352766 3300042876 Bacteria 1334
379 Ga0453683_0004735 3300044673 Bacteria 9598
380 Ga0453684_0011986 3300044712 Bacteria 14420
381 Ga0453684_0062436 3300044712 Bacteria 4772
382 Ga0453684_0075245 3300044712 Bacteria 4245
383 Ga0453684_0132412 3300044712 Bacteria 2990
384 Ga0453684_0469943 3300044712 Bacteria 1397
385 Ga0451576_0000360 3300045051 Bacteria 109145
386 Ga0451576_0003161 3300045051 Bacteria 23042
387 Ga0451576_0013599 3300045051 Bacteria 9097
388 Ga0451576_0031691 3300045051 Bacteria 5635
389 Ga0451576_0097372 3300045051 Bacteria 3059
390 Ga0451576_0141387 3300045051 Bacteria 2510
391 Ga0451576_0234667 3300045051 Bacteria 1916
392 Ga0451576_0378770 3300045051 Bacteria 1483
393 Ga0495629_0046392 3300046459 Bacteria 3048
394 Ga0495580_0302557 3300046472 Bacteria 1089
395 Ga0495608_0097334 3300046511 Bacteria 1900
396 Ga0495652_0159690 3300046529 Bacteria 1752
397 Ga0495640_0303969 3300046533 Bacteria 990
398 Ga0495667_0089745 3300046559 Bacteria 1992
399 Ga0495667_0118103 3300046559 Bacteria 1713
400 Ga0495647_0022081 3300046681 Bacteria 2298
401 Ga0495658_0027644 3300046683 Bacteria 3055
402 Ga0495613_0105657 3300046689 Bacteria 2032
403 Ga0495624_0197995 3300046690 Bacteria 1221
404 Ga0495680_0036246 3300047322 Bacteria 3962
405 Ga0495602_0157197 3300048088 Bacteria 1779
406 Ga0496101_0295276 3300048904 Bacteria 1268
407 Ga0496104_0012132 3300048907 Bacteria 7739
408 Ga0496104_0154410 3300048907 Bacteria 2203
409 Ga0496105_0041024 3300048908 Bacteria 3815
410 Ga0496106_0013606 3300048909 Bacteria 6007
411 Ga0496106_0181078 3300048909 Bacteria 1673
412 Ga0496107_0047836 3300048910 Bacteria 3080
413 Ga0496108_0129261 3300048911 Bacteria 2171
414 Ga0496109_0232923 3300048912 Bacteria 1733
415 Ga0496109_0445126 3300048912 Bacteria 1224
416 Ga0496110_0452737 3300048913 Bacteria 1170
417 Ga0496111_0156845 3300048914 Bacteria 1689
418 Ga0496113_0156987 3300048916 Bacteria 1797
419 Ga0496114_0018489 3300048917 Bacteria 5636
420 Ga0496115_0037229 3300048918 Bacteria 3855
421 Ga0501031_0009336 3300049568 Bacteria 6376
422 Ga0501032_0024781 3300049569 Bacteria 4139
423 Ga0501033_0009546 3300049570 Bacteria 7467
424 Ga0501034_0269754 3300049571 Bacteria 1643
425 Ga0501036_0000243 3300049572 Bacteria 36738
426 Ga0501037_0124795 3300049573 Bacteria 1849
427 Ga0501038_0001070 3300049574 Bacteria 24711
428 Ga0501039_0000414 3300049575 Bacteria 30647
429 Ga0501040_0000452 3300049576 Bacteria 24369
430 Ga0501041_0000160 3300049577 Bacteria 29869
431 Ga0501042_0000352 3300049578 Bacteria 23103
432 Ga0501043_0003538 3300049579 Bacteria 12839
433 Ga0501046_0000151 3300049580 Bacteria 72539
434 Ga0501048_0001007 3300049582 Bacteria 21033
435 Ga0501068_0021705 3300049584 Bacteria 3752
436 Ga0501070_0008836 3300049586 Bacteria 8517
437 Ga0501071_0000115 3300049587 Bacteria 31546
