F450052
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 468 | 205 | 468 | 249 |
Family's Representative Sequence
| Representative Sequence | 3300026118|Ga0207675_100029273|Ga0207675_1000292734 |
| Length | 244 |
| Sequence | VKERIDKLLVERGMAESRTKAQAMVMAGVVLVNEQRVEKSSDQFSSDAQIRIKRADDPATRYVGRGGLKLEAALKQFQIDVRGLVCLDVGASTGGFTDCLLQHGATKVFAIDVGHNQIDWRLRNDPRVEVREGVPIRFDLAVVDVSFISVSKVLPAVAPLLKEEGSMVVLIKPQFEVGRGEVGSGGIVRDEQKRLRVVAEVNQFAATLQLRVEGLVESAIKGAEGNVEYLAHYSYHPASKHVAN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 67 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 93 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 138 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 141 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 142 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 143 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 144 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 145 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 146 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 147 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 148 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 149 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 150 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 152 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 153 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 154 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 155 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 156 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 157 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 158 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 163 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 164 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 165 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 167 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 168 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 169 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 174 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 175 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 176 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 177 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 178 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 179 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 180 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 181 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 182 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 183 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 184 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 185 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 186 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 187 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 188 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 189 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 190 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 191 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 192 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 193 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 194 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 195 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 196 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 197 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 205 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.21 |
| Nodule | 0 |
| Rhizoplane | 2.78 |
| Rhizosphere | 95.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10242010 | 3300003320 | Bacteria | 2824 |
| 2 | rootL2_10076314 | 3300003322 | Bacteria | 4175 |
| 3 | Ga0065704_10097050 | 3300005289 | Bacteria | 2368 |
| 4 | Ga0065712_10006595 | 3300005290 | Bacteria | 2879 |
| 5 | Ga0065712_10099388 | 3300005290 | Bacteria | 2092 |
| 6 | Ga0065712_10219704 | 3300005290 | Bacteria | 1045 |
| 7 | Ga0065715_10010167 | 3300005293 | Bacteria | 3087 |
| 8 | Ga0065715_10018518 | 3300005293 | Bacteria | 2272 |
| 9 | Ga0065715_10106098 | 3300005293 | Bacteria | 2851 |
| 10 | Ga0065715_10174730 | 3300005293 | Unclassified | 1520 |
| 11 | Ga0070690_100029181 | 3300005330 | Bacteria | 3419 |
| 12 | Ga0070690_100034203 | 3300005330 | Unclassified | 3184 |
| 13 | Ga0070670_100039439 | 3300005331 | Bacteria | 4061 |
| 14 | Ga0070670_100532682 | 3300005331 | Bacteria | 1047 |
| 15 | Ga0068869_100029301 | 3300005334 | Unclassified | 3856 |
| 16 | Ga0068869_100040781 | 3300005334 | Bacteria | 3321 |
| 17 | Ga0068869_100050162 | 3300005334 | Bacteria | 3024 |
| 18 | Ga0068869_100170311 | 3300005334 | Bacteria | 1701 |
| 19 | Ga0070666_10156084 | 3300005335 | Unclassified | 1594 |
| 20 | Ga0070680_100385705 | 3300005336 | Bacteria | 1193 |
| 21 | Ga0068868_100033094 | 3300005338 | Bacteria | 3983 |
| 22 | Ga0068868_100160700 | 3300005338 | Unclassified | 1855 |
| 23 | Ga0070689_100008318 | 3300005340 | Bacteria | 7304 |
| 24 | Ga0070689_100129061 | 3300005340 | Bacteria | 2026 |
| 25 | Ga0070687_100208109 | 3300005343 | Bacteria | 1190 |
| 26 | Ga0070687_100224192 | 3300005343 | Bacteria | 1153 |
| 27 | Ga0070692_10008884 | 3300005345 | Unclassified | 4503 |
| 28 | Ga0070692_10021029 | 3300005345 | Bacteria | 3171 |
| 29 | Ga0070669_100008246 | 3300005353 | Bacteria | 7442 |
| 30 | Ga0070675_100094481 | 3300005354 | Bacteria | 2509 |
| 31 | Ga0070675_100295847 | 3300005354 | Bacteria | 1425 |
| 32 | Ga0070675_100337154 | 3300005354 | Bacteria | 1335 |
| 33 | Ga0070675_100570559 | 3300005354 | Bacteria | 1024 |
| 34 | Ga0070671_100157580 | 3300005355 | Unclassified | 1918 |
| 35 | Ga0070667_100203329 | 3300005367 | Bacteria | 1758 |
| 36 | Ga0070667_100342871 | 3300005367 | Bacteria | 1351 |
| 37 | Ga0070701_10044736 | 3300005438 | Bacteria | 2269 |
| 38 | Ga0070701_10063286 | 3300005438 | Bacteria | 1957 |
| 39 | Ga0070701_10094097 | 3300005438 | Unclassified | 1648 |
| 40 | Ga0070701_10210475 | 3300005438 | Bacteria | 1154 |
| 41 | Ga0070705_100132679 | 3300005440 | Unclassified | 1627 |
| 42 | Ga0070705_100205908 | 3300005440 | Bacteria | 1352 |
| 43 | Ga0070700_100003376 | 3300005441 | Bacteria | 8232 |
| 44 | Ga0070700_100033324 | 3300005441 | Unclassified | 3101 |
| 45 | Ga0070700_100046348 | 3300005441 | Bacteria | 2685 |
| 46 | Ga0070700_100052074 | 3300005441 | Bacteria | 2551 |
| 47 | Ga0070700_100093187 | 3300005441 | Unclassified | 1970 |
| 48 | Ga0070694_100030939 | 3300005444 | Bacteria | 3506 |
| 49 | Ga0070694_100118121 | 3300005444 | Bacteria | 1899 |
| 50 | Ga0070694_100227780 | 3300005444 | Unclassified | 1401 |
| 51 | Ga0070694_100378696 | 3300005444 | Unclassified | 1103 |
| 52 | Ga0070694_100416024 | 3300005444 | Unclassified | 1055 |
| 53 | Ga0070708_100015570 | 3300005445 | Bacteria | 6285 |
| 54 | Ga0070708_100372552 | 3300005445 | Bacteria | 1346 |
| 55 | Ga0070708_100763713 | 3300005445 | Bacteria | 909 |
| 56 | Ga0070662_100050413 | 3300005457 | Bacteria | 3003 |
| 57 | Ga0070662_100226391 | 3300005457 | Bacteria | 1494 |
| 58 | Ga0068867_100082686 | 3300005459 | Bacteria | 2423 |
| 59 | Ga0068867_100086858 | 3300005459 | Bacteria | 2367 |
| 60 | Ga0068867_100896181 | 3300005459 | Bacteria | 798 |
| 61 | Ga0070706_100000019 | 3300005467 | Bacteria | 166483 |
| 62 | Ga0070706_100030351 | 3300005467 | Bacteria | 4980 |
| 63 | Ga0070706_100032074 | 3300005467 | Bacteria | 4845 |
| 64 | Ga0070706_100062091 | 3300005467 | Bacteria | 3451 |
| 65 | Ga0070706_100067407 | 3300005467 | Bacteria | 3310 |
| 66 | Ga0070706_100909896 | 3300005467 | Bacteria | 813 |
| 67 | Ga0070707_100115525 | 3300005468 | Bacteria | 2604 |
| 68 | Ga0070707_100297758 | 3300005468 | Unclassified | 1567 |
| 69 | Ga0070707_100454386 | 3300005468 | Bacteria | 1242 |
| 70 | Ga0070698_100011152 | 3300005471 | Bacteria | 9548 |
| 71 | Ga0070698_100032837 | 3300005471 | Bacteria | 5376 |
| 72 | Ga0070698_100046727 | 3300005471 | Bacteria | 4426 |
| 73 | Ga0070698_100092459 | 3300005471 | Bacteria | 3006 |
| 74 | Ga0070698_100425461 | 3300005471 | Bacteria | 1262 |
| 75 | Ga0070699_100023225 | 3300005518 | Bacteria | 5342 |
| 76 | Ga0070699_100104626 | 3300005518 | Unclassified | 2482 |
| 77 | Ga0070699_100565447 | 3300005518 | Bacteria | 1036 |
| 78 | Ga0070679_100148826 | 3300005530 | Bacteria | 2319 |
| 79 | Ga0070697_100000042 | 3300005536 | Bacteria | 94533 |
| 80 | Ga0070697_100007191 | 3300005536 | Bacteria | 8656 |