438 Ga0501072_0000185 3300049588 Bacteria 45075
439 Ga0501074_0014152 3300049590 Bacteria 5801
440 Ga0501075_0000041 3300049591 Bacteria 51649
441 Ga0501076_0088223 3300049592 Bacteria 2493
442 Ga0501077_0001377 3300049593 Bacteria 14636
443 Ga0501079_0000010 3300049741 Bacteria 73916
444 Ga0501079_0107551 3300049741 Bacteria 2165
445 Ga0501080_0015156 3300049742 Bacteria 7101
446 Ga0501081_0001130 3300049743 Bacteria 16078
447 Ga0501081_0037875 3300049743 Bacteria 3292
448 Ga0501083_0023296 3300049744 Bacteria 4296
449 Ga0501035_0039647 3300049822 Bacteria 4261
450 Ga0501044_0396588 3300049823 Bacteria 1293
451 Ga0501045_0000218 3300049824 Bacteria 32946
452 Ga0501045_0127881 3300049824 Bacteria 1888
453 Ga0501045_0336065 3300049824 Bacteria 1124
454 nmdc:mga05p37_20097_c1 3300050507 Bacteria 8082
455 nmdc:mga09592_14821_c1 3300050508 Bacteria 6363
456 nmdc:mga06r32_42308_c1 3300050510 Bacteria 4331
457 nmdc:mga08y16_1240_c1 3300050511 Bacteria 25278
458 nmdc:mga08y16_74937_c1 3300050511 Bacteria 3527
459 nmdc:mga08y16_9200_c1 3300050511 Bacteria 10367
460 nmdc:mga08x19_31563_c1 3300050514 Bacteria 3333
461 nmdc:mga0a205_165963_c1 3300050515 Bacteria 2104
462 Ga0495595_0186016 3300053084 Bacteria 1031
463 Ga0495619_0042298 3300053085 Bacteria 2983
464 Ga0495619_0173817 3300053085 Bacteria 1490
465 Ga0501084_0002601 3300054114 Bacteria 14536
466 Ga0501082_0001542 3300060353 Bacteria 20287
467 Ga0501082_0267839 3300060353 Bacteria 1487
468 Ga0530510_0000962 3300061734 Bacteria 19018
469 Ga0307412_10265709
470 Ga0065712_10017240
471 Ga0065715_10121232
472 Ga0070676_10004850
473 Ga0070676_10007926
474 Ga0070690_100002195
475 Ga0070670_100010558
476 Ga0070670_100157300
477 Ga0070670_100189684
478 Ga0070677_10031024
479 Ga0068869_100017934
480 Ga0068869_100046358
481 Ga0068869_100113453
482 Ga0070666_10001365
483 Ga0070666_10009573
484 Ga0070666_10029168
485 Ga0070666_10128979
486 Ga0068868_100008747
487 Ga0068868_100008974
488 Ga0068868_100011217
489 Ga0068868_100187877
490 Ga0070660_100084503
491 Ga0070689_100185720
492 Ga0070689_100244201
493 Ga0070687_100033865
494 Ga0070661_100030609
495 Ga0070668_100002083
496 Ga0070668_100044515
497 Ga0070668_100057690
498 Ga0070669_100003165
499 Ga0070669_100063143
500 Ga0070669_100223202
501 Ga0070675_100001529
502 Ga0070675_100017652
503 Ga0070675_100023804
504 Ga0070675_100197328
505 Ga0070671_100001043
506 Ga0070671_100095181
507 Ga0070671_100183373
508 Ga0070671_100233884
509 Ga0070671_100254655
510 Ga0070674_100012303
511 Ga0070674_100013158
512 Ga0070674_100079297
513 Ga0070674_100110139
514 Ga0070674_100122879
515 Ga0070674_100230891
516 Ga0070673_100003599
517 Ga0070673_100056017
518 Ga0070673_100155257
519 Ga0070673_100276597
520 Ga0070659_100175803
521 Ga0070667_100001752
522 Ga0070667_100007590
523 Ga0070667_100067920
524 Ga0070667_100069860
525 Ga0070667_100177673
526 Ga0070701_10011589
527 Ga0070705_100200363
528 Ga0070700_100024387
529 Ga0070700_100119305
530 Ga0070694_100151084
531 Ga0070663_100050949
532 Ga0070678_100022029
533 Ga0070678_100390482
534 Ga0070662_100001716
535 Ga0070662_100010587
536 Ga0070662_100110597
537 Ga0068867_100010371
538 Ga0068867_100043723
539 Ga0068867_100158803
540 Ga0068853_100346200
541 Ga0070672_100008271
542 Ga0070672_100029111
543 Ga0070672_100151449
544 Ga0070672_100170019
545 Ga0070672_100192024
546 Ga0070672_100463603
547 Ga0070686_100085380
548 Ga0070686_100203808
549 Ga0070693_100367380
550 Ga0070665_100101368
551 Ga0068855_100227563
552 Ga0070664_100222117
553 Ga0070702_100013096
554 Ga0070702_100163264
555 Ga0068852_100035948
556 Ga0068852_100040403
557 Ga0068852_100354351
558 Ga0068859_100002602
559 Ga0068859_100007470
560 Ga0068859_100031674
561 Ga0068859_100220672
562 Ga0068864_100001134
563 Ga0068864_100018264
564 Ga0068864_100037343
565 Ga0068864_100074777
566 Ga0068866_10000487
567 Ga0068861_100004681
568 Ga0068861_100362133
569 Ga0068861_100441682
570 Ga0068863_100003115
571 Ga0068863_100010509
572 Ga0068863_100018283
573 Ga0068863_100063822
574 Ga0068863_100266059
575 Ga0068858_100000473
576 Ga0068858_100004867
577 Ga0068858_100035983
578 Ga0068860_100020125
579 Ga0068860_100102322
580 Ga0068860_100275045
581 Ga0068860_100523330
582 Ga0068862_100005793
583 Ga0068862_100112102
584 Ga0068862_100172348
585 Ga0097621_100004267
586 Ga0097621_100004452
587 Ga0068871_100009229
588 Ga0068871_100051009
589 Ga0068871_100082795
590 Ga0068871_100250550
591 Ga0075428_100077430
592 Ga0075430_100198734
593 Ga0075431_100038843
594 Ga0075431_100166866
595 Ga0075434_100111065
596 Ga0075429_100012332
597 Ga0068865_100005673
598 Ga0068865_100018311
599 Ga0075436_100069043
600 Ga0075436_100085543
601 Ga0097620_100002602
602 Ga0097620_100007470
603 Ga0097620_100031674
604 Ga0097620_100220667
605 Ga0075435_100100263
606 Ga0075435_100127376
607 Ga0111539_10000290
608 Ga0111539_10006198
609 Ga0111539_10121487
610 Ga0111539_10427627
611 Ga0105245_10366541
612 Ga0105245_10403024
613 Ga0114129_10026258
614 Ga0114129_10619746
615 Ga0105243_10009107
616 Ga0105242_10022356
617 Ga0105248_10002972
618 Ga0105248_10044451
619 Ga0105248_10048131
620 Ga0105248_10241050
621 Ga0105248_10565207
622 Ga0105249_10012851
623 Ga0105249_10058330
624 Ga0105239_10132556
625 Ga0157371_10067691
626 Ga0157369_10111420
627 Ga0157369_10293700
628 Ga0157374_10217902
629 Ga0157374_10564089
630 Ga0157378_10059229
631 Ga0163162_10005741
632 Ga0163162_10005909
633 Ga0163162_10416451
634 Ga0157372_10043685
635 Ga0157375_10011295
636 Ga0157375_10162579
637 Ga0157375_10188821
638 Ga0163163_10000891
639 Ga0163163_10022468
640 Ga0163163_10331463
641 Ga0163163_10348331
642 Ga0157380_10005692
643 Ga0157380_10007534
644 Ga0157380_10024291
645 Ga0157380_10063754