| 81 | Ga0070697_100027035 | 3300005536 | Bacteria | 4588 |
| 82 | Ga0070697_100040500 | 3300005536 | Bacteria | 3770 |
| 83 | Ga0068853_100011800 | 3300005539 | Bacteria | 7103 |
| 84 | Ga0070672_100079998 | 3300005543 | Bacteria | 2617 |
| 85 | Ga0070686_100052380 | 3300005544 | Bacteria | 2602 |
| 86 | Ga0070695_100014195 | 3300005545 | Bacteria | 4799 |
| 87 | Ga0070695_100111148 | 3300005545 | Unclassified | 1860 |
| 88 | Ga0070695_100160474 | 3300005545 | Bacteria | 1577 |
| 89 | Ga0070695_100282126 | 3300005545 | Bacteria | 1221 |
| 90 | Ga0070696_100014545 | 3300005546 | Bacteria | 5281 |
| 91 | Ga0070696_100119608 | 3300005546 | Unclassified | 1905 |
| 92 | Ga0070696_100194185 | 3300005546 | Bacteria | 1512 |
| 93 | Ga0070696_100307883 | 3300005546 | Bacteria | 1215 |
| 94 | Ga0070693_100009604 | 3300005547 | Unclassified | 4816 |
| 95 | Ga0070693_100018746 | 3300005547 | Bacteria | 3619 |
| 96 | Ga0070693_100090281 | 3300005547 | Bacteria | 1845 |
| 97 | Ga0070665_100039350 | 3300005548 | Bacteria | 4754 |
| 98 | Ga0070704_100042465 | 3300005549 | Bacteria | 3146 |
| 99 | Ga0070704_100067213 | 3300005549 | Bacteria | 2588 |
| 100 | Ga0070704_100124128 | 3300005549 | Bacteria | 1989 |
| 101 | Ga0070704_100166658 | 3300005549 | Unclassified | 1747 |
| 102 | Ga0070704_100321982 | 3300005549 | Unclassified | 1296 |
| 103 | Ga0070704_100604155 | 3300005549 | Bacteria | 964 |
| 104 | Ga0070704_100764925 | 3300005549 | Unclassified | 861 |
| 105 | Ga0070664_100099365 | 3300005564 | Bacteria | 2529 |
| 106 | Ga0070664_100240852 | 3300005564 | Bacteria | 1624 |
| 107 | Ga0068857_100084738 | 3300005577 | Bacteria | 2832 |
| 108 | Ga0068857_100240444 | 3300005577 | Bacteria | 1657 |
| 109 | Ga0068854_100129296 | 3300005578 | Bacteria | 1927 |
| 110 | Ga0068854_100223178 | 3300005578 | Bacteria | 1492 |
| 111 | Ga0068854_100517464 | 3300005578 | Unclassified | 1007 |
| 112 | Ga0070702_100021748 | 3300005615 | Bacteria | 3381 |
| 113 | Ga0070702_100023865 | 3300005615 | Unclassified | 3256 |
| 114 | Ga0070702_100064177 | 3300005615 | Unclassified | 2147 |
| 115 | Ga0068852_100215395 | 3300005616 | Bacteria | 1824 |
| 116 | Ga0068859_100043802 | 3300005617 | Unclassified | 4498 |
| 117 | Ga0068859_100059139 | 3300005617 | Bacteria | 3861 |
| 118 | Ga0068859_100104769 | 3300005617 | Bacteria | 2888 |
| 119 | Ga0068859_100124202 | 3300005617 | Bacteria | 2649 |
| 120 | Ga0068859_100246201 | 3300005617 | Bacteria | 1877 |
| 121 | Ga0068859_100249193 | 3300005617 | Bacteria | 1866 |
| 122 | Ga0068859_100348615 | 3300005617 | Unclassified | 1575 |
| 123 | Ga0068859_100494730 | 3300005617 | Unclassified | 1318 |
| 124 | Ga0068859_100760263 | 3300005617 | Bacteria | 1058 |
| 125 | Ga0068864_100006010 | 3300005618 | Bacteria | 9965 |
| 126 | Ga0068864_100024548 | 3300005618 | Bacteria | 5072 |
| 127 | Ga0068864_100046596 | 3300005618 | Bacteria | 3720 |
| 128 | Ga0068864_100444281 | 3300005618 | Bacteria | 1239 |
| 129 | Ga0068864_100445520 | 3300005618 | Bacteria | 1238 |
| 130 | Ga0068864_100928214 | 3300005618 | Bacteria | 860 |
| 131 | Ga0068861_100015826 | 3300005719 | Bacteria | 5325 |
| 132 | Ga0068861_100029238 | 3300005719 | Bacteria | 4030 |
| 133 | Ga0068861_100074211 | 3300005719 | Bacteria | 2644 |
| 134 | Ga0068851_10002663 | 3300005834 | Bacteria | 7869 |
| 135 | Ga0068870_10018105 | 3300005840 | Unclassified | 3396 |
| 136 | Ga0068870_10021603 | 3300005840 | Unclassified | 3151 |
| 137 | Ga0068870_10106633 | 3300005840 | Bacteria | 1593 |
| 138 | Ga0068870_10223277 | 3300005840 | Bacteria | 1154 |
| 139 | Ga0068863_100422890 | 3300005841 | Bacteria | 1305 |
| 140 | Ga0068858_100024283 | 3300005842 | Bacteria | 5649 |
| 141 | Ga0068858_100066756 | 3300005842 | Bacteria | 3331 |
| 142 | Ga0068858_100137713 | 3300005842 | Bacteria | 2291 |
| 143 | Ga0068858_100164594 | 3300005842 | Bacteria | 2090 |
| 144 | Ga0068860_100037258 | 3300005843 | Unclassified | 4655 |
| 145 | Ga0068860_100078909 | 3300005843 | Bacteria | 3131 |
| 146 | Ga0068860_100237076 | 3300005843 | Bacteria | 1774 |
| 147 | Ga0068860_100281445 | 3300005843 | Bacteria | 1625 |
| 148 | Ga0068862_100027762 | 3300005844 | Bacteria | 4765 |
| 149 | Ga0068862_100438480 | 3300005844 | Bacteria | 1229 |
| 150 | Ga0081539_10000360 | 3300005985 | Bacteria | 100156 |
| 151 | Ga0081539_10000669 | 3300005985 | Bacteria | 68738 |
| 152 | Ga0097621_100003835 | 3300006237 | Bacteria | 10413 |
| 153 | Ga0068871_100029981 | 3300006358 | Bacteria | 4279 |
| 154 | Ga0068871_100228178 | 3300006358 | Unclassified | 1615 |
| 155 | Ga0068871_100332210 | 3300006358 | Bacteria | 1341 |
| 156 | Ga0075428_100145235 | 3300006844 | Unclassified | 2578 |
| 157 | Ga0075430_100062246 | 3300006846 | Bacteria | 3135 |
| 158 | Ga0075430_100623740 | 3300006846 | Unclassified | 889 |
| 159 | Ga0075430_100623741 | 3300006846 | Unclassified | 889 |
| 160 | Ga0075431_100139659 | 3300006847 | Bacteria | 2498 |
| 161 | Ga0075433_10010620 | 3300006852 | Bacteria | 7403 |
| 162 | Ga0075433_10069700 | 3300006852 | Bacteria | 3089 |
| 163 | Ga0075434_100050025 | 3300006871 | Bacteria | 4151 |
| 164 | Ga0075434_100080948 | 3300006871 | Bacteria | 3244 |
| 165 | Ga0075429_100063450 | 3300006880 | Bacteria | 3218 |
| 166 | Ga0075429_100067871 | 3300006880 | Bacteria | 3104 |
| 167 | Ga0068865_100005713 | 3300006881 | Bacteria | 7561 |
| 168 | Ga0068865_100049198 | 3300006881 | Unclassified | 2904 |
| 169 | Ga0068865_100136679 | 3300006881 | Bacteria | 1843 |
| 170 | Ga0068865_100211868 | 3300006881 | Bacteria | 1510 |
| 171 | Ga0097620_100043803 | 3300006931 | Unclassified | 4498 |
| 172 | Ga0097620_100059141 | 3300006931 | Bacteria | 3861 |
| 173 | Ga0097620_100076976 | 3300006931 | Bacteria | 3376 |
| 174 | Ga0097620_100104771 | 3300006931 | Bacteria | 2888 |
| 175 | Ga0097620_100124195 | 3300006931 | Bacteria | 2649 |
| 176 | Ga0097620_100246198 | 3300006931 | Bacteria | 1877 |
| 177 | Ga0097620_100249199 | 3300006931 | Bacteria | 1866 |
| 178 | Ga0097620_100348599 | 3300006931 | Unclassified | 1575 |
| 179 | Ga0097620_100494736 | 3300006931 | Unclassified | 1318 |
| 180 | Ga0097620_100760233 | 3300006931 | Bacteria | 1058 |
| 181 | Ga0075435_100005170 | 3300007076 | Bacteria | 9075 |
| 182 | Ga0075435_100069875 | 3300007076 | Bacteria | 2865 |
| 183 | Ga0099794_10168414 | 3300007265 | Bacteria | 1116 |
| 184 | Ga0105251_10076827 | 3300009011 | Bacteria | 1549 |
| 185 | Ga0111539_10021005 | 3300009094 | Bacteria | 8039 |
| 186 | Ga0111539_10458319 | 3300009094 | Unclassified | 1485 |
| 187 | Ga0111539_10561924 | 3300009094 | Bacteria | 1329 |
| 188 | Ga0105245_10063460 | 3300009098 | Bacteria | 3335 |
| 189 | Ga0105247_10020574 | 3300009101 | Bacteria | 3967 |
| 190 | Ga0105247_10099523 | 3300009101 | Bacteria | 1857 |
| 191 | Ga0105247_10506859 | 3300009101 | Bacteria | 880 |
| 192 | Ga0114129_10004845 | 3300009147 | Bacteria | 19000 |
| 193 | Ga0114129_10007705 | 3300009147 | Bacteria | 15323 |
| 194 | Ga0114129_10010635 | 3300009147 | Bacteria | 13125 |
| 195 | Ga0114129_10014212 | 3300009147 | Bacteria | 11343 |
| 196 | Ga0114129_10015657 | 3300009147 | Bacteria | 10784 |
| 197 | Ga0114129_10085804 | 3300009147 | Bacteria | 4367 |
| 198 | Ga0114129_10210834 | 3300009147 | Unclassified | 2626 |
| 199 | Ga0114129_10211037 | 3300009147 | Unclassified | 2625 |
| 200 | Ga0114129_10262468 | 3300009147 | Bacteria | 2314 |
| 201 | Ga0114129_10533761 | 3300009147 | Bacteria | 1528 |
| 202 | Ga0114129_10652162 | 3300009147 | Bacteria | 1358 |
| 203 | Ga0114129_10888694 | 3300009147 | Bacteria | 1130 |
| 204 | Ga0105243_10060344 | 3300009148 | Bacteria | 3030 |
| 205 | Ga0105241_10010731 | 3300009174 | Bacteria | 6724 |
| 206 | Ga0105241_10074489 | 3300009174 | Bacteria | 2644 |
| 207 | Ga0105241_10308966 | 3300009174 | Bacteria | 1359 |
| 208 | Ga0105241_10429938 | 3300009174 | Unclassified | 1164 |
| 209 | Ga0105242_10026849 | 3300009176 | Bacteria | 4566 |
| 210 | Ga0105242_10069534 | 3300009176 | Bacteria | 2916 |
| 211 | Ga0105248_10011605 | 3300009177 | Bacteria | 9705 |
| 212 | Ga0105248_10169486 | 3300009177 | Bacteria | 2461 |
| 213 | Ga0105237_10002569 | 3300009545 | Bacteria | 22400 |
| 214 | Ga0105237_10093543 | 3300009545 | Unclassified | 2995 |
| 215 | Ga0105238_10003652 | 3300009551 | Bacteria | 15343 |
| 216 | Ga0105238_10137717 | 3300009551 | Bacteria | 2419 |
| 217 | Ga0105249_10056024 | 3300009553 | Bacteria | 3609 |
| 218 | Ga0105249_10134878 | 3300009553 | Bacteria | 2361 |
| 219 | Ga0105249_10148179 | 3300009553 | Bacteria | 2257 |
| 220 | Ga0105249_10212086 | 3300009553 | Unclassified | 1901 |
| 221 | Ga0105249_10910486 | 3300009553 | Bacteria | 947 |
| 222 | Ga0105239_10305649 | 3300010375 | Bacteria | 1791 |
| 223 | Ga0105239_10344289 | 3300010375 | Bacteria | 1683 |
| 224 | Ga0105239_10349670 | 3300010375 | Bacteria | 1669 |
| 225 | Ga0105239_11187297 | 3300010375 | Unclassified | 879 |
| 226 | Ga0105246_10034179 | 3300011119 | Bacteria | 3385 |
| 227 | Ga0157373_10006382 | 3300013100 | Bacteria | 8809 |
| 228 | Ga0157373_10017305 | 3300013100 | Bacteria | 5248 |
| 229 | Ga0157373_10050745 | 3300013100 | Unclassified | 2954 |
| 230 | Ga0157374_10036630 | 3300013296 | Bacteria | 4495 |
| 231 | Ga0157378_10005142 | 3300013297 | Bacteria | 11487 |
| 232 | Ga0157378_10068435 | 3300013297 | Bacteria | 3184 |
| 233 | Ga0157378_10147631 | 3300013297 | Bacteria | 2189 |
| 234 | Ga0163162_10001625 | 3300013306 | Bacteria | 21041 |
| 235 | Ga0163162_10020033 | 3300013306 | Bacteria | 6569 |
| 236 | Ga0163162_10023577 | 3300013306 | Bacteria | 6075 |
| 237 | Ga0163162_10061722 | 3300013306 | Unclassified | 3786 |
| 238 | Ga0163162_10080872 | 3300013306 | Bacteria | 3318 |
| 239 | Ga0163162_10156215 | 3300013306 | Bacteria | 2401 |
| 240 | Ga0163162_10396065 | 3300013306 | Bacteria | 1513 |
| 241 | Ga0163162_10523182 | 3300013306 | Bacteria | 1315 |
| 242 | Ga0157372_10027292 | 3300013307 | Bacteria | 6217 |
| 243 | Ga0157375_10004457 | 3300013308 | Bacteria | 12159 |
| 244 | Ga0157375_10127211 | 3300013308 | Unclassified | 2664 |
| 245 | Ga0157375_10219955 | 3300013308 | Bacteria | 2057 |
| 246 | Ga0163163_10000536 | 3300014325 | Bacteria | 33560 |
| 247 | Ga0163163_10003037 | 3300014325 | Bacteria | 14218 |
| 248 | Ga0163163_10013448 | 3300014325 | Bacteria | 7496 |
| 249 | Ga0163163_10046876 | 3300014325 | Bacteria | 4246 |
| 250 | Ga0163163_10079504 | 3300014325 | Unclassified | 3277 |
| 251 | Ga0163163_10097825 | 3300014325 | Bacteria | 2955 |
| 252 | Ga0163163_10308593 | 3300014325 | Bacteria | 1635 |
| 253 | Ga0157380_10002430 | 3300014326 | Bacteria | 12552 |
| 254 | Ga0157380_10011474 | 3300014326 | Bacteria | 6405 |
| 255 | Ga0157380_10075729 | 3300014326 | Bacteria | 2736 |
| 256 | Ga0157380_10084312 | 3300014326 | Bacteria | 2605 |
| 257 | Ga0157380_10170631 | 3300014326 | Unclassified | 1901 |
| 258 | Ga0157377_10007731 | 3300014745 | Bacteria | 5206 |
| 259 | Ga0157377_10082711 | 3300014745 | Unclassified | 1880 |
| 260 | Ga0157377_10119005 | 3300014745 | Bacteria | 1598 |
| 261 | Ga0157376_10087853 | 3300014969 | Bacteria | 2684 |
| 262 | Ga0157376_10654161 | 3300014969 | Unclassified | 1052 |
| 263 | Ga0163161_10039753 | 3300017792 | Bacteria | 3378 |
| 264 | Ga0213876_10016872 | 3300021384 | Bacteria | 3858 |
| 265 | Ga0207656_10004814 | 3300025321 | Bacteria | 4736 |
| 266 | Ga0207653_10002658 | 3300025885 | Bacteria | 5672 |
| 267 | Ga0207710_10003361 | 3300025900 | Bacteria | 7151 |
| 268 | Ga0207680_10064868 | 3300025903 | Unclassified | 2240 |
| 269 | Ga0207647_10202851 | 3300025904 | Bacteria | 1147 |
| 270 | Ga0207643_10055316 | 3300025908 | Bacteria | 2257 |
| 271 | Ga0207684_10000079 | 3300025910 | Bacteria | 179842 |
| 272 | Ga0207684_10011978 | 3300025910 | Bacteria | 7552 |
| 273 | Ga0207684_10049450 | 3300025910 | Bacteria | 3566 |
| 274 | Ga0207707_10097478 | 3300025912 | Bacteria | 2570 |
| 275 | Ga0207707_10156521 | 3300025912 | Bacteria | 1993 |
| 276 | Ga0207671_10003041 | 3300025914 | Bacteria | 17169 |
| 277 | Ga0207660_10015697 | 3300025917 | Bacteria | 5002 |
| 278 | Ga0207662_10029931 | 3300025918 | Bacteria | 3157 |
| 279 | Ga0207662_10058218 | 3300025918 | Unclassified | 2312 |
| 280 | Ga0207662_10137613 | 3300025918 | Bacteria | 1545 |
| 281 | Ga0207662_10254878 | 3300025918 | Bacteria | 1153 |
| 282 | Ga0207662_10465033 | 3300025918 | Bacteria | 867 |
| 283 | Ga0207646_10040681 | 3300025922 | Unclassified | 4179 |
| 284 | Ga0207646_10101272 | 3300025922 | Bacteria | 2582 |
| 285 | Ga0207646_10110864 | 3300025922 | Unclassified | 2462 |
| 286 | Ga0207681_10005287 | 3300025923 | Bacteria | 7932 |
| 287 | Ga0207681_10067150 | 3300025923 | Bacteria | 2485 |
| 288 | Ga0207694_10002743 | 3300025924 | Bacteria | 14239 |
| 289 | Ga0207650_10000001 | 3300025925 | Bacteria | 1545726 |
| 290 | Ga0207650_10000511 | 3300025925 | Bacteria | 32409 |
| 291 | Ga0207650_10106643 | 3300025925 | Bacteria | 2164 |
| 292 | Ga0207650_10237666 | 3300025925 | Bacteria | 1471 |
| 293 | Ga0207650_10391903 | 3300025925 | Unclassified | 1148 |
| 294 | Ga0207659_10321703 | 3300025926 | Bacteria | 1276 |
| 295 | Ga0207659_10603334 | 3300025926 | Unclassified | 936 |
| 296 | Ga0207644_10013351 | 3300025931 | Bacteria | 5475 |
| 297 | Ga0207644_10043332 | 3300025931 | Bacteria | 3193 |
| 298 | Ga0207690_10200137 | 3300025932 | Bacteria | 1516 |
| 299 | Ga0207706_10123703 | 3300025933 | Bacteria | 2275 |
| 300 | Ga0207706_10175161 | 3300025933 | Bacteria | 1884 |
| 301 | Ga0207706_10289353 | 3300025933 | Bacteria | 1428 |
| 302 | Ga0207686_10021258 | 3300025934 | Unclassified | 3721 |
| 303 | Ga0207709_10080448 | 3300025935 | Bacteria | 2098 |
| 304 | Ga0207709_10325681 | 3300025935 | Bacteria | 1152 |
| 305 | Ga0207670_10113012 | 3300025936 | Bacteria | 1961 |
| 306 | Ga0207704_10007125 | 3300025938 | Bacteria | 5263 |
| 307 | Ga0207704_10092231 | 3300025938 | Bacteria | 1993 |
| 308 | Ga0207704_10216569 | 3300025938 | Bacteria | 1414 |
| 309 | Ga0207704_10326561 | 3300025938 | Bacteria | 1186 |
| 310 | Ga0207665_10006407 | 3300025939 | Bacteria | 7809 |
| 311 | Ga0207691_10011463 | 3300025940 | Bacteria | 8506 |
| 312 | Ga0207691_10124447 | 3300025940 | Bacteria | 2282 |
| 313 | Ga0207711_10036697 | 3300025941 | Bacteria | 4160 |
| 314 | Ga0207711_10186560 | 3300025941 | Bacteria | 1888 |
| 315 | Ga0207711_10834199 | 3300025941 | Bacteria | 858 |
| 316 | Ga0207689_10002487 | 3300025942 | Bacteria | 17116 |
| 317 | Ga0207689_10004823 | 3300025942 | Bacteria | 12164 |
| 318 | Ga0207689_10038757 | 3300025942 | Bacteria | 3945 |
| 319 | Ga0207689_10090788 | 3300025942 | Unclassified | 2510 |
| 320 | Ga0207689_10102581 | 3300025942 | Bacteria | 2350 |
| 321 | Ga0207689_10110925 | 3300025942 | Bacteria | 2254 |
| 322 | Ga0207689_10426443 | 3300025942 | Unclassified | 1107 |
| 323 | Ga0207679_10178178 | 3300025945 | Unclassified | 1756 |
| 324 | Ga0207679_10320548 | 3300025945 | Bacteria | 1342 |
| 325 | Ga0207651_10581725 | 3300025960 | Bacteria | 977 |
| 326 | Ga0207712_10018383 | 3300025961 | Unclassified | 4552 |
| 327 | Ga0207712_10068783 | 3300025961 | Bacteria | 2539 |
| 328 | Ga0207712_10069521 | 3300025961 | Bacteria | 2526 |
| 329 | Ga0207712_10271117 | 3300025961 | Bacteria | 1381 |
| 330 | Ga0207712_10273087 | 3300025961 | Bacteria | 1376 |
| 331 | Ga0207668_10357950 | 3300025972 | Bacteria | 1222 |
| 332 | Ga0207640_10600158 | 3300025981 | Bacteria | 932 |
| 333 | Ga0207658_10062360 | 3300025986 | Unclassified | 2790 |
| 334 | Ga0207658_10175653 | 3300025986 | Bacteria | 1769 |
| 335 | Ga0207658_10265725 | 3300025986 | Bacteria | 1464 |
| 336 | Ga0207677_10048232 | 3300026023 | Bacteria | 2866 |
| 337 | Ga0207677_10280532 | 3300026023 | Bacteria | 1367 |
| 338 | Ga0207703_10019071 | 3300026035 | Bacteria | 5358 |
| 339 | Ga0207703_10091730 | 3300026035 | Unclassified | 2556 |
| 340 | Ga0207703_10402884 | 3300026035 | Bacteria | 1270 |
| 341 | Ga0207703_10578349 | 3300026035 | Bacteria | 1061 |
| 342 | Ga0207639_10349526 | 3300026041 | Bacteria | 1320 |
| 343 | Ga0207678_10151372 | 3300026067 | Bacteria | 1981 |
| 344 | Ga0207708_10000453 | 3300026075 | Bacteria | 31845 |
| 345 | Ga0207708_10006841 | 3300026075 | Bacteria | 8434 |
| 346 | Ga0207641_10031090 | 3300026088 | Bacteria | 4426 |
| 347 | Ga0207641_10470947 | 3300026088 | Bacteria | 1216 |
| 348 | Ga0207648_10121392 | 3300026089 | Bacteria | 2298 |
| 349 | Ga0207648_10775382 | 3300026089 | Bacteria | 891 |
| 350 | Ga0207676_10002604 | 3300026095 | Bacteria | 12861 |
| 351 | Ga0207676_10008472 | 3300026095 | Bacteria | 7310 |
| 352 | Ga0207676_10008972 | 3300026095 | Bacteria | 7115 |
| 353 | Ga0207676_10235118 | 3300026095 | Bacteria | 1640 |
| 354 | Ga0207676_10292746 | 3300026095 | Unclassified | 1483 |
| 355 | Ga0207676_10697549 | 3300026095 | Bacteria | 983 |
| 356 | Ga0207674_10082868 | 3300026116 | Bacteria | 3207 |
| 357 | Ga0207675_100020124 | 3300026118 | Bacteria | 6224 |