646 Ga0157377_10061690
647 Ga0157379_10000427
648 Ga0157379_10018988
649 Ga0157376_10002954
650 Ga0157376_10008778
651 Ga0157376_10014990
652 Ga0157376_10186620
653 Ga0157376_10236828
654 Ga0163161_10019654
655 Ga0207697_10024769
656 Ga0207697_10030867
657 Ga0207682_10000804
658 Ga0207682_10006260
659 Ga0207682_10019844
660 Ga0207642_10005276
661 Ga0207680_10001889
662 Ga0207680_10005602
663 Ga0207645_10006570
664 Ga0207645_10017340
665 Ga0207645_10030295
666 Ga0207643_10011273
667 Ga0207671_10070087
668 Ga0207662_10057110
669 Ga0207662_10168470
670 Ga0207657_10070148
671 Ga0207681_10004500
672 Ga0207681_10076163
673 Ga0207681_10091969
674 Ga0207650_10016567
675 Ga0207650_10078462
676 Ga0207659_10001180
677 Ga0207659_10003962
678 Ga0207659_10017175
679 Ga0207659_10029603
680 Ga0207659_10098140
681 Ga0207687_10030478
682 Ga0207687_10094305
683 Ga0207644_10011211
684 Ga0207644_10091740
685 Ga0207644_10105399
686 Ga0207690_10105598
687 Ga0207706_10014795
688 Ga0207706_10014909
689 Ga0207706_10032074
690 Ga0207706_10120747
691 Ga0207686_10050384
692 Ga0207686_10090416
693 Ga0207709_10001799
694 Ga0207670_10233399
695 Ga0207669_10000448
696 Ga0207669_10042182
697 Ga0207669_10095541
698 Ga0207669_10429054
699 Ga0207669_10468860
700 Ga0207704_10010417
701 Ga0207691_10016360
702 Ga0207691_10026570
703 Ga0207691_10031021
704 Ga0207691_10061714
705 Ga0207691_10076542
706 Ga0207691_10172715
707 Ga0207711_10002634
708 Ga0207711_10006101
709 Ga0207711_10007856
710 Ga0207711_10022993
711 Ga0207689_10011240
712 Ga0207689_10015201
713 Ga0207689_10016920
714 Ga0207679_10047078
715 Ga0207667_10517091
716 Ga0207651_10002443
717 Ga0207651_10301732
718 Ga0207712_10016117
719 Ga0207712_10069686
720 Ga0207668_10019012
721 Ga0207668_10060120
722 Ga0207668_10085711
723 Ga0207658_10002524
724 Ga0207658_10003546
725 Ga0207658_10064350
726 Ga0207677_10000601
727 Ga0207677_10041159
728 Ga0207677_10147292
729 Ga0207703_10000556
730 Ga0207703_10003678
731 Ga0207703_10145189
732 Ga0207703_10257069
733 Ga0207678_10021665
734 Ga0207708_10038585
735 Ga0207641_10001540
736 Ga0207641_10053017
737 Ga0207641_10230376
738 Ga0207648_10010099
739 Ga0207648_10034567
740 Ga0207648_10301450
741 Ga0207648_10406920
742 Ga0207676_10002338
743 Ga0207676_10051402
744 Ga0207675_100005585
745 Ga0207675_100006107
746 Ga0207675_100009571
747 Ga0207675_100103562
748 Ga0207675_100120767
749 Ga0207683_10003819
750 Ga0207683_10040509
751 Ga0207683_10069885
752 Ga0207683_10118455
753 Ga0207683_10212171
754 Ga0207698_10011061
755 Ga0209981_1001205
756 Ga0209996_1002921
757 Ga0210000_1004786
758 Ga0209995_1005322
759 Ga0209968_1018659
760 Ga0209971_1007219
761 Ga0209966_1010129
762 Ga0209974_10041766
763 Ga0207428_10005393
764 Ga0207428_10076172
765 Ga0268266_10077310
766 Ga0268265_10005256
767 Ga0268265_10074667
768 Ga0268264_10015781
769 Ga0268264_10137985