| 358 | Ga0207675_100029273 | 3300026118 | Bacteria | 5131 |
| 359 | Ga0207675_100059018 | 3300026118 | Bacteria | 3581 |
| 360 | Ga0207675_100059492 | 3300026118 | Bacteria | 3565 |
| 361 | Ga0207675_100059905 | 3300026118 | Bacteria | 3553 |
| 362 | Ga0207675_100114790 | 3300026118 | Bacteria | 2544 |
| 363 | Ga0207675_100476969 | 3300026118 | Bacteria | 1239 |
| 364 | Ga0207698_10095712 | 3300026142 | Unclassified | 2445 |
| 365 | Ga0207698_10122011 | 3300026142 | Bacteria | 2208 |
| 366 | Ga0207698_10477281 | 3300026142 | Bacteria | 1209 |
| 367 | Ga0207428_10075967 | 3300027907 | Unclassified | 2632 |
| 368 | Ga0268265_10080866 | 3300028380 | Bacteria | 2564 |
| 369 | Ga0268265_10119660 | 3300028380 | Bacteria | 2167 |
| 370 | Ga0268264_10119148 | 3300028381 | Bacteria | 2324 |
| 371 | Ga0268264_10156855 | 3300028381 | Bacteria | 2046 |
| 372 | Ga0268264_10171815 | 3300028381 | Bacteria | 1961 |
| 373 | Ga0268264_10194243 | 3300028381 | Unclassified | 1852 |
| 374 | Ga0268264_10345475 | 3300028381 | Bacteria | 1415 |
| 375 | Ga0307515_10137599 | 3300028794 | Bacteria | 2643 |
| 376 | Ga0307408_100010929 | 3300031548 | Bacteria | 5991 |
| 377 | Ga0307405_10069114 | 3300031731 | Bacteria | 2263 |
| 378 | Ga0307405_10101601 | 3300031731 | Bacteria | 1930 |
| 379 | Ga0307406_10269305 | 3300031901 | Bacteria | 1293 |
| 380 | Ga0307412_10062144 | 3300031911 | Bacteria | 2513 |
| 381 | Ga0307412_10158436 | 3300031911 | Bacteria | 1679 |
| 382 | Ga0307416_100063013 | 3300032002 | Bacteria | 3034 |
| 383 | Ga0307416_100677046 | 3300032002 | Bacteria | 1119 |
| 384 | Ga0307414_10028619 | 3300032004 | Unclassified | 3616 |
| 385 | Ga0307411_10004380 | 3300032005 | Bacteria | 6753 |
| 386 | Ga0307411_10054741 | 3300032005 | Bacteria | 2621 |
| 387 | Ga0307411_10694280 | 3300032005 | Bacteria | 886 |
| 388 | Ga0373951_0003998 | 3300035091 | Bacteria | 3538 |
| 389 | Ga0373931_0090599 | 3300035691 | Bacteria | 1703 |
| 390 | Ga0373937_0211268 | 3300036401 | Bacteria | 1826 |
| 391 | Ga0395900_0106164 | 3300037418 | Bacteria | 2885 |
| 392 | Ga0395905_0081626 | 3300037471 | Bacteria | 3030 |
| 393 | Ga0395901_0477537 | 3300038443 | Bacteria | 1272 |
| 394 | Ga0436365_0325727 | 3300039437 | Bacteria | 10237 |
| 395 | Ga0436365_1023949 | 3300039437 | Bacteria | 126686 |
| 396 | Ga0450889_003585 | 3300042144 | Bacteria | 1533 |
| 397 | Ga0439446_0019691 | 3300042156 | Bacteria | 1898 |
| 398 | Ga0439458_0001971 | 3300042157 | Bacteria | 5091 |
| 399 | Ga0495580_0089521 | 3300046472 | Unclassified | 2143 |
| 400 | Ga0495632_0012621 | 3300046519 | Bacteria | 4864 |
| 401 | Ga0495636_0065896 | 3300047318 | Bacteria | 1539 |
| 402 | Ga0495672_0009111 | 3300047320 | Bacteria | 7237 |
| 403 | Ga0496102_0016105 | 3300048905 | Bacteria | 6529 |
| 404 | Ga0496103_0006385 | 3300048906 | Bacteria | 7044 |
| 405 | Ga0496106_0024733 | 3300048909 | Bacteria | 4466 |
| 406 | Ga0496108_0087919 | 3300048911 | Bacteria | 2640 |
| 407 | Ga0496108_0114793 | 3300048911 | Bacteria | 2306 |
| 408 | Ga0496110_0186383 | 3300048913 | Bacteria | 1884 |
| 409 | Ga0496112_0060757 | 3300048915 | Unclassified | 3725 |
| 410 | Ga0496112_0198225 | 3300048915 | Bacteria | 1968 |
| 411 | Ga0496112_0201026 | 3300048915 | Bacteria | 1952 |
| 412 | Ga0496112_0238658 | 3300048915 | Bacteria | 1771 |
| 413 | Ga0496112_0857860 | 3300048915 | Bacteria | 831 |
| 414 | Ga0496113_0093515 | 3300048916 | Bacteria | 2321 |
| 415 | Ga0496113_0410750 | 3300048916 | Bacteria | 1087 |
| 416 | Ga0501038_0002878 | 3300049574 | Bacteria | 16052 |
| 417 | Ga0501041_0234704 | 3300049577 | Bacteria | 1152 |
| 418 | Ga0501076_0094708 | 3300049592 | Unclassified | 2405 |
| 419 | Ga0501077_0301575 | 3300049593 | Bacteria | 1021 |
| 420 | Ga0501198_002784 | 3300049649 | Unclassified | 2368 |
| 421 | Ga0501198_004151 | 3300049649 | Bacteria | 2003 |
| 422 | Ga0501202_001439 | 3300049652 | Bacteria | 3822 |
| 423 | Ga0501216_030648 | 3300049660 | Unclassified | 991 |
| 424 | Ga0501217_000505 | 3300049661 | Bacteria | 6463 |
| 425 | Ga0501217_022189 | 3300049661 | Unclassified | 1504 |
| 426 | Ga0501223_008050 | 3300049663 | Bacteria | 2150 |
| 427 | Ga0501224_004302 | 3300049664 | Unclassified | 2019 |
| 428 | Ga0501227_001151 | 3300049665 | Bacteria | 5913 |
| 429 | Ga0501228_005642 | 3300049666 | Bacteria | 1115 |
| 430 | Ga0501230_005991 | 3300049667 | Bacteria | 1746 |
| 431 | Ga0501233_005176 | 3300049668 | Bacteria | 2415 |
| 432 | Ga0501235_007561 | 3300049669 | Bacteria | 2365 |
| 433 | Ga0501243_014990 | 3300049675 | Bacteria | 1243 |
| 434 | Ga0501249_005074 | 3300049679 | Unclassified | 2689 |
| 435 | Ga0501251_001493 | 3300049681 | Bacteria | 2192 |
| 436 | Ga0501257_017396 | 3300049686 | Unclassified | 1672 |
| 437 | Ga0501221_009940 | 3300049704 | Unclassified | 1679 |
| 438 | Ga0501225_0002080 | 3300049705 | Bacteria | 6222 |
| 439 | Ga0501225_0014167 | 3300049705 | Bacteria | 2228 |
| 440 | Ga0501225_0046312 | 3300049705 | Bacteria | 1205 |
| 441 | Ga0501229_006358 | 3300049706 | Bacteria | 1460 |
| 442 | Ga0501234_002592 | 3300049707 | Bacteria | 2847 |
| 443 | Ga0501268_007995 | 3300049765 | Unclassified | 1590 |
| 444 | Ga0501273_007057 | 3300049770 | Unclassified | 1315 |
| 445 | Ga0501273_016108 | 3300049770 | Unclassified | 976 |
| 446 | Ga0501279_021114 | 3300049775 | Unclassified | 929 |
| 447 | Ga0501212_023737 | 3300049851 | Unclassified | 962 |
| 448 | Ga0501226_002243 | 3300049853 | Bacteria | 2384 |
| 449 | nmdc:mga05p37_118214_c1 | 3300050507 | Bacteria | 3257 |
| 450 | nmdc:mga05p37_210337_c1 | 3300050507 | Unclassified | 2352 |
| 451 | nmdc:mga05p37_560834_c1 | 3300050507 | Unclassified | 1298 |
| 452 | nmdc:mga05p37_72732_c1 | 3300050507 | Bacteria | 4231 |
| 453 | nmdc:mga09592_63188_c1 | 3300050508 | Bacteria | 3133 |
| 454 | nmdc:mga0qj67_50805_c1 | 3300050509 | Bacteria | 3279 |
| 455 | nmdc:mga0qj67_577204_c1 | 3300050509 | Unclassified | 901 |
| 456 | nmdc:mga0qj67_597210_c1 | 3300050509 | Unclassified | 883 |
| 457 | nmdc:mga08y16_160984_c1 | 3300050511 | Unclassified | 2332 |
| 458 | nmdc:mga08y16_18914_c1 | 3300050511 | Bacteria | 7253 |
| 459 | nmdc:mga08y16_9954_c1 | 3300050511 | Bacteria | 9981 |
| 460 | nmdc:mga0n895_243120_c1 | 3300050512 | Bacteria | 1827 |
| 461 | nmdc:mga0n895_59619_c1 | 3300050512 | Bacteria | 3765 |
| 462 | nmdc:mga0rr50_146662_c1 | 3300050513 | Bacteria | 1903 |
| 463 | nmdc:mga0a205_23175_c1 | 3300050515 | Bacteria | 5888 |
| 464 | nmdc:mga0a205_419483_c1 | 3300050515 | Bacteria | 1200 |
| 465 | nmdc:mga0a205_43333_c1 | 3300050515 | Bacteria | 4339 |
| 466 | nmdc:mga0a205_86764_c1 | 3300050515 | Bacteria | 3023 |
| 467 | Ga0500616_0001248 | 3300053153 | Bacteria | 25475 |
| 468 | Ga0530510_0045465 | 3300061734 | Bacteria | 3172 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006852 | Ga0075433_10069700 | Ga0075433_100697002 | 223 |
| 2 | 3300006871 | Ga0075434_100080948 | Ga0075434_1000809484 | 223 |
| 3 | 3300005293 | Ga0065715_10174730 | Ga0065715_101747303 | 233 |
| 4 | 3300005617 | Ga0068859_100246201 | Ga0068859_1002462012 | 233 |
| 5 | 3300006931 | Ga0097620_100246198 | Ga0097620_1002461982 | 233 |
| 6 | 3300009101 | Ga0105247_10020574 | Ga0105247_100205742 | 233 |
| 7 | 3300025900 | Ga0207710_10003361 | Ga0207710_100033612 | 233 |
| 8 | 3300025918 | Ga0207662_10137613 | Ga0207662_101376134 | 233 |
| 9 | 3300026035 | Ga0207703_10091730 | Ga0207703_100917304 | 233 |
| 10 | 3300026041 | Ga0207639_10349526 | Ga0207639_103495261 | 233 |
| 11 | 3300028381 | Ga0268264_10194243 | Ga0268264_101942433 | 233 |
| 12 | 3300005719 | Ga0068861_100029238 | Ga0068861_1000292383 | 236 |
| 13 | 3300026118 | Ga0207675_100029273 | Ga0207675_1000292734 | 236 |
| 14 | 3300005577 | Ga0068857_100084738 | Ga0068857_1000847383 | 238 |
| 15 | 3300037471 | Ga0395905_0081626 | Ga0395905_0081626_1781_2497 | 238 |
| 16 | 3300049661 | Ga0501217_022189 | Ga0501217_022189_25_792 | 239 |
| 17 | 3300005547 | Ga0070693_100018746 | Ga0070693_1000187464 | 240 |
| 18 | 3300005549 | Ga0070704_100067213 | Ga0070704_1000672133 | 240 |
| 19 | 3300049705 | Ga0501225_0014167 | Ga0501225_0014167_1188_1955 | 240 |
| 20 | 3300005445 | Ga0070708_100372552 | Ga0070708_1003725522 | 241 |
| 21 | 3300025922 | Ga0207646_10101272 | Ga0207646_101012723 | 241 |
| 22 | 3300005467 | Ga0070706_100032074 | Ga0070706_1000320743 | 242 |
| 23 | 3300005468 | Ga0070707_100115525 | Ga0070707_1001155253 | 242 |
| 24 | 3300005471 | Ga0070698_100092459 | Ga0070698_1000924593 | 242 |
| 25 | 3300005536 | Ga0070697_100040500 | Ga0070697_1000405003 | 242 |
| 26 | 3300005545 | Ga0070695_100160474 | Ga0070695_1001604742 | 242 |
| 27 | 3300005549 | Ga0070704_100166658 | Ga0070704_1001666583 | 242 |
| 28 | 3300025942 | Ga0207689_10038757 | Ga0207689_100387575 | 242 |
| 29 | 3300025945 | Ga0207679_10320548 | Ga0207679_103205481 | 242 |
| 30 | 3300047320 | Ga0495672_0009111 | Ga0495672_0009111_5527_6276 | 244 |
| 31 | 3300005471 | Ga0070698_100425461 | Ga0070698_1004254611 | 245 |
| 32 | 3300007076 | Ga0075435_100005170 | Ga0075435_1000051707 | 245 |
| 33 | 3300009147 | Ga0114129_10652162 | Ga0114129_106521621 | 245 |
| 34 | 3300005338 | Ga0068868_100160700 | Ga0068868_1001607002 | 246 |
| 35 | 3300005345 | Ga0070692_10008884 | Ga0070692_100088843 | 246 |
| 36 | 3300005354 | Ga0070675_100337154 | Ga0070675_1003371542 | 246 |
| 37 | 3300005438 | Ga0070701_10210475 | Ga0070701_102104751 | 246 |
| 38 | 3300005441 | Ga0070700_100093187 | Ga0070700_1000931872 | 246 |
| 39 | 3300005444 | Ga0070694_100030939 | Ga0070694_1000309392 | 246 |
| 40 | 3300005467 | Ga0070706_100909896 | Ga0070706_1009098961 | 246 |
| 41 | 3300005471 | Ga0070698_100046727 | Ga0070698_1000467272 | 246 |
| 42 | 3300005518 | Ga0070699_100023225 | Ga0070699_1000232252 | 246 |
| 43 | 3300005530 | Ga0070679_100148826 | Ga0070679_1001488261 | 246 |
| 44 | 3300005539 | Ga0068853_100011800 | Ga0068853_1000118005 | 246 |
| 45 | 3300005545 | Ga0070695_100111148 | Ga0070695_1001111482 | 246 |
| 46 | 3300005547 | Ga0070693_100009604 | Ga0070693_1000096044 | 246 |
| 47 | 3300005549 | Ga0070704_100124128 | Ga0070704_1001241282 | 246 |
| 48 | 3300005549 | Ga0070704_100764925 | Ga0070704_1007649251 | 246 |
| 49 | 3300005577 | Ga0068857_100240444 | Ga0068857_1002404442 | 246 |
| 50 | 3300005578 | Ga0068854_100129296 | Ga0068854_1001292963 | 246 |
| 51 | 3300005617 | Ga0068859_100348615 | Ga0068859_1003486152 | 246 |
| 52 | 3300005618 | Ga0068864_100024548 | Ga0068864_1000245484 | 246 |
| 53 | 3300005618 | Ga0068864_100445520 | Ga0068864_1004455202 | 246 |
| 54 | 3300005834 | Ga0068851_10002663 | Ga0068851_100026634 | 246 |
| 55 | 3300005842 | Ga0068858_100164594 | Ga0068858_1001645941 | 246 |
| 56 | 3300005843 | Ga0068860_100078909 | Ga0068860_1000789092 | 246 |
| 57 | 3300006846 | Ga0075430_100623740 | Ga0075430_1006237401 | 246 |
| 58 | 3300006846 | Ga0075430_100623741 | Ga0075430_1006237411 | 246 |
| 59 | 3300006847 | Ga0075431_100139659 | Ga0075431_1001396593 | 246 |
| 60 | 3300006852 | Ga0075433_10010620 | Ga0075433_100106203 | 246 |
| 61 | 3300006880 | Ga0075429_100063450 | Ga0075429_1000634501 | 246 |
| 62 | 3300006881 | Ga0068865_100005713 | Ga0068865_10000571310 | 246 |
| 63 | 3300006931 | Ga0097620_100076976 | Ga0097620_1000769766 | 246 |
| 64 | 3300006931 | Ga0097620_100348599 | Ga0097620_1003485992 | 246 |
| 65 | 3300009011 | Ga0105251_10076827 | Ga0105251_100768272 | 246 |
| 66 | 3300009101 | Ga0105247_10099523 | Ga0105247_100995233 | 246 |
| 67 | 3300009147 | Ga0114129_10085804 | Ga0114129_100858044 | 246 |
| 68 | 3300009147 | Ga0114129_10888694 | Ga0114129_108886941 | 246 |
| 69 | 3300009148 | Ga0105243_10060344 | Ga0105243_100603444 | 246 |
| 70 | 3300009174 | Ga0105241_10308966 | Ga0105241_103089663 | 246 |
| 71 | 3300009174 | Ga0105241_10429938 | Ga0105241_104299381 | 246 |
| 72 | 3300009177 | Ga0105248_10169486 | Ga0105248_101694863 | 246 |
| 73 | 3300009545 | Ga0105237_10002569 | Ga0105237_100025698 | 246 |
| 74 | 3300009553 | Ga0105249_10056024 | Ga0105249_100560244 | 246 |
| 75 | 3300010375 | Ga0105239_11187297 | Ga0105239_111872971 | 246 |
| 76 | 3300013100 | Ga0157373_10017305 | Ga0157373_100173054 | 246 |
| 77 | 3300013100 | Ga0157373_10050745 | Ga0157373_100507453 | 246 |
| 78 | 3300013306 | Ga0163162_10023577 | Ga0163162_100235776 | 246 |
| 79 | 3300013306 | Ga0163162_10523182 | Ga0163162_105231821 | 246 |
| 80 | 3300013307 | Ga0157372_10027292 | Ga0157372_100272925 | 246 |
| 81 | 3300013308 | Ga0157375_10219955 | Ga0157375_102199552 | 246 |
| 82 | 3300014325 | Ga0163163_10000536 | Ga0163163_1000053624 | 246 |
| 83 | 3300014325 | Ga0163163_10003037 | Ga0163163_1000303711 | 246 |
| 84 | 3300014325 | Ga0163163_10308593 | Ga0163163_103085933 | 246 |
| 85 | 3300014745 | Ga0157377_10082711 | Ga0157377_100827113 | 246 |
| 86 | 3300014745 | Ga0157377_10119005 | Ga0157377_101190052 | 246 |
| 87 | 3300025321 | Ga0207656_10004814 | Ga0207656_100048145 | 246 |
| 88 | 3300025885 | Ga0207653_10002658 | Ga0207653_100026584 | 246 |
| 89 | 3300025904 | Ga0207647_10202851 | Ga0207647_102028511 | 246 |
| 90 | 3300025912 | Ga0207707_10156521 | Ga0207707_101565212 | 246 |
| 91 | 3300025914 | Ga0207671_10003041 | Ga0207671_1000304110 | 246 |
| 92 | 3300025918 | Ga0207662_10029931 | Ga0207662_100299314 | 246 |
| 93 | 3300025922 | Ga0207646_10040681 | Ga0207646_100406813 | 246 |
| 94 | 3300025925 | Ga0207650_10000001 | Ga0207650_10000001116 | 246 |
| 95 | 3300025925 | Ga0207650_10237666 | Ga0207650_102376662 | 246 |
| 96 | 3300025926 | Ga0207659_10603334 | Ga0207659_106033341 | 246 |
| 97 | 3300025932 | Ga0207690_10200137 | Ga0207690_102001371 | 246 |
| 98 | 3300025935 | Ga0207709_10325681 | Ga0207709_103256811 | 246 |
| 99 | 3300025938 | Ga0207704_10007125 | Ga0207704_100071256 | 246 |
| 100 | 3300025941 | Ga0207711_10036697 | Ga0207711_100366974 | 246 |
| 101 | 3300025941 | Ga0207711_10834199 | Ga0207711_108341991 | 246 |
| 102 | 3300025942 | Ga0207689_10090788 | Ga0207689_100907882 | 246 |
| 103 | 3300025961 | Ga0207712_10018383 | Ga0207712_100183833 | 246 |
| 104 | 3300025986 | Ga0207658_10175653 | Ga0207658_101756532 | 246 |
| 105 | 3300026035 | Ga0207703_10402884 | Ga0207703_104028842 | 246 |
| 106 | 3300026067 | Ga0207678_10151372 | Ga0207678_101513723 | 246 |
| 107 | 3300026075 | Ga0207708_10000453 | Ga0207708_100004537 | 246 |
| 108 | 3300026088 | Ga0207641_10031090 | Ga0207641_100310903 | 246 |
| 109 | 3300026088 | Ga0207641_10470947 | Ga0207641_104709472 | 246 |
| 110 | 3300026089 | Ga0207648_10775382 | Ga0207648_107753821 | 246 |
| 111 | 3300026095 | Ga0207676_10002604 | Ga0207676_1000260410 | 246 |
| 112 | 3300026095 | Ga0207676_10008972 | Ga0207676_100089721 | 246 |
| 113 | 3300026095 | Ga0207676_10292746 | Ga0207676_102927462 | 246 |
| 114 | 3300026118 | Ga0207675_100059905 | Ga0207675_1000599053 | 246 |
| 115 | 3300026142 | Ga0207698_10095712 | Ga0207698_100957123 | 246 |
| 116 | 3300028381 | Ga0268264_10345475 | Ga0268264_103454752 | 246 |
| 117 | 3300031548 | Ga0307408_100010929 | Ga0307408_1000109293 | 246 |
| 118 | 3300031731 | Ga0307405_10069114 | Ga0307405_100691142 | 246 |
| 119 | 3300031731 | Ga0307405_10101601 | Ga0307405_101016012 | 246 |
| 120 | 3300031911 | Ga0307412_10062144 | Ga0307412_100621443 | 246 |
| 121 | 3300032002 | Ga0307416_100063013 | Ga0307416_1000630132 | 246 |
| 122 | 3300032004 | Ga0307414_10028619 | Ga0307414_100286194 | 246 |
| 123 | 3300032005 | Ga0307411_10054741 | Ga0307411_100547414 | 246 |
| 124 | 3300035091 | Ga0373951_0003998 | Ga0373951_0003998_1790_2539 | 246 |
| 125 | 3300035691 | Ga0373931_0090599 | Ga0373931_0090599_935_1675 | 246 |
| 126 | 3300042144 | Ga0450889_003585 | Ga0450889_003585_38_778 | 246 |
| 127 | 3300042157 | Ga0439458_0001971 | Ga0439458_0001971_1888_2628 | 246 |
| 128 | 3300048911 | Ga0496108_0087919 | Ga0496108_0087919_888_1628 | 246 |
| 129 | 3300048913 | Ga0496110_0186383 | Ga0496110_0186383_70_810 | 246 |
| 130 | 3300048915 | Ga0496112_0198225 | Ga0496112_0198225_637_1377 | 246 |
| 131 | 3300048915 | Ga0496112_0238658 | Ga0496112_0238658_41_781 | 246 |
| 132 | 3300048915 | Ga0496112_0857860 | Ga0496112_0857860_30_770 | 246 |
| 133 | 3300048916 | Ga0496113_0410750 | Ga0496113_0410750_181_921 | 246 |
| 134 | 3300049577 | Ga0501041_0234704 | Ga0501041_0234704_329_1069 | 246 |
| 135 | 3300049649 | Ga0501198_004151 | Ga0501198_004151_1034_1774 | 246 |
| 136 | 3300049652 | Ga0501202_001439 | Ga0501202_001439_851_1591 | 246 |
| 137 | 3300049660 | Ga0501216_030648 | Ga0501216_030648_224_964 | 246 |
| 138 | 3300049661 | Ga0501217_000505 | Ga0501217_000505_1398_2138 | 246 |
| 139 | 3300049663 | Ga0501223_008050 | Ga0501223_008050_180_920 | 246 |
| 140 | 3300049664 | Ga0501224_004302 | Ga0501224_004302_337_1077 | 246 |
| 141 | 3300049665 | Ga0501227_001151 | Ga0501227_001151_2558_3298 | 246 |
| 142 | 3300049668 | Ga0501233_005176 | Ga0501233_005176_445_1185 | 246 |
| 143 | 3300049669 | Ga0501235_007561 | Ga0501235_007561_629_1369 | 246 |