770 Ga0265330_10006123
771 Ga0265320_10068545
772 Ga0265331_10061089
773 Ga0265316_10079831
774 Ga0316575_10014083
775 Ga0316575_10017579
776 Ga0316575_10020021
777 Ga0316575_10023264
778 Ga0316575_10048109
779 Ga0316579_10001133
780 Ga0316579_10046557
781 Ga0265314_10048912
782 Ga0265314_10053133
783 Ga0265342_10128388
784 Ga0316576_10011050
785 Ga0316576_10016945
786 Ga0316576_10018786
787 Ga0316576_10036799
788 Ga0316576_10097921
789 Ga0316576_10120729
790 Ga0316576_10214471
791 Ga0316576_10248707
792 Ga0316578_10013849
793 Ga0316578_10032270
794 Ga0316578_10086644
795 Ga0307405_10014501
796 Ga0307405_10323858
797 Ga0316577_10004619
798 Ga0307413_10002439
799 Ga0307410_10230120
800 Ga0307406_10003161
801 Ga0307407_10019471
802 Ga0307412_10030101
803 Ga0307409_100058338
804 Ga0307416_100425392
805 Ga0307414_10254273
806 Ga0307411_10005708
807 Ga0307411_10354792
808 Ga0307415_100014804
809 Ga0307415_100109058
810 Ga0316585_10006858
811 Ga0316585_10007649
812 Ga0316580_10003076
813 Ga0316580_10011638
814 Ga0373926_0086748
815 Ga0373949_0044830
816 Ga0373923_0118677
817 Ga0373946_0019347
818 Ga0373946_0110004
819 Ga0373955_0093842
820 Ga0316574_0000327
821 Ga0316574_0004554
822 Ga0316574_0009455
823 Ga0316574_0093434
824 Ga0316574_0132794
825 Ga0373931_0006052
826 Ga0373927_0008583
827 Ga0373927_0121057
828 Ga0373937_0159898
829 Ga0373937_0174890
830 Ga0373937_0332068
831 Ga0316582_0001896
832 Ga0316582_0080046
833 Ga0316584_0124394
834 Ga0316584_0125528
835 Ga0316584_0161371
836 Ga0373925_0012516
837 Ga0316581_0009618
838 Ga0400486_10986
839 Ga0400487_04427
840 Ga0439461_0000313
841 Ga0439434_0003854
842 Ga0439435_0000007
843 Ga0439444_0000290
844 Ga0451577_0004361
845 Ga0451577_0013737
846 Ga0451577_0352766
847 Ga0453683_0004735
848 Ga0453684_0011986
849 Ga0453684_0062436
850 Ga0453684_0075245
851 Ga0453684_0132412
852 Ga0453684_0469943
853 Ga0451576_0000360
854 Ga0451576_0003161
855 Ga0451576_0013599
856 Ga0451576_0031691
857 Ga0451576_0097372
858 Ga0451576_0141387
859 Ga0451576_0234667
860 Ga0451576_0378770
861 Ga0495629_0046392
862 Ga0495580_0302557
863 Ga0495608_0097334
864 Ga0495652_0159690
865 Ga0495640_0303969
866 Ga0495667_0089745
867 Ga0495667_0118103
868 Ga0495647_0022081
869 Ga0495658_0027644
870 Ga0495613_0105657
871 Ga0495624_0197995
872 Ga0495680_0036246
873 Ga0495602_0157197
874 Ga0496101_0295276
875 Ga0496104_0012132
876 Ga0496104_0154410
877 Ga0496105_0041024
878 Ga0496106_0013606
879 Ga0496106_0181078
880 Ga0496107_0047836
881 Ga0496108_0129261
882 Ga0496109_0232923
883 Ga0496109_0445126
884 Ga0496110_0452737
885 Ga0496111_0156845
886 Ga0496113_0156987
887 Ga0496114_0018489
888 Ga0496115_0037229
889 Ga0501031_0009336
890 Ga0501032_0024781
891 Ga0501033_0009546
892 Ga0501034_0269754
893 Ga0501036_0000243
894 Ga0501037_0124795
895 Ga0501038_0001070
896 Ga0501039_0000414
897 Ga0501040_0000452
898 Ga0501041_0000160
899 Ga0501042_0000352
900 Ga0501043_0003538
901 Ga0501046_0000151
902 Ga0501048_0001007
903 Ga0501068_0021705
904 Ga0501070_0008836
905 Ga0501071_0000115
906 Ga0501072_0000185
907 Ga0501074_0014152
908 Ga0501075_0000041
909 Ga0501076_0088223
910 Ga0501077_0001377
911 Ga0501079_0000010
912 Ga0501079_0107551
913 Ga0501080_0015156
914 Ga0501081_0001130
915 Ga0501081_0037875
916 Ga0501083_0023296
917 Ga0501035_0039647
918 Ga0501044_0396588
919 Ga0501045_0000218
920 Ga0501045_0127881
921 Ga0501045_0336065
922 nmdc:mga05p37_20097_c1
923 nmdc:mga09592_14821_c1
924 nmdc:mga06r32_42308_c1
925 nmdc:mga08y16_1240_c1
926 nmdc:mga08y16_74937_c1
927 nmdc:mga08y16_9200_c1
928 nmdc:mga08x19_31563_c1
929 nmdc:mga0a205_165963_c1
930 Ga0495595_0186016
931 Ga0495619_0042298
932 Ga0495619_0173817
933 Ga0501084_0002601
934 Ga0501082_0001542
935 Ga0501082_0267839
936 Ga0530510_0000962

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10418

DHODB_Fe-S_bind

Iron-sulfur cluster binding domain of dihydroorotate dehydrogenase B

240

277

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jca-assembly1.cif.gz_S nadp(h) bound nadh-dependent ferredoxin:nadp oxidoreductase (nfni) from pyrococcus furiosus 0.863 3 277
5jca-assembly1.cif.gz_S nadp(h) bound nadh-dependent ferredoxin:nadp oxidoreductase (nfni) from pyrococcus furiosus 0.8488 3 277
4yry-assembly1.cif.gz_A insights into flavin-based electron bifurcation via the nadh-dependent reduced ferredoxin-nadp oxidoreductase structure 0.846 1 271
2rho-assembly2.cif.gz_B synthetic gene encoded bacillus subtilis ftsz ncs dimer with bound gdp and gtp-gamma-s 0.8454 100 161
4yry-assembly1.cif.gz_A insights into flavin-based electron bifurcation via the nadh-dependent reduced ferredoxin-nadp oxidoreductase structure 0.8292 1 271
ID Description Score Start End Superfamily
af_Q58841_92_194_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.9578 103 204 3.40.50.80
af_Q58841_92_194_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.9222 103 204 3.40.50.80
5ue9D02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.8458 98 212 3.40.50.80
5ue9D02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.8261 98 212 3.40.50.80
af_Q2G2P2_146_251_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.8226 4 93 2.40.30.10
ID Description Score Start End GO Terms
AF-A0A3D3DDW6-F1-model_v4 Sulfide/dihydroorotate dehydrogenase-like FAD/NAD-binding protein 0.9736 5 100 GO:0016491
AF-X1U856-F1-model_v4 FAD-binding FR-type domain-containing protein 0.966 5 99 GO:0016491
AF-I7LSE9-F1-model_v4 deleted 0.9654 5 101
AF-A0A7V5YQ23-F1-model_v4 NADPH-dependent glutamate synthase (EC 1.4.1.13) 0.9576 3 95 GO:0004355
GO:0051536
AF-A0A497DYB0-F1-model_v4 Sulfide/dihydroorotate dehydrogenase-like FAD/NAD-binding protein 0.9557 5 100 GO:0016491

Map