| 144 | 3300049675 | Ga0501243_014990 | Ga0501243_014990_429_1169 | 246 |
| 145 | 3300049681 | Ga0501251_001493 | Ga0501251_001493_892_1632 | 246 |
| 146 | 3300049686 | Ga0501257_017396 | Ga0501257_017396_154_894 | 246 |
| 147 | 3300049705 | Ga0501225_0002080 | Ga0501225_0002080_4192_4932 | 246 |
| 148 | 3300049705 | Ga0501225_0046312 | Ga0501225_0046312_160_900 | 246 |
| 149 | 3300049707 | Ga0501234_002592 | Ga0501234_002592_499_1239 | 246 |
| 150 | 3300049765 | Ga0501268_007995 | Ga0501268_007995_720_1460 | 246 |
| 151 | 3300049853 | Ga0501226_002243 | Ga0501226_002243_21_761 | 246 |
| 152 | 3300050508 | nmdc:mga09592_63188_c1 | nmdc:mga09592_63188_c1_2010_2750 | 246 |
| 153 | 3300050509 | nmdc:mga0qj67_577204_c1 | nmdc:mga0qj67_577204_c1_42_782 | 246 |
| 154 | 3300050509 | nmdc:mga0qj67_597210_c1 | nmdc:mga0qj67_597210_c1_102_842 | 246 |
| 155 | 3300050515 | nmdc:mga0a205_43333_c1 | nmdc:mga0a205_43333_c1_2991_3731 | 246 |
| 156 | 3300003320 | rootH2_10242010 | rootH2_102420101 | 247 |
| 157 | 3300003322 | rootL2_10076314 | rootL2_100763144 | 247 |
| 158 | 3300005289 | Ga0065704_10097050 | Ga0065704_100970503 | 247 |
| 159 | 3300005290 | Ga0065712_10006595 | Ga0065712_100065953 | 247 |
| 160 | 3300005290 | Ga0065712_10099388 | Ga0065712_100993881 | 247 |
| 161 | 3300005290 | Ga0065712_10219704 | Ga0065712_102197041 | 247 |
| 162 | 3300005293 | Ga0065715_10010167 | Ga0065715_100101672 | 247 |
| 163 | 3300005293 | Ga0065715_10018518 | Ga0065715_100185182 | 247 |
| 164 | 3300005293 | Ga0065715_10106098 | Ga0065715_101060982 | 247 |
| 165 | 3300005330 | Ga0070690_100029181 | Ga0070690_1000291813 | 247 |
| 166 | 3300005330 | Ga0070690_100034203 | Ga0070690_1000342033 | 247 |
| 167 | 3300005331 | Ga0070670_100039439 | Ga0070670_1000394394 | 247 |
| 168 | 3300005331 | Ga0070670_100532682 | Ga0070670_1005326821 | 247 |
| 169 | 3300005334 | Ga0068869_100029301 | Ga0068869_1000293014 | 247 |
| 170 | 3300005334 | Ga0068869_100040781 | Ga0068869_1000407812 | 247 |
| 171 | 3300005334 | Ga0068869_100050162 | Ga0068869_1000501623 | 247 |
| 172 | 3300005334 | Ga0068869_100170311 | Ga0068869_1001703111 | 247 |
| 173 | 3300005335 | Ga0070666_10156084 | Ga0070666_101560842 | 247 |
| 174 | 3300005336 | Ga0070680_100385705 | Ga0070680_1003857052 | 247 |
| 175 | 3300005338 | Ga0068868_100033094 | Ga0068868_1000330943 | 247 |
| 176 | 3300005340 | Ga0070689_100008318 | Ga0070689_1000083186 | 247 |
| 177 | 3300005340 | Ga0070689_100129061 | Ga0070689_1001290613 | 247 |
| 178 | 3300005343 | Ga0070687_100208109 | Ga0070687_1002081092 | 247 |
| 179 | 3300005343 | Ga0070687_100224192 | Ga0070687_1002241922 | 247 |
| 180 | 3300005345 | Ga0070692_10021029 | Ga0070692_100210294 | 247 |
| 181 | 3300005353 | Ga0070669_100008246 | Ga0070669_1000082463 | 247 |
| 182 | 3300005354 | Ga0070675_100094481 | Ga0070675_1000944812 | 247 |
| 183 | 3300005354 | Ga0070675_100295847 | Ga0070675_1002958471 | 247 |
| 184 | 3300005354 | Ga0070675_100570559 | Ga0070675_1005705591 | 247 |
| 185 | 3300005355 | Ga0070671_100157580 | Ga0070671_1001575803 | 247 |
| 186 | 3300005367 | Ga0070667_100203329 | Ga0070667_1002033292 | 247 |
| 187 | 3300005367 | Ga0070667_100342871 | Ga0070667_1003428711 | 247 |
| 188 | 3300005438 | Ga0070701_10044736 | Ga0070701_100447362 | 247 |
| 189 | 3300005438 | Ga0070701_10063286 | Ga0070701_100632862 | 247 |
| 190 | 3300005438 | Ga0070701_10094097 | Ga0070701_100940972 | 247 |
| 191 | 3300005440 | Ga0070705_100132679 | Ga0070705_1001326792 | 247 |
| 192 | 3300005440 | Ga0070705_100205908 | Ga0070705_1002059082 | 247 |
| 193 | 3300005441 | Ga0070700_100003376 | Ga0070700_1000033764 | 247 |
| 194 | 3300005441 | Ga0070700_100033324 | Ga0070700_1000333243 | 247 |
| 195 | 3300005441 | Ga0070700_100046348 | Ga0070700_1000463484 | 247 |
| 196 | 3300005441 | Ga0070700_100052074 | Ga0070700_1000520743 | 247 |
| 197 | 3300005444 | Ga0070694_100118121 | Ga0070694_1001181212 | 247 |
| 198 | 3300005444 | Ga0070694_100227780 | Ga0070694_1002277802 | 247 |
| 199 | 3300005444 | Ga0070694_100378696 | Ga0070694_1003786961 | 247 |
| 200 | 3300005444 | Ga0070694_100416024 | Ga0070694_1004160241 | 247 |
| 201 | 3300005445 | Ga0070708_100015570 | Ga0070708_1000155705 | 247 |
| 202 | 3300005445 | Ga0070708_100763713 | Ga0070708_1007637131 | 247 |
| 203 | 3300005457 | Ga0070662_100050413 | Ga0070662_1000504133 | 247 |
| 204 | 3300005457 | Ga0070662_100226391 | Ga0070662_1002263911 | 247 |
| 205 | 3300005459 | Ga0068867_100082686 | Ga0068867_1000826863 | 247 |
| 206 | 3300005459 | Ga0068867_100086858 | Ga0068867_1000868582 | 247 |
| 207 | 3300005459 | Ga0068867_100896181 | Ga0068867_1008961811 | 247 |
| 208 | 3300005467 | Ga0070706_100000019 | Ga0070706_100000019113 | 247 |
| 209 | 3300005467 | Ga0070706_100030351 | Ga0070706_1000303514 | 247 |
| 210 | 3300005467 | Ga0070706_100062091 | Ga0070706_1000620913 | 247 |
| 211 | 3300005467 | Ga0070706_100067407 | Ga0070706_1000674073 | 247 |
| 212 | 3300005468 | Ga0070707_100297758 | Ga0070707_1002977582 | 247 |
| 213 | 3300005468 | Ga0070707_100454386 | Ga0070707_1004543862 | 247 |
| 214 | 3300005471 | Ga0070698_100011152 | Ga0070698_1000111526 | 247 |
| 215 | 3300005471 | Ga0070698_100032837 | Ga0070698_1000328375 | 247 |
| 216 | 3300005518 | Ga0070699_100104626 | Ga0070699_1001046263 | 247 |
| 217 | 3300005518 | Ga0070699_100565447 | Ga0070699_1005654471 | 247 |
| 218 | 3300005536 | Ga0070697_100000042 | Ga0070697_10000004263 | 247 |
| 219 | 3300005536 | Ga0070697_100007191 | Ga0070697_1000071915 | 247 |
| 220 | 3300005536 | Ga0070697_100027035 | Ga0070697_1000270353 | 247 |
| 221 | 3300005543 | Ga0070672_100079998 | Ga0070672_1000799981 | 247 |
| 222 | 3300005544 | Ga0070686_100052380 | Ga0070686_1000523802 | 247 |
| 223 | 3300005545 | Ga0070695_100014195 | Ga0070695_1000141952 | 247 |
| 224 | 3300005545 | Ga0070695_100282126 | Ga0070695_1002821262 | 247 |
| 225 | 3300005546 | Ga0070696_100014545 | Ga0070696_1000145453 | 247 |
| 226 | 3300005546 | Ga0070696_100119608 | Ga0070696_1001196082 | 247 |
| 227 | 3300005546 | Ga0070696_100194185 | Ga0070696_1001941851 | 247 |
| 228 | 3300005546 | Ga0070696_100307883 | Ga0070696_1003078831 | 247 |
| 229 | 3300005547 | Ga0070693_100090281 | Ga0070693_1000902813 | 247 |
| 230 | 3300005548 | Ga0070665_100039350 | Ga0070665_1000393504 | 247 |
| 231 | 3300005549 | Ga0070704_100042465 | Ga0070704_1000424653 | 247 |
| 232 | 3300005549 | Ga0070704_100321982 | Ga0070704_1003219822 | 247 |
| 233 | 3300005549 | Ga0070704_100604155 | Ga0070704_1006041551 | 247 |
| 234 | 3300005564 | Ga0070664_100099365 | Ga0070664_1000993654 | 247 |
| 235 | 3300005564 | Ga0070664_100240852 | Ga0070664_1002408522 | 247 |
| 236 | 3300005578 | Ga0068854_100223178 | Ga0068854_1002231782 | 247 |
| 237 | 3300005578 | Ga0068854_100517464 | Ga0068854_1005174641 | 247 |
| 238 | 3300005615 | Ga0070702_100021748 | Ga0070702_1000217484 | 247 |
| 239 | 3300005615 | Ga0070702_100023865 | Ga0070702_1000238653 | 247 |
| 240 | 3300005615 | Ga0070702_100064177 | Ga0070702_1000641772 | 247 |
| 241 | 3300005616 | Ga0068852_100215395 | Ga0068852_1002153952 | 247 |
| 242 | 3300005617 | Ga0068859_100043802 | Ga0068859_1000438023 | 247 |
| 243 | 3300005617 | Ga0068859_100059139 | Ga0068859_1000591393 | 247 |
| 244 | 3300005617 | Ga0068859_100104769 | Ga0068859_1001047692 | 247 |
| 245 | 3300005617 | Ga0068859_100124202 | Ga0068859_1001242024 | 247 |
| 246 | 3300005617 | Ga0068859_100249193 | Ga0068859_1002491932 | 247 |
| 247 | 3300005617 | Ga0068859_100494730 | Ga0068859_1004947302 | 247 |
| 248 | 3300005617 | Ga0068859_100760263 | Ga0068859_1007602631 | 247 |
| 249 | 3300005618 | Ga0068864_100006010 | Ga0068864_1000060105 | 247 |
| 250 | 3300005618 | Ga0068864_100046596 | Ga0068864_1000465962 | 247 |
| 251 | 3300005618 | Ga0068864_100444281 | Ga0068864_1004442811 | 247 |
| 252 | 3300005618 | Ga0068864_100928214 | Ga0068864_1009282141 | 247 |
| 253 | 3300005719 | Ga0068861_100015826 | Ga0068861_1000158265 | 247 |
| 254 | 3300005719 | Ga0068861_100074211 | Ga0068861_1000742112 | 247 |
| 255 | 3300005840 | Ga0068870_10018105 | Ga0068870_100181053 | 247 |
| 256 | 3300005840 | Ga0068870_10021603 | Ga0068870_100216032 | 247 |
| 257 | 3300005840 | Ga0068870_10106633 | Ga0068870_101066332 | 247 |
| 258 | 3300005840 | Ga0068870_10223277 | Ga0068870_102232771 | 247 |
| 259 | 3300005841 | Ga0068863_100422890 | Ga0068863_1004228901 | 247 |
| 260 | 3300005842 | Ga0068858_100024283 | Ga0068858_1000242833 | 247 |
| 261 | 3300005842 | Ga0068858_100066756 | Ga0068858_1000667564 | 247 |
| 262 | 3300005842 | Ga0068858_100137713 | Ga0068858_1001377135 | 247 |
| 263 | 3300005843 | Ga0068860_100037258 | Ga0068860_1000372583 | 247 |
| 264 | 3300005843 | Ga0068860_100237076 | Ga0068860_1002370763 | 247 |
| 265 | 3300005843 | Ga0068860_100281445 | Ga0068860_1002814454 | 247 |
| 266 | 3300005844 | Ga0068862_100027762 | Ga0068862_1000277624 | 247 |
| 267 | 3300005844 | Ga0068862_100438480 | Ga0068862_1004384801 | 247 |
| 268 | 3300005985 | Ga0081539_10000360 | Ga0081539_1000036026 | 247 |
| 269 | 3300005985 | Ga0081539_10000669 | Ga0081539_1000066940 | 247 |
| 270 | 3300006237 | Ga0097621_100003835 | Ga0097621_1000038354 | 247 |
| 271 | 3300006358 | Ga0068871_100029981 | Ga0068871_1000299812 | 247 |
| 272 | 3300006358 | Ga0068871_100228178 | Ga0068871_1002281781 | 247 |
| 273 | 3300006358 | Ga0068871_100332210 | Ga0068871_1003322102 | 247 |
| 274 | 3300006844 | Ga0075428_100145235 | Ga0075428_1001452352 | 247 |
| 275 | 3300006846 | Ga0075430_100062246 | Ga0075430_1000622464 | 247 |
| 276 | 3300006871 | Ga0075434_100050025 | Ga0075434_1000500254 | 247 |
| 277 | 3300006880 | Ga0075429_100067871 | Ga0075429_1000678714 | 247 |
| 278 | 3300006881 | Ga0068865_100049198 | Ga0068865_1000491982 | 247 |
| 279 | 3300006881 | Ga0068865_100136679 | Ga0068865_1001366792 | 247 |
| 280 | 3300006881 | Ga0068865_100211868 | Ga0068865_1002118682 | 247 |
| 281 | 3300006931 | Ga0097620_100043803 | Ga0097620_1000438033 | 247 |
| 282 | 3300006931 | Ga0097620_100059141 | Ga0097620_1000591413 | 247 |
| 283 | 3300006931 | Ga0097620_100104771 | Ga0097620_1001047714 | 247 |
| 284 | 3300006931 | Ga0097620_100124195 | Ga0097620_1001241954 | 247 |
| 285 | 3300006931 | Ga0097620_100249199 | Ga0097620_1002491992 | 247 |
| 286 | 3300006931 | Ga0097620_100494736 | Ga0097620_1004947362 | 247 |
| 287 | 3300006931 | Ga0097620_100760233 | Ga0097620_1007602332 | 247 |
| 288 | 3300007076 | Ga0075435_100069875 | Ga0075435_1000698752 | 247 |
| 289 | 3300007265 | Ga0099794_10168414 | Ga0099794_101684141 | 247 |
| 290 | 3300009094 | Ga0111539_10021005 | Ga0111539_100210055 | 247 |
| 291 | 3300009094 | Ga0111539_10458319 | Ga0111539_104583192 | 247 |
| 292 | 3300009094 | Ga0111539_10561924 | Ga0111539_105619242 | 247 |
| 293 | 3300009098 | Ga0105245_10063460 | Ga0105245_100634603 | 247 |
| 294 | 3300009101 | Ga0105247_10506859 | Ga0105247_105068591 | 247 |
| 295 | 3300009147 | Ga0114129_10004845 | Ga0114129_1000484511 | 247 |
| 296 | 3300009147 | Ga0114129_10007705 | Ga0114129_1000770512 | 247 |
| 297 | 3300009147 | Ga0114129_10010635 | Ga0114129_100106354 | 247 |
| 298 | 3300009147 | Ga0114129_10014212 | Ga0114129_100142124 | 247 |
| 299 | 3300009147 | Ga0114129_10015657 | Ga0114129_100156572 | 247 |
| 300 | 3300009147 | Ga0114129_10210834 | Ga0114129_102108344 | 247 |
| 301 | 3300009147 | Ga0114129_10211037 | Ga0114129_102110372 | 247 |
| 302 | 3300009147 | Ga0114129_10262468 | Ga0114129_102624683 | 247 |
| 303 | 3300009147 | Ga0114129_10533761 | Ga0114129_105337613 | 247 |
| 304 | 3300009174 | Ga0105241_10010731 | Ga0105241_100107316 | 247 |
| 305 | 3300009174 | Ga0105241_10074489 | Ga0105241_100744891 | 247 |
| 306 | 3300009176 | Ga0105242_10026849 | Ga0105242_100268492 | 247 |
| 307 | 3300009176 | Ga0105242_10069534 | Ga0105242_100695343 | 247 |
| 308 | 3300009177 | Ga0105248_10011605 | Ga0105248_100116054 | 247 |
| 309 | 3300009545 | Ga0105237_10093543 | Ga0105237_100935432 | 247 |
| 310 | 3300009551 | Ga0105238_10003652 | Ga0105238_100036528 | 247 |
| 311 | 3300009551 | Ga0105238_10137717 | Ga0105238_101377173 | 247 |
| 312 | 3300009553 | Ga0105249_10134878 | Ga0105249_101348782 | 247 |
| 313 | 3300009553 | Ga0105249_10148179 | Ga0105249_101481793 | 247 |
| 314 | 3300009553 | Ga0105249_10212086 | Ga0105249_102120862 | 247 |
| 315 | 3300009553 | Ga0105249_10910486 | Ga0105249_109104861 | 247 |
| 316 | 3300010375 | Ga0105239_10305649 | Ga0105239_103056492 | 247 |
| 317 | 3300010375 | Ga0105239_10344289 | Ga0105239_103442892 | 247 |
| 318 | 3300010375 | Ga0105239_10349670 | Ga0105239_103496702 | 247 |
| 319 | 3300011119 | Ga0105246_10034179 | Ga0105246_100341792 | 247 |
| 320 | 3300013100 | Ga0157373_10006382 | Ga0157373_100063826 | 247 |
| 321 | 3300013296 | Ga0157374_10036630 | Ga0157374_100366304 | 247 |
| 322 | 3300013297 | Ga0157378_10005142 | Ga0157378_1000514212 | 247 |
| 323 | 3300013297 | Ga0157378_10068435 | Ga0157378_100684352 | 247 |
| 324 | 3300013297 | Ga0157378_10147631 | Ga0157378_101476313 | 247 |
| 325 | 3300013306 | Ga0163162_10001625 | Ga0163162_1000162518 | 247 |
| 326 | 3300013306 | Ga0163162_10020033 | Ga0163162_100200333 | 247 |
| 327 | 3300013306 | Ga0163162_10061722 | Ga0163162_100617223 | 247 |
| 328 | 3300013306 | Ga0163162_10080872 | Ga0163162_100808723 | 247 |
| 329 | 3300013306 | Ga0163162_10156215 | Ga0163162_101562151 | 247 |
| 330 | 3300013306 | Ga0163162_10396065 | Ga0163162_103960653 | 247 |
| 331 | 3300013308 | Ga0157375_10004457 | Ga0157375_100044577 | 247 |
| 332 | 3300013308 | Ga0157375_10127211 | Ga0157375_101272113 | 247 |
| 333 | 3300014325 | Ga0163163_10013448 | Ga0163163_100134482 | 247 |
| 334 | 3300014325 | Ga0163163_10046876 | Ga0163163_100468766 | 247 |
| 335 | 3300014325 | Ga0163163_10079504 | Ga0163163_100795043 | 247 |
| 336 | 3300014325 | Ga0163163_10097825 | Ga0163163_100978253 | 247 |
| 337 | 3300014326 | Ga0157380_10002430 | Ga0157380_1000243012 | 247 |
| 338 | 3300014326 | Ga0157380_10011474 | Ga0157380_100114742 | 247 |
| 339 | 3300014326 | Ga0157380_10075729 | Ga0157380_100757293 | 247 |
| 340 | 3300014326 | Ga0157380_10084312 | Ga0157380_100843122 | 247 |
| 341 | 3300014326 | Ga0157380_10170631 | Ga0157380_101706313 | 247 |
| 342 | 3300014745 | Ga0157377_10007731 | Ga0157377_100077312 | 247 |
| 343 | 3300014969 | Ga0157376_10087853 | Ga0157376_100878531 | 247 |
| 344 | 3300014969 | Ga0157376_10654161 | Ga0157376_106541611 | 247 |
| 345 | 3300017792 | Ga0163161_10039753 | Ga0163161_100397533 | 247 |
| 346 | 3300021384 | Ga0213876_10016872 | Ga0213876_100168723 | 247 |
| 347 | 3300025903 | Ga0207680_10064868 | Ga0207680_100648682 | 247 |
| 348 | 3300025908 | Ga0207643_10055316 | Ga0207643_100553162 | 247 |
| 349 | 3300025910 | Ga0207684_10000079 | Ga0207684_10000079117 | 247 |
| 350 | 3300025910 | Ga0207684_10011978 | Ga0207684_100119788 | 247 |
| 351 | 3300025910 | Ga0207684_10049450 | Ga0207684_100494503 | 247 |
| 352 | 3300025912 | Ga0207707_10097478 | Ga0207707_100974784 | 247 |
| 353 | 3300025917 | Ga0207660_10015697 | Ga0207660_100156976 | 247 |
| 354 | 3300025918 | Ga0207662_10058218 | Ga0207662_100582183 | 247 |
| 355 | 3300025918 | Ga0207662_10254878 | Ga0207662_102548781 | 247 |
| 356 | 3300025918 | Ga0207662_10465033 | Ga0207662_104650331 | 247 |
| 357 | 3300025922 | Ga0207646_10110864 | Ga0207646_101108642 | 247 |
| 358 | 3300025923 | Ga0207681_10005287 | Ga0207681_100052878 | 247 |
| 359 | 3300025923 | Ga0207681_10067150 | Ga0207681_100671503 | 247 |
| 360 | 3300025924 | Ga0207694_10002743 | Ga0207694_100027432 | 247 |
| 361 | 3300025925 | Ga0207650_10000511 | Ga0207650_1000051117 | 247 |
| 362 | 3300025925 | Ga0207650_10106643 | Ga0207650_101066432 | 247 |
| 363 | 3300025925 | Ga0207650_10391903 | Ga0207650_103919032 | 247 |
| 364 | 3300025926 | Ga0207659_10321703 | Ga0207659_103217031 | 247 |
| 365 | 3300025931 | Ga0207644_10013351 | Ga0207644_100133518 | 247 |
| 366 | 3300025931 | Ga0207644_10043332 | Ga0207644_100433323 | 247 |
| 367 | 3300025933 | Ga0207706_10123703 | Ga0207706_101237032 | 247 |
| 368 | 3300025933 | Ga0207706_10175161 | Ga0207706_101751612 | 247 |
| 369 | 3300025933 | Ga0207706_10289353 | Ga0207706_102893531 | 247 |
| 370 | 3300025934 | Ga0207686_10021258 | Ga0207686_100212582 | 247 |
| 371 | 3300025935 | Ga0207709_10080448 | Ga0207709_100804482 | 247 |
| 372 | 3300025936 | Ga0207670_10113012 | Ga0207670_101130123 | 247 |
| 373 | 3300025938 | Ga0207704_10092231 | Ga0207704_100922313 | 247 |
| 374 | 3300025938 | Ga0207704_10216569 | Ga0207704_102165692 | 247 |
| 375 | 3300025938 | Ga0207704_10326561 | Ga0207704_103265612 | 247 |
| 376 | 3300025939 | Ga0207665_10006407 | Ga0207665_100064075 | 247 |
| 377 | 3300025940 | Ga0207691_10011463 | Ga0207691_100114633 | 247 |
| 378 | 3300025940 | Ga0207691_10124447 | Ga0207691_101244473 | 247 |
| 379 | 3300025941 | Ga0207711_10186560 | Ga0207711_101865603 | 247 |
| 380 | 3300025942 | Ga0207689_10002487 | Ga0207689_100024879 | 247 |
| 381 | 3300025942 | Ga0207689_10004823 | Ga0207689_1000482310 | 247 |
| 382 | 3300025942 | Ga0207689_10102581 | Ga0207689_101025812 | 247 |
| 383 | 3300025942 | Ga0207689_10110925 | Ga0207689_101109252 | 247 |
| 384 | 3300025942 | Ga0207689_10426443 | Ga0207689_104264431 | 247 |
| 385 | 3300025945 | Ga0207679_10178178 | Ga0207679_101781781 | 247 |
| 386 | 3300025960 | Ga0207651_10581725 | Ga0207651_105817252 | 247 |
| 387 | 3300025961 | Ga0207712_10068783 | Ga0207712_100687832 | 247 |
| 388 | 3300025961 | Ga0207712_10069521 | Ga0207712_100695215 | 247 |
| 389 | 3300025961 | Ga0207712_10271117 | Ga0207712_102711172 | 247 |
| 390 | 3300025961 | Ga0207712_10273087 | Ga0207712_102730872 | 247 |
| 391 | 3300025972 | Ga0207668_10357950 | Ga0207668_103579502 | 247 |
| 392 | 3300025981 | Ga0207640_10600158 | Ga0207640_106001581 | 247 |
| 393 | 3300025986 | Ga0207658_10062360 | Ga0207658_100623603 | 247 |
| 394 | 3300025986 | Ga0207658_10265725 | Ga0207658_102657252 | 247 |
| 395 | 3300026023 | Ga0207677_10048232 | Ga0207677_100482322 | 247 |
| 396 | 3300026023 | Ga0207677_10280532 | Ga0207677_102805321 | 247 |
| 397 | 3300026035 | Ga0207703_10019071 | Ga0207703_100190714 | 247 |
| 398 | 3300026035 | Ga0207703_10578349 | Ga0207703_105783491 | 247 |
| 399 | 3300026075 | Ga0207708_10006841 | Ga0207708_100068413 | 247 |
| 400 | 3300026089 | Ga0207648_10121392 | Ga0207648_101213922 | 247 |
| 401 | 3300026095 | Ga0207676_10008472 | Ga0207676_100084722 | 247 |
| 402 | 3300026095 | Ga0207676_10235118 | Ga0207676_102351181 | 247 |
| 403 | 3300026095 | Ga0207676_10697549 | Ga0207676_106975491 | 247 |
| 404 | 3300026116 | Ga0207674_10082868 | Ga0207674_100828683 | 247 |
| 405 | 3300026118 | Ga0207675_100020124 | Ga0207675_1000201243 | 247 |
| 406 | 3300026118 | Ga0207675_100059018 | Ga0207675_1000590181 | 247 |
| 407 | 3300026118 | Ga0207675_100059492 | Ga0207675_1000594925 | 247 |
| 408 | 3300026118 | Ga0207675_100114790 | Ga0207675_1001147903 | 247 |
| 409 | 3300026118 | Ga0207675_100476969 | Ga0207675_1004769691 | 247 |
| 410 | 3300026142 | Ga0207698_10122011 | Ga0207698_101220112 | 247 |
| 411 | 3300026142 | Ga0207698_10477281 | Ga0207698_104772812 | 247 |
| 412 | 3300027907 | Ga0207428_10075967 | Ga0207428_100759672 | 247 |
| 413 | 3300028380 | Ga0268265_10080866 | Ga0268265_100808662 | 247 |
| 414 | 3300028380 | Ga0268265_10119660 | Ga0268265_101196601 | 247 |
| 415 | 3300028381 | Ga0268264_10119148 | Ga0268264_101191483 | 247 |
| 416 | 3300028381 | Ga0268264_10156855 | Ga0268264_101568551 | 247 |
| 417 | 3300028381 | Ga0268264_10171815 | Ga0268264_101718154 | 247 |
| 418 | 3300028794 | Ga0307515_10137599 | Ga0307515_101375991 | 247 |
| 419 | 3300031901 | Ga0307406_10269305 | Ga0307406_102693051 | 247 |
| 420 | 3300031911 | Ga0307412_10158436 | Ga0307412_101584361 | 247 |
| 421 | 3300032002 | Ga0307416_100677046 | Ga0307416_1006770461 | 247 |
| 422 | 3300032005 | Ga0307411_10004380 | Ga0307411_100043803 | 247 |
| 423 | 3300032005 | Ga0307411_10694280 | Ga0307411_106942801 | 247 |
| 424 | 3300036401 | Ga0373937_0211268 | Ga0373937_0211268_912_1670 | 247 |
| 425 | 3300037418 | Ga0395900_0106164 | Ga0395900_0106164_1713_2471 | 247 |
| 426 | 3300038443 | Ga0395901_0477537 | Ga0395901_0477537_62_820 | 247 |
| 427 | 3300039437 | Ga0436365_0325727 | Ga0436365_0325727_5861_6616 | 247 |
| 428 | 3300039437 | Ga0436365_1023949 | Ga0436365_1023949_19199_19969 | 247 |
| 429 | 3300042156 | Ga0439446_0019691 | Ga0439446_0019691_97_858 | 247 |
| 430 | 3300046472 | Ga0495580_0089521 | Ga0495580_0089521_81_839 | 247 |
| 431 | 3300046519 | Ga0495632_0012621 | Ga0495632_0012621_3327_4079 | 247 |
| 432 | 3300047318 | Ga0495636_0065896 | Ga0495636_0065896_733_1494 | 247 |
| 433 | 3300048905 | Ga0496102_0016105 | Ga0496102_0016105_2037_2834 | 247 |
| 434 | 3300048906 | Ga0496103_0006385 | Ga0496103_0006385_2395_3192 | 247 |
| 435 | 3300048909 | Ga0496106_0024733 | Ga0496106_0024733_3312_4076 | 247 |
| 436 | 3300048911 | Ga0496108_0114793 | Ga0496108_0114793_1086_1856 | 247 |
| 437 | 3300048915 | Ga0496112_0060757 | Ga0496112_0060757_946_1689 | 247 |
| 438 | 3300048915 | Ga0496112_0201026 | Ga0496112_0201026_382_1143 | 247 |
| 439 | 3300048916 | Ga0496113_0093515 | Ga0496113_0093515_947_1744 | 247 |
| 440 | 3300049574 | Ga0501038_0002878 | Ga0501038_0002878_872_1639 | 247 |
| 441 | 3300049592 | Ga0501076_0094708 | Ga0501076_0094708_89_835 | 247 |
| 442 | 3300049593 | Ga0501077_0301575 | Ga0501077_0301575_146_901 | 247 |
| 443 | 3300049649 | Ga0501198_002784 | Ga0501198_002784_662_1408 | 247 |
| 444 | 3300049666 | Ga0501228_005642 | Ga0501228_005642_225_971 | 247 |
| 445 | 3300049667 | Ga0501230_005991 | Ga0501230_005991_191_937 | 247 |
| 446 | 3300049679 | Ga0501249_005074 | Ga0501249_005074_296_1042 | 247 |
| 447 | 3300049704 | Ga0501221_009940 | Ga0501221_009940_387_1133 | 247 |
| 448 | 3300049706 | Ga0501229_006358 | Ga0501229_006358_337_1083 | 247 |
| 449 | 3300049770 | Ga0501273_007057 | Ga0501273_007057_464_1231 | 247 |
| 450 | 3300049770 | Ga0501273_016108 | Ga0501273_016108_145_891 | 247 |
| 451 | 3300049775 | Ga0501279_021114 | Ga0501279_021114_117_863 | 247 |
| 452 | 3300049851 | Ga0501212_023737 | Ga0501212_023737_65_811 | 247 |
| 453 | 3300050507 | nmdc:mga05p37_118214_c1 | nmdc:mga05p37_118214_c1_919_1674 | 247 |
| 454 | 3300050507 | nmdc:mga05p37_210337_c1 | nmdc:mga05p37_210337_c1_1242_1988 | 247 |
| 455 | 3300050507 | nmdc:mga05p37_560834_c1 | nmdc:mga05p37_560834_c1_247_996 | 247 |
| 456 | 3300050507 | nmdc:mga05p37_72732_c1 | nmdc:mga05p37_72732_c1_1890_2648 | 247 |
| 457 | 3300050509 | nmdc:mga0qj67_50805_c1 | nmdc:mga0qj67_50805_c1_638_1393 | 247 |
| 458 | 3300050511 | nmdc:mga08y16_160984_c1 | nmdc:mga08y16_160984_c1_259_1005 | 247 |
| 459 | 3300050511 | nmdc:mga08y16_18914_c1 | nmdc:mga08y16_18914_c1_4223_4966 | 247 |
| 460 | 3300050511 | nmdc:mga08y16_9954_c1 | nmdc:mga08y16_9954_c1_1383_2129 | 247 |
| 461 | 3300050512 | nmdc:mga0n895_243120_c1 | nmdc:mga0n895_243120_c1_587_1330 | 247 |
| 462 | 3300050512 | nmdc:mga0n895_59619_c1 | nmdc:mga0n895_59619_c1_1995_2744 | 247 |
| 463 | 3300050513 | nmdc:mga0rr50_146662_c1 | nmdc:mga0rr50_146662_c1_780_1541 | 247 |
| 464 | 3300050515 | nmdc:mga0a205_23175_c1 | nmdc:mga0a205_23175_c1_1457_2200 | 247 |
| 465 | 3300050515 | nmdc:mga0a205_419483_c1 | nmdc:mga0a205_419483_c1_107_850 | 247 |
| 466 | 3300050515 | nmdc:mga0a205_86764_c1 | nmdc:mga0a205_86764_c1_1194_1943 | 247 |
| 467 | 3300053153 | Ga0500616_0001248 | Ga0500616_0001248_1943_2686 | 247 |
| 468 | 3300061734 | Ga0530510_0045465 | Ga0530510_0045465_968_1723 | 247 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3opn-assembly1.cif.gz_A | the crystal structure of a putative hemolysin from lactococcus lactis | 0.9772 | 62 | 245 |
| 5eov-assembly1.cif.gz_A | c-terminal domain of the 16s/23s rrna (cytidine-2'-o)-methyltransferase tlya. | 0.9709 | 65 | 247 |
| 2cqj-assembly1.cif.gz_A | solution structure of the s4 domain of u3 small nucleolar ribonucleoprotein protein imp3 homolog | 0.9498 | 2 | 45 |
| 5wxm-assembly1.cif.gz_A | crystal structure of the imp3 and mpp10 complex | 0.9473 | 4 | 53 |
| 8d8l-assembly1.cif.gz_D | yeast mitochondrial small subunit assembly intermediate (state 3) | 0.9276 | 4 | 54 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C0P590_106_292_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9848 | 70 | 247 | 3.40.50.150 |
| 3opnA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9743 | 62 | 245 | 3.40.50.150 |
| 5eovA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9709 | 65 | 247 | 3.40.50.150 |
| af_Q8I5D3_12_67_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9399 | 5 | 54 | 3.10.290.10 |
| af_P02355_88_184_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9355 | 5 | 54 | 3.10.290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3E0KKI0-F1-model_v4 | TlyA family rRNA (Cytidine-2'-O)-methyltransferase | 0.9912 | 66 | 245 |
GO:0008168
GO:0032259 |
| AF-A0A812A551-F1-model_v4 | deleted | 0.991 | 165 | 246 |
|
| AF-A0A7W1FBX5-F1-model_v4 | TlyA family rRNA (Cytidine-2'-O)-methyltransferase | 0.9898 | 170 | 244 |
GO:0008168
GO:0032259 |
| AF-A0A645GDA7-F1-model_v4 | 16S/23S rRNA (Cytidine-2'-O)-methyltransferase TlyA (EC 2.1.1.226) | 0.989 | 135 | 246 |
GO:0008168
GO:0032259 |
| AF-A0A7Z9ZZR2-F1-model_v4 | TlyA family RNA methyltransferase | 0.9883 | 74 | 245 |
GO:0008168
GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar