F450052

General Info

Members Datasets Scaffolds Average Seq Length
468 205 468 249

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100029273|Ga0207675_1000292734
Length 244
Sequence VKERIDKLLVERGMAESRTKAQAMVMAGVVLVNEQRVEKSSDQFSSDAQIRIKRADDPATRYVGRGGLKLEAALKQFQIDVRGLVCLDVGASTGGFTDCLLQHGATKVFAIDVGHNQIDWRLRNDPRVEVREGVPIRFDLAVVDVSFISVSKVLPAVAPLLKEEGSMVVLIKPQFEVGRGEVGSGGIVRDEQKRLRVVAEVNQFAATLQLRVEGLVESAIKGAEGNVEYLAHYSYHPASKHVAN

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
156 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
157 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
173 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
174 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
175 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
176 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
177 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
178 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
179 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
180 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
181 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
182 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
183 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
184 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
185 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
186 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
187 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
188 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
189 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
190 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
191 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
192 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
193 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
194 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
195 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
196 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 2.78
Rhizosphere 95.73
Stem 0
Stem Tuber 0
Unclassified 1.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10242010 3300003320 Bacteria 2824
2 rootL2_10076314 3300003322 Bacteria 4175
3 Ga0065704_10097050 3300005289 Bacteria 2368
4 Ga0065712_10006595 3300005290 Bacteria 2879
5 Ga0065712_10099388 3300005290 Bacteria 2092
6 Ga0065712_10219704 3300005290 Bacteria 1045
7 Ga0065715_10010167 3300005293 Bacteria 3087
8 Ga0065715_10018518 3300005293 Bacteria 2272
9 Ga0065715_10106098 3300005293 Bacteria 2851
10 Ga0065715_10174730 3300005293 Unclassified 1520
11 Ga0070690_100029181 3300005330 Bacteria 3419
12 Ga0070690_100034203 3300005330 Unclassified 3184
13 Ga0070670_100039439 3300005331 Bacteria 4061
14 Ga0070670_100532682 3300005331 Bacteria 1047
15 Ga0068869_100029301 3300005334 Unclassified 3856
16 Ga0068869_100040781 3300005334 Bacteria 3321
17 Ga0068869_100050162 3300005334 Bacteria 3024
18 Ga0068869_100170311 3300005334 Bacteria 1701
19 Ga0070666_10156084 3300005335 Unclassified 1594
20 Ga0070680_100385705 3300005336 Bacteria 1193
21 Ga0068868_100033094 3300005338 Bacteria 3983
22 Ga0068868_100160700 3300005338 Unclassified 1855
23 Ga0070689_100008318 3300005340 Bacteria 7304
24 Ga0070689_100129061 3300005340 Bacteria 2026
25 Ga0070687_100208109 3300005343 Bacteria 1190
26 Ga0070687_100224192 3300005343 Bacteria 1153
27 Ga0070692_10008884 3300005345 Unclassified 4503
28 Ga0070692_10021029 3300005345 Bacteria 3171
29 Ga0070669_100008246 3300005353 Bacteria 7442
30 Ga0070675_100094481 3300005354 Bacteria 2509
31 Ga0070675_100295847 3300005354 Bacteria 1425
32 Ga0070675_100337154 3300005354 Bacteria 1335
33 Ga0070675_100570559 3300005354 Bacteria 1024
34 Ga0070671_100157580 3300005355 Unclassified 1918
35 Ga0070667_100203329 3300005367 Bacteria 1758
36 Ga0070667_100342871 3300005367 Bacteria 1351
37 Ga0070701_10044736 3300005438 Bacteria 2269
38 Ga0070701_10063286 3300005438 Bacteria 1957
39 Ga0070701_10094097 3300005438 Unclassified 1648
40 Ga0070701_10210475 3300005438 Bacteria 1154
41 Ga0070705_100132679 3300005440 Unclassified 1627
42 Ga0070705_100205908 3300005440 Bacteria 1352
43 Ga0070700_100003376 3300005441 Bacteria 8232
44 Ga0070700_100033324 3300005441 Unclassified 3101
45 Ga0070700_100046348 3300005441 Bacteria 2685
46 Ga0070700_100052074 3300005441 Bacteria 2551
47 Ga0070700_100093187 3300005441 Unclassified 1970
48 Ga0070694_100030939 3300005444 Bacteria 3506
49 Ga0070694_100118121 3300005444 Bacteria 1899
50 Ga0070694_100227780 3300005444 Unclassified 1401
51 Ga0070694_100378696 3300005444 Unclassified 1103
52 Ga0070694_100416024 3300005444 Unclassified 1055
53 Ga0070708_100015570 3300005445 Bacteria 6285
54 Ga0070708_100372552 3300005445 Bacteria 1346
55 Ga0070708_100763713 3300005445 Bacteria 909
56 Ga0070662_100050413 3300005457 Bacteria 3003
57 Ga0070662_100226391 3300005457 Bacteria 1494
58 Ga0068867_100082686 3300005459 Bacteria 2423
59 Ga0068867_100086858 3300005459 Bacteria 2367
60 Ga0068867_100896181 3300005459 Bacteria 798
61 Ga0070706_100000019 3300005467 Bacteria 166483
62 Ga0070706_100030351 3300005467 Bacteria 4980
63 Ga0070706_100032074 3300005467 Bacteria 4845
64 Ga0070706_100062091 3300005467 Bacteria 3451
65 Ga0070706_100067407 3300005467 Bacteria 3310
66 Ga0070706_100909896 3300005467 Bacteria 813
67 Ga0070707_100115525 3300005468 Bacteria 2604
68 Ga0070707_100297758 3300005468 Unclassified 1567
69 Ga0070707_100454386 3300005468 Bacteria 1242
70 Ga0070698_100011152 3300005471 Bacteria 9548
71 Ga0070698_100032837 3300005471 Bacteria 5376
72 Ga0070698_100046727 3300005471 Bacteria 4426
73 Ga0070698_100092459 3300005471 Bacteria 3006
74 Ga0070698_100425461 3300005471 Bacteria 1262
75 Ga0070699_100023225 3300005518 Bacteria 5342
76 Ga0070699_100104626 3300005518 Unclassified 2482
77 Ga0070699_100565447 3300005518 Bacteria 1036
78 Ga0070679_100148826 3300005530 Bacteria 2319
79 Ga0070697_100000042 3300005536 Bacteria 94533
80 Ga0070697_100007191 3300005536 Bacteria 8656
81 Ga0070697_100027035 3300005536 Bacteria 4588
82 Ga0070697_100040500 3300005536 Bacteria 3770
83 Ga0068853_100011800 3300005539 Bacteria 7103
84 Ga0070672_100079998 3300005543 Bacteria 2617
85 Ga0070686_100052380 3300005544 Bacteria 2602
86 Ga0070695_100014195 3300005545 Bacteria 4799
87 Ga0070695_100111148 3300005545 Unclassified 1860
88 Ga0070695_100160474 3300005545 Bacteria 1577
89 Ga0070695_100282126 3300005545 Bacteria 1221
90 Ga0070696_100014545 3300005546 Bacteria 5281
91 Ga0070696_100119608 3300005546 Unclassified 1905
92 Ga0070696_100194185 3300005546 Bacteria 1512
93 Ga0070696_100307883 3300005546 Bacteria 1215
94 Ga0070693_100009604 3300005547 Unclassified 4816
95 Ga0070693_100018746 3300005547 Bacteria 3619
96 Ga0070693_100090281 3300005547 Bacteria 1845
97 Ga0070665_100039350 3300005548 Bacteria 4754
98 Ga0070704_100042465 3300005549 Bacteria 3146
99 Ga0070704_100067213 3300005549 Bacteria 2588
100 Ga0070704_100124128 3300005549 Bacteria 1989
101 Ga0070704_100166658 3300005549 Unclassified 1747
102 Ga0070704_100321982 3300005549 Unclassified 1296
103 Ga0070704_100604155 3300005549 Bacteria 964
104 Ga0070704_100764925 3300005549 Unclassified 861
105 Ga0070664_100099365 3300005564 Bacteria 2529
106 Ga0070664_100240852 3300005564 Bacteria 1624
107 Ga0068857_100084738 3300005577 Bacteria 2832
108 Ga0068857_100240444 3300005577 Bacteria 1657
109 Ga0068854_100129296 3300005578 Bacteria 1927
110 Ga0068854_100223178 3300005578 Bacteria 1492
111 Ga0068854_100517464 3300005578 Unclassified 1007
112 Ga0070702_100021748 3300005615 Bacteria 3381
113 Ga0070702_100023865 3300005615 Unclassified 3256
114 Ga0070702_100064177 3300005615 Unclassified 2147
115 Ga0068852_100215395 3300005616 Bacteria 1824
116 Ga0068859_100043802 3300005617 Unclassified 4498
117 Ga0068859_100059139 3300005617 Bacteria 3861
118 Ga0068859_100104769 3300005617 Bacteria 2888
119 Ga0068859_100124202 3300005617 Bacteria 2649
120 Ga0068859_100246201 3300005617 Bacteria 1877
121 Ga0068859_100249193 3300005617 Bacteria 1866
122 Ga0068859_100348615 3300005617 Unclassified 1575
123 Ga0068859_100494730 3300005617 Unclassified 1318
124 Ga0068859_100760263 3300005617 Bacteria 1058
125 Ga0068864_100006010 3300005618 Bacteria 9965
126 Ga0068864_100024548 3300005618 Bacteria 5072
127 Ga0068864_100046596 3300005618 Bacteria 3720
128 Ga0068864_100444281 3300005618 Bacteria 1239
129 Ga0068864_100445520 3300005618 Bacteria 1238
130 Ga0068864_100928214 3300005618 Bacteria 860
131 Ga0068861_100015826 3300005719 Bacteria 5325
132 Ga0068861_100029238 3300005719 Bacteria 4030
133 Ga0068861_100074211 3300005719 Bacteria 2644
134 Ga0068851_10002663 3300005834 Bacteria 7869
135 Ga0068870_10018105 3300005840 Unclassified 3396
136 Ga0068870_10021603 3300005840 Unclassified 3151
137 Ga0068870_10106633 3300005840 Bacteria 1593
138 Ga0068870_10223277 3300005840 Bacteria 1154
139 Ga0068863_100422890 3300005841 Bacteria 1305
140 Ga0068858_100024283 3300005842 Bacteria 5649
141 Ga0068858_100066756 3300005842 Bacteria 3331
142 Ga0068858_100137713 3300005842 Bacteria 2291
143 Ga0068858_100164594 3300005842 Bacteria 2090
144 Ga0068860_100037258 3300005843 Unclassified 4655
145 Ga0068860_100078909 3300005843 Bacteria 3131
146 Ga0068860_100237076 3300005843 Bacteria 1774
147 Ga0068860_100281445 3300005843 Bacteria 1625
148 Ga0068862_100027762 3300005844 Bacteria 4765
149 Ga0068862_100438480 3300005844 Bacteria 1229
150 Ga0081539_10000360 3300005985 Bacteria 100156
151 Ga0081539_10000669 3300005985 Bacteria 68738
152 Ga0097621_100003835 3300006237 Bacteria 10413
153 Ga0068871_100029981 3300006358 Bacteria 4279
154 Ga0068871_100228178 3300006358 Unclassified 1615
155 Ga0068871_100332210 3300006358 Bacteria 1341
156 Ga0075428_100145235 3300006844 Unclassified 2578
157 Ga0075430_100062246 3300006846 Bacteria 3135
158 Ga0075430_100623740 3300006846 Unclassified 889
159 Ga0075430_100623741 3300006846 Unclassified 889
160 Ga0075431_100139659 3300006847 Bacteria 2498
161 Ga0075433_10010620 3300006852 Bacteria 7403
162 Ga0075433_10069700 3300006852 Bacteria 3089
163 Ga0075434_100050025 3300006871 Bacteria 4151
164 Ga0075434_100080948 3300006871 Bacteria 3244
165 Ga0075429_100063450 3300006880 Bacteria 3218
166 Ga0075429_100067871 3300006880 Bacteria 3104
167 Ga0068865_100005713 3300006881 Bacteria 7561
168 Ga0068865_100049198 3300006881 Unclassified 2904
169 Ga0068865_100136679 3300006881 Bacteria 1843
170 Ga0068865_100211868 3300006881 Bacteria 1510
171 Ga0097620_100043803 3300006931 Unclassified 4498
172 Ga0097620_100059141 3300006931 Bacteria 3861
173 Ga0097620_100076976 3300006931 Bacteria 3376
174 Ga0097620_100104771 3300006931 Bacteria 2888
175 Ga0097620_100124195 3300006931 Bacteria 2649
176 Ga0097620_100246198 3300006931 Bacteria 1877
177 Ga0097620_100249199 3300006931 Bacteria 1866
178 Ga0097620_100348599 3300006931 Unclassified 1575
179 Ga0097620_100494736 3300006931 Unclassified 1318
180 Ga0097620_100760233 3300006931 Bacteria 1058
181 Ga0075435_100005170 3300007076 Bacteria 9075
182 Ga0075435_100069875 3300007076 Bacteria 2865
183 Ga0099794_10168414 3300007265 Bacteria 1116
184 Ga0105251_10076827 3300009011 Bacteria 1549
185 Ga0111539_10021005 3300009094 Bacteria 8039
186 Ga0111539_10458319 3300009094 Unclassified 1485
187 Ga0111539_10561924 3300009094 Bacteria 1329
188 Ga0105245_10063460 3300009098 Bacteria 3335
189 Ga0105247_10020574 3300009101 Bacteria 3967
190 Ga0105247_10099523 3300009101 Bacteria 1857
191 Ga0105247_10506859 3300009101 Bacteria 880
192 Ga0114129_10004845 3300009147 Bacteria 19000
193 Ga0114129_10007705 3300009147 Bacteria 15323
194 Ga0114129_10010635 3300009147 Bacteria 13125
195 Ga0114129_10014212 3300009147 Bacteria 11343
196 Ga0114129_10015657 3300009147 Bacteria 10784
197 Ga0114129_10085804 3300009147 Bacteria 4367
198 Ga0114129_10210834 3300009147 Unclassified 2626
199 Ga0114129_10211037 3300009147 Unclassified 2625
200 Ga0114129_10262468 3300009147 Bacteria 2314
201 Ga0114129_10533761 3300009147 Bacteria 1528
202 Ga0114129_10652162 3300009147 Bacteria 1358
203 Ga0114129_10888694 3300009147 Bacteria 1130
204 Ga0105243_10060344 3300009148 Bacteria 3030
205 Ga0105241_10010731 3300009174 Bacteria 6724
206 Ga0105241_10074489 3300009174 Bacteria 2644
207 Ga0105241_10308966 3300009174 Bacteria 1359
208 Ga0105241_10429938 3300009174 Unclassified 1164
209 Ga0105242_10026849 3300009176 Bacteria 4566
210 Ga0105242_10069534 3300009176 Bacteria 2916
211 Ga0105248_10011605 3300009177 Bacteria 9705
212 Ga0105248_10169486 3300009177 Bacteria 2461
213 Ga0105237_10002569 3300009545 Bacteria 22400
214 Ga0105237_10093543 3300009545 Unclassified 2995
215 Ga0105238_10003652 3300009551 Bacteria 15343
216 Ga0105238_10137717 3300009551 Bacteria 2419
217 Ga0105249_10056024 3300009553 Bacteria 3609
218 Ga0105249_10134878 3300009553 Bacteria 2361
219 Ga0105249_10148179 3300009553 Bacteria 2257
220 Ga0105249_10212086 3300009553 Unclassified 1901
221 Ga0105249_10910486 3300009553 Bacteria 947
222 Ga0105239_10305649 3300010375 Bacteria 1791
223 Ga0105239_10344289 3300010375 Bacteria 1683
224 Ga0105239_10349670 3300010375 Bacteria 1669
225 Ga0105239_11187297 3300010375 Unclassified 879
226 Ga0105246_10034179 3300011119 Bacteria 3385
227 Ga0157373_10006382 3300013100 Bacteria 8809
228 Ga0157373_10017305 3300013100 Bacteria 5248
229 Ga0157373_10050745 3300013100 Unclassified 2954
230 Ga0157374_10036630 3300013296 Bacteria 4495
231 Ga0157378_10005142 3300013297 Bacteria 11487
232 Ga0157378_10068435 3300013297 Bacteria 3184
233 Ga0157378_10147631 3300013297 Bacteria 2189
234 Ga0163162_10001625 3300013306 Bacteria 21041
235 Ga0163162_10020033 3300013306 Bacteria 6569
236 Ga0163162_10023577 3300013306 Bacteria 6075
237 Ga0163162_10061722 3300013306 Unclassified 3786
238 Ga0163162_10080872 3300013306 Bacteria 3318
239 Ga0163162_10156215 3300013306 Bacteria 2401
240 Ga0163162_10396065 3300013306 Bacteria 1513
241 Ga0163162_10523182 3300013306 Bacteria 1315
242 Ga0157372_10027292 3300013307 Bacteria 6217
243 Ga0157375_10004457 3300013308 Bacteria 12159
244 Ga0157375_10127211 3300013308 Unclassified 2664
245 Ga0157375_10219955 3300013308 Bacteria 2057
246 Ga0163163_10000536 3300014325 Bacteria 33560
247 Ga0163163_10003037 3300014325 Bacteria 14218
248 Ga0163163_10013448 3300014325 Bacteria 7496
249 Ga0163163_10046876 3300014325 Bacteria 4246
250 Ga0163163_10079504 3300014325 Unclassified 3277
251 Ga0163163_10097825 3300014325 Bacteria 2955
252 Ga0163163_10308593 3300014325 Bacteria 1635
253 Ga0157380_10002430 3300014326 Bacteria 12552
254 Ga0157380_10011474 3300014326 Bacteria 6405
255 Ga0157380_10075729 3300014326 Bacteria 2736
256 Ga0157380_10084312 3300014326 Bacteria 2605
257 Ga0157380_10170631 3300014326 Unclassified 1901
258 Ga0157377_10007731 3300014745 Bacteria 5206
259 Ga0157377_10082711 3300014745 Unclassified 1880
260 Ga0157377_10119005 3300014745 Bacteria 1598
261 Ga0157376_10087853 3300014969 Bacteria 2684
262 Ga0157376_10654161 3300014969 Unclassified 1052
263 Ga0163161_10039753 3300017792 Bacteria 3378
264 Ga0213876_10016872 3300021384 Bacteria 3858
265 Ga0207656_10004814 3300025321 Bacteria 4736
266 Ga0207653_10002658 3300025885 Bacteria 5672
267 Ga0207710_10003361 3300025900 Bacteria 7151
268 Ga0207680_10064868 3300025903 Unclassified 2240
269 Ga0207647_10202851 3300025904 Bacteria 1147
270 Ga0207643_10055316 3300025908 Bacteria 2257
271 Ga0207684_10000079 3300025910 Bacteria 179842
272 Ga0207684_10011978 3300025910 Bacteria 7552
273 Ga0207684_10049450 3300025910 Bacteria 3566
274 Ga0207707_10097478 3300025912 Bacteria 2570
275 Ga0207707_10156521 3300025912 Bacteria 1993
276 Ga0207671_10003041 3300025914 Bacteria 17169
277 Ga0207660_10015697 3300025917 Bacteria 5002
278 Ga0207662_10029931 3300025918 Bacteria 3157
279 Ga0207662_10058218 3300025918 Unclassified 2312
280 Ga0207662_10137613 3300025918 Bacteria 1545
281 Ga0207662_10254878 3300025918 Bacteria 1153
282 Ga0207662_10465033 3300025918 Bacteria 867
283 Ga0207646_10040681 3300025922 Unclassified 4179
284 Ga0207646_10101272 3300025922 Bacteria 2582
285 Ga0207646_10110864 3300025922 Unclassified 2462
286 Ga0207681_10005287 3300025923 Bacteria 7932
287 Ga0207681_10067150 3300025923 Bacteria 2485
288 Ga0207694_10002743 3300025924 Bacteria 14239
289 Ga0207650_10000001 3300025925 Bacteria 1545726
290 Ga0207650_10000511 3300025925 Bacteria 32409
291 Ga0207650_10106643 3300025925 Bacteria 2164
292 Ga0207650_10237666 3300025925 Bacteria 1471
293 Ga0207650_10391903 3300025925 Unclassified 1148
294 Ga0207659_10321703 3300025926 Bacteria 1276
295 Ga0207659_10603334 3300025926 Unclassified 936
296 Ga0207644_10013351 3300025931 Bacteria 5475
297 Ga0207644_10043332 3300025931 Bacteria 3193
298 Ga0207690_10200137 3300025932 Bacteria 1516
299 Ga0207706_10123703 3300025933 Bacteria 2275
300 Ga0207706_10175161 3300025933 Bacteria 1884
301 Ga0207706_10289353 3300025933 Bacteria 1428
302 Ga0207686_10021258 3300025934 Unclassified 3721
303 Ga0207709_10080448 3300025935 Bacteria 2098
304 Ga0207709_10325681 3300025935 Bacteria 1152
305 Ga0207670_10113012 3300025936 Bacteria 1961
306 Ga0207704_10007125 3300025938 Bacteria 5263
307 Ga0207704_10092231 3300025938 Bacteria 1993
308 Ga0207704_10216569 3300025938 Bacteria 1414
309 Ga0207704_10326561 3300025938 Bacteria 1186
310 Ga0207665_10006407 3300025939 Bacteria 7809
311 Ga0207691_10011463 3300025940 Bacteria 8506
312 Ga0207691_10124447 3300025940 Bacteria 2282
313 Ga0207711_10036697 3300025941 Bacteria 4160
314 Ga0207711_10186560 3300025941 Bacteria 1888
315 Ga0207711_10834199 3300025941 Bacteria 858
316 Ga0207689_10002487 3300025942 Bacteria 17116
317 Ga0207689_10004823 3300025942 Bacteria 12164
318 Ga0207689_10038757 3300025942 Bacteria 3945
319 Ga0207689_10090788 3300025942 Unclassified 2510
320 Ga0207689_10102581 3300025942 Bacteria 2350
321 Ga0207689_10110925 3300025942 Bacteria 2254
322 Ga0207689_10426443 3300025942 Unclassified 1107
323 Ga0207679_10178178 3300025945 Unclassified 1756
324 Ga0207679_10320548 3300025945 Bacteria 1342
325 Ga0207651_10581725 3300025960 Bacteria 977
326 Ga0207712_10018383 3300025961 Unclassified 4552
327 Ga0207712_10068783 3300025961 Bacteria 2539
328 Ga0207712_10069521 3300025961 Bacteria 2526
329 Ga0207712_10271117 3300025961 Bacteria 1381
330 Ga0207712_10273087 3300025961 Bacteria 1376
331 Ga0207668_10357950 3300025972 Bacteria 1222
332 Ga0207640_10600158 3300025981 Bacteria 932
333 Ga0207658_10062360 3300025986 Unclassified 2790
334 Ga0207658_10175653 3300025986 Bacteria 1769
335 Ga0207658_10265725 3300025986 Bacteria 1464
336 Ga0207677_10048232 3300026023 Bacteria 2866
337 Ga0207677_10280532 3300026023 Bacteria 1367
338 Ga0207703_10019071 3300026035 Bacteria 5358
339 Ga0207703_10091730 3300026035 Unclassified 2556
340 Ga0207703_10402884 3300026035 Bacteria 1270
341 Ga0207703_10578349 3300026035 Bacteria 1061
342 Ga0207639_10349526 3300026041 Bacteria 1320
343 Ga0207678_10151372 3300026067 Bacteria 1981
344 Ga0207708_10000453 3300026075 Bacteria 31845
345 Ga0207708_10006841 3300026075 Bacteria 8434
346 Ga0207641_10031090 3300026088 Bacteria 4426
347 Ga0207641_10470947 3300026088 Bacteria 1216
348 Ga0207648_10121392 3300026089 Bacteria 2298
349 Ga0207648_10775382 3300026089 Bacteria 891
350 Ga0207676_10002604 3300026095 Bacteria 12861
351 Ga0207676_10008472 3300026095 Bacteria 7310
352 Ga0207676_10008972 3300026095 Bacteria 7115
353 Ga0207676_10235118 3300026095 Bacteria 1640
354 Ga0207676_10292746 3300026095 Unclassified 1483
355 Ga0207676_10697549 3300026095 Bacteria 983
356 Ga0207674_10082868 3300026116 Bacteria 3207
357 Ga0207675_100020124 3300026118 Bacteria 6224
358 Ga0207675_100029273 3300026118 Bacteria 5131
359 Ga0207675_100059018 3300026118 Bacteria 3581
360 Ga0207675_100059492 3300026118 Bacteria 3565
361 Ga0207675_100059905 3300026118 Bacteria 3553
362 Ga0207675_100114790 3300026118 Bacteria 2544
363 Ga0207675_100476969 3300026118 Bacteria 1239
364 Ga0207698_10095712 3300026142 Unclassified 2445
365 Ga0207698_10122011 3300026142 Bacteria 2208
366 Ga0207698_10477281 3300026142 Bacteria 1209
367 Ga0207428_10075967 3300027907 Unclassified 2632
368 Ga0268265_10080866 3300028380 Bacteria 2564
369 Ga0268265_10119660 3300028380 Bacteria 2167
370 Ga0268264_10119148 3300028381 Bacteria 2324
371 Ga0268264_10156855 3300028381 Bacteria 2046
372 Ga0268264_10171815 3300028381 Bacteria 1961
373 Ga0268264_10194243 3300028381 Unclassified 1852
374 Ga0268264_10345475 3300028381 Bacteria 1415
375 Ga0307515_10137599 3300028794 Bacteria 2643
376 Ga0307408_100010929 3300031548 Bacteria 5991
377 Ga0307405_10069114 3300031731 Bacteria 2263
378 Ga0307405_10101601 3300031731 Bacteria 1930
379 Ga0307406_10269305 3300031901 Bacteria 1293
380 Ga0307412_10062144 3300031911 Bacteria 2513
381 Ga0307412_10158436 3300031911 Bacteria 1679
382 Ga0307416_100063013 3300032002 Bacteria 3034
383 Ga0307416_100677046 3300032002 Bacteria 1119
384 Ga0307414_10028619 3300032004 Unclassified 3616
385 Ga0307411_10004380 3300032005 Bacteria 6753
386 Ga0307411_10054741 3300032005 Bacteria 2621
387 Ga0307411_10694280 3300032005 Bacteria 886
388 Ga0373951_0003998 3300035091 Bacteria 3538
389 Ga0373931_0090599 3300035691 Bacteria 1703
390 Ga0373937_0211268 3300036401 Bacteria 1826
391 Ga0395900_0106164 3300037418 Bacteria 2885
392 Ga0395905_0081626 3300037471 Bacteria 3030
393 Ga0395901_0477537 3300038443 Bacteria 1272
394 Ga0436365_0325727 3300039437 Bacteria 10237
395 Ga0436365_1023949 3300039437 Bacteria 126686
396 Ga0450889_003585 3300042144 Bacteria 1533
397 Ga0439446_0019691 3300042156 Bacteria 1898
398 Ga0439458_0001971 3300042157 Bacteria 5091
399 Ga0495580_0089521 3300046472 Unclassified 2143
400 Ga0495632_0012621 3300046519 Bacteria 4864
401 Ga0495636_0065896 3300047318 Bacteria 1539
402 Ga0495672_0009111 3300047320 Bacteria 7237
403 Ga0496102_0016105 3300048905 Bacteria 6529
404 Ga0496103_0006385 3300048906 Bacteria 7044
405 Ga0496106_0024733 3300048909 Bacteria 4466
406 Ga0496108_0087919 3300048911 Bacteria 2640
407 Ga0496108_0114793 3300048911 Bacteria 2306
408 Ga0496110_0186383 3300048913 Bacteria 1884
409 Ga0496112_0060757 3300048915 Unclassified 3725
410 Ga0496112_0198225 3300048915 Bacteria 1968
411 Ga0496112_0201026 3300048915 Bacteria 1952
412 Ga0496112_0238658 3300048915 Bacteria 1771
413 Ga0496112_0857860 3300048915 Bacteria 831
414 Ga0496113_0093515 3300048916 Bacteria 2321
415 Ga0496113_0410750 3300048916 Bacteria 1087
416 Ga0501038_0002878 3300049574 Bacteria 16052
417 Ga0501041_0234704 3300049577 Bacteria 1152
418 Ga0501076_0094708 3300049592 Unclassified 2405
419 Ga0501077_0301575 3300049593 Bacteria 1021
420 Ga0501198_002784 3300049649 Unclassified 2368
421 Ga0501198_004151 3300049649 Bacteria 2003
422 Ga0501202_001439 3300049652 Bacteria 3822
423 Ga0501216_030648 3300049660 Unclassified 991
424 Ga0501217_000505 3300049661 Bacteria 6463
425 Ga0501217_022189 3300049661 Unclassified 1504
426 Ga0501223_008050 3300049663 Bacteria 2150
427 Ga0501224_004302 3300049664 Unclassified 2019
428 Ga0501227_001151 3300049665 Bacteria 5913
429 Ga0501228_005642 3300049666 Bacteria 1115
430 Ga0501230_005991 3300049667 Bacteria 1746
431 Ga0501233_005176 3300049668 Bacteria 2415
432 Ga0501235_007561 3300049669 Bacteria 2365
433 Ga0501243_014990 3300049675 Bacteria 1243
434 Ga0501249_005074 3300049679 Unclassified 2689
435 Ga0501251_001493 3300049681 Bacteria 2192
436 Ga0501257_017396 3300049686 Unclassified 1672
437 Ga0501221_009940 3300049704 Unclassified 1679
438 Ga0501225_0002080 3300049705 Bacteria 6222
439 Ga0501225_0014167 3300049705 Bacteria 2228
440 Ga0501225_0046312 3300049705 Bacteria 1205
441 Ga0501229_006358 3300049706 Bacteria 1460
442 Ga0501234_002592 3300049707 Bacteria 2847
443 Ga0501268_007995 3300049765 Unclassified 1590
444 Ga0501273_007057 3300049770 Unclassified 1315
445 Ga0501273_016108 3300049770 Unclassified 976
446 Ga0501279_021114 3300049775 Unclassified 929
447 Ga0501212_023737 3300049851 Unclassified 962
448 Ga0501226_002243 3300049853 Bacteria 2384
449 nmdc:mga05p37_118214_c1 3300050507 Bacteria 3257
450 nmdc:mga05p37_210337_c1 3300050507 Unclassified 2352
451 nmdc:mga05p37_560834_c1 3300050507 Unclassified 1298
452 nmdc:mga05p37_72732_c1 3300050507 Bacteria 4231
453 nmdc:mga09592_63188_c1 3300050508 Bacteria 3133
454 nmdc:mga0qj67_50805_c1 3300050509 Bacteria 3279
455 nmdc:mga0qj67_577204_c1 3300050509 Unclassified 901
456 nmdc:mga0qj67_597210_c1 3300050509 Unclassified 883
457 nmdc:mga08y16_160984_c1 3300050511 Unclassified 2332
458 nmdc:mga08y16_18914_c1 3300050511 Bacteria 7253
459 nmdc:mga08y16_9954_c1 3300050511 Bacteria 9981
460 nmdc:mga0n895_243120_c1 3300050512 Bacteria 1827
461 nmdc:mga0n895_59619_c1 3300050512 Bacteria 3765
462 nmdc:mga0rr50_146662_c1 3300050513 Bacteria 1903
463 nmdc:mga0a205_23175_c1 3300050515 Bacteria 5888
464 nmdc:mga0a205_419483_c1 3300050515 Bacteria 1200
465 nmdc:mga0a205_43333_c1 3300050515 Bacteria 4339
466 nmdc:mga0a205_86764_c1 3300050515 Bacteria 3023
467 Ga0500616_0001248 3300053153 Bacteria 25475
468 Ga0530510_0045465 3300061734 Bacteria 3172

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006852 Ga0075433_10069700 Ga0075433_100697002 223
2 3300006871 Ga0075434_100080948 Ga0075434_1000809484 223
3 3300005293 Ga0065715_10174730 Ga0065715_101747303 233
4 3300005617 Ga0068859_100246201 Ga0068859_1002462012 233
5 3300006931 Ga0097620_100246198 Ga0097620_1002461982 233
6 3300009101 Ga0105247_10020574 Ga0105247_100205742 233
7 3300025900 Ga0207710_10003361 Ga0207710_100033612 233
8 3300025918 Ga0207662_10137613 Ga0207662_101376134 233
9 3300026035 Ga0207703_10091730 Ga0207703_100917304 233
10 3300026041 Ga0207639_10349526 Ga0207639_103495261 233
11 3300028381 Ga0268264_10194243 Ga0268264_101942433 233
12 3300005719 Ga0068861_100029238 Ga0068861_1000292383 236
13 3300026118 Ga0207675_100029273 Ga0207675_1000292734 236
14 3300005577 Ga0068857_100084738 Ga0068857_1000847383 238
15 3300037471 Ga0395905_0081626 Ga0395905_0081626_1781_2497 238
16 3300049661 Ga0501217_022189 Ga0501217_022189_25_792 239
17 3300005547 Ga0070693_100018746 Ga0070693_1000187464 240
18 3300005549 Ga0070704_100067213 Ga0070704_1000672133 240
19 3300049705 Ga0501225_0014167 Ga0501225_0014167_1188_1955 240
20 3300005445 Ga0070708_100372552 Ga0070708_1003725522 241
21 3300025922 Ga0207646_10101272 Ga0207646_101012723 241
22 3300005467 Ga0070706_100032074 Ga0070706_1000320743 242
23 3300005468 Ga0070707_100115525 Ga0070707_1001155253 242
24 3300005471 Ga0070698_100092459 Ga0070698_1000924593 242
25 3300005536 Ga0070697_100040500 Ga0070697_1000405003 242
26 3300005545 Ga0070695_100160474 Ga0070695_1001604742 242
27 3300005549 Ga0070704_100166658 Ga0070704_1001666583 242
28 3300025942 Ga0207689_10038757 Ga0207689_100387575 242
29 3300025945 Ga0207679_10320548 Ga0207679_103205481 242
30 3300047320 Ga0495672_0009111 Ga0495672_0009111_5527_6276 244
31 3300005471 Ga0070698_100425461 Ga0070698_1004254611 245
32 3300007076 Ga0075435_100005170 Ga0075435_1000051707 245
33 3300009147 Ga0114129_10652162 Ga0114129_106521621 245
34 3300005338 Ga0068868_100160700 Ga0068868_1001607002 246
35 3300005345 Ga0070692_10008884 Ga0070692_100088843 246
36 3300005354 Ga0070675_100337154 Ga0070675_1003371542 246
37 3300005438 Ga0070701_10210475 Ga0070701_102104751 246
38 3300005441 Ga0070700_100093187 Ga0070700_1000931872 246
39 3300005444 Ga0070694_100030939 Ga0070694_1000309392 246
40 3300005467 Ga0070706_100909896 Ga0070706_1009098961 246
41 3300005471 Ga0070698_100046727 Ga0070698_1000467272 246
42 3300005518 Ga0070699_100023225 Ga0070699_1000232252 246
43 3300005530 Ga0070679_100148826 Ga0070679_1001488261 246
44 3300005539 Ga0068853_100011800 Ga0068853_1000118005 246
45 3300005545 Ga0070695_100111148 Ga0070695_1001111482 246
46 3300005547 Ga0070693_100009604 Ga0070693_1000096044 246
47 3300005549 Ga0070704_100124128 Ga0070704_1001241282 246
48 3300005549 Ga0070704_100764925 Ga0070704_1007649251 246
49 3300005577 Ga0068857_100240444 Ga0068857_1002404442 246
50 3300005578 Ga0068854_100129296 Ga0068854_1001292963 246
51 3300005617 Ga0068859_100348615 Ga0068859_1003486152 246
52 3300005618 Ga0068864_100024548 Ga0068864_1000245484 246
53 3300005618 Ga0068864_100445520 Ga0068864_1004455202 246
54 3300005834 Ga0068851_10002663 Ga0068851_100026634 246
55 3300005842 Ga0068858_100164594 Ga0068858_1001645941 246
56 3300005843 Ga0068860_100078909 Ga0068860_1000789092 246
57 3300006846 Ga0075430_100623740 Ga0075430_1006237401 246
58 3300006846 Ga0075430_100623741 Ga0075430_1006237411 246
59 3300006847 Ga0075431_100139659 Ga0075431_1001396593 246
60 3300006852 Ga0075433_10010620 Ga0075433_100106203 246
61 3300006880 Ga0075429_100063450 Ga0075429_1000634501 246
62 3300006881 Ga0068865_100005713 Ga0068865_10000571310 246
63 3300006931 Ga0097620_100076976 Ga0097620_1000769766 246
64 3300006931 Ga0097620_100348599 Ga0097620_1003485992 246
65 3300009011 Ga0105251_10076827 Ga0105251_100768272 246
66 3300009101 Ga0105247_10099523 Ga0105247_100995233 246
67 3300009147 Ga0114129_10085804 Ga0114129_100858044 246
68 3300009147 Ga0114129_10888694 Ga0114129_108886941 246
69 3300009148 Ga0105243_10060344 Ga0105243_100603444 246
70 3300009174 Ga0105241_10308966 Ga0105241_103089663 246
71 3300009174 Ga0105241_10429938 Ga0105241_104299381 246
72 3300009177 Ga0105248_10169486 Ga0105248_101694863 246
73 3300009545 Ga0105237_10002569 Ga0105237_100025698 246
74 3300009553 Ga0105249_10056024 Ga0105249_100560244 246
75 3300010375 Ga0105239_11187297 Ga0105239_111872971 246
76 3300013100 Ga0157373_10017305 Ga0157373_100173054 246
77 3300013100 Ga0157373_10050745 Ga0157373_100507453 246
78 3300013306 Ga0163162_10023577 Ga0163162_100235776 246
79 3300013306 Ga0163162_10523182 Ga0163162_105231821 246
80 3300013307 Ga0157372_10027292 Ga0157372_100272925 246
81 3300013308 Ga0157375_10219955 Ga0157375_102199552 246
82 3300014325 Ga0163163_10000536 Ga0163163_1000053624 246
83 3300014325 Ga0163163_10003037 Ga0163163_1000303711 246
84 3300014325 Ga0163163_10308593 Ga0163163_103085933 246
85 3300014745 Ga0157377_10082711 Ga0157377_100827113 246
86 3300014745 Ga0157377_10119005 Ga0157377_101190052 246
87 3300025321 Ga0207656_10004814 Ga0207656_100048145 246
88 3300025885 Ga0207653_10002658 Ga0207653_100026584 246
89 3300025904 Ga0207647_10202851 Ga0207647_102028511 246
90 3300025912 Ga0207707_10156521 Ga0207707_101565212 246
91 3300025914 Ga0207671_10003041 Ga0207671_1000304110 246
92 3300025918 Ga0207662_10029931 Ga0207662_100299314 246
93 3300025922 Ga0207646_10040681 Ga0207646_100406813 246
94 3300025925 Ga0207650_10000001 Ga0207650_10000001116 246
95 3300025925 Ga0207650_10237666 Ga0207650_102376662 246
96 3300025926 Ga0207659_10603334 Ga0207659_106033341 246
97 3300025932 Ga0207690_10200137 Ga0207690_102001371 246
98 3300025935 Ga0207709_10325681 Ga0207709_103256811 246
99 3300025938 Ga0207704_10007125 Ga0207704_100071256 246
100 3300025941 Ga0207711_10036697 Ga0207711_100366974 246
101 3300025941 Ga0207711_10834199 Ga0207711_108341991 246
102 3300025942 Ga0207689_10090788 Ga0207689_100907882 246
103 3300025961 Ga0207712_10018383 Ga0207712_100183833 246
104 3300025986 Ga0207658_10175653 Ga0207658_101756532 246
105 3300026035 Ga0207703_10402884 Ga0207703_104028842 246
106 3300026067 Ga0207678_10151372 Ga0207678_101513723 246
107 3300026075 Ga0207708_10000453 Ga0207708_100004537 246
108 3300026088 Ga0207641_10031090 Ga0207641_100310903 246
109 3300026088 Ga0207641_10470947 Ga0207641_104709472 246
110 3300026089 Ga0207648_10775382 Ga0207648_107753821 246
111 3300026095 Ga0207676_10002604 Ga0207676_1000260410 246
112 3300026095 Ga0207676_10008972 Ga0207676_100089721 246
113 3300026095 Ga0207676_10292746 Ga0207676_102927462 246
114 3300026118 Ga0207675_100059905 Ga0207675_1000599053 246
115 3300026142 Ga0207698_10095712 Ga0207698_100957123 246
116 3300028381 Ga0268264_10345475 Ga0268264_103454752 246
117 3300031548 Ga0307408_100010929 Ga0307408_1000109293 246
118 3300031731 Ga0307405_10069114 Ga0307405_100691142 246
119 3300031731 Ga0307405_10101601 Ga0307405_101016012 246
120 3300031911 Ga0307412_10062144 Ga0307412_100621443 246
121 3300032002 Ga0307416_100063013 Ga0307416_1000630132 246
122 3300032004 Ga0307414_10028619 Ga0307414_100286194 246
123 3300032005 Ga0307411_10054741 Ga0307411_100547414 246
124 3300035091 Ga0373951_0003998 Ga0373951_0003998_1790_2539 246
125 3300035691 Ga0373931_0090599 Ga0373931_0090599_935_1675 246
126 3300042144 Ga0450889_003585 Ga0450889_003585_38_778 246
127 3300042157 Ga0439458_0001971 Ga0439458_0001971_1888_2628 246
128 3300048911 Ga0496108_0087919 Ga0496108_0087919_888_1628 246
129 3300048913 Ga0496110_0186383 Ga0496110_0186383_70_810 246
130 3300048915 Ga0496112_0198225 Ga0496112_0198225_637_1377 246
131 3300048915 Ga0496112_0238658 Ga0496112_0238658_41_781 246
132 3300048915 Ga0496112_0857860 Ga0496112_0857860_30_770 246
133 3300048916 Ga0496113_0410750 Ga0496113_0410750_181_921 246
134 3300049577 Ga0501041_0234704 Ga0501041_0234704_329_1069 246
135 3300049649 Ga0501198_004151 Ga0501198_004151_1034_1774 246
136 3300049652 Ga0501202_001439 Ga0501202_001439_851_1591 246
137 3300049660 Ga0501216_030648 Ga0501216_030648_224_964 246
138 3300049661 Ga0501217_000505 Ga0501217_000505_1398_2138 246
139 3300049663 Ga0501223_008050 Ga0501223_008050_180_920 246
140 3300049664 Ga0501224_004302 Ga0501224_004302_337_1077 246
141 3300049665 Ga0501227_001151 Ga0501227_001151_2558_3298 246
142 3300049668 Ga0501233_005176 Ga0501233_005176_445_1185 246
143 3300049669 Ga0501235_007561 Ga0501235_007561_629_1369 246
144 3300049675 Ga0501243_014990 Ga0501243_014990_429_1169 246
145 3300049681 Ga0501251_001493 Ga0501251_001493_892_1632 246
146 3300049686 Ga0501257_017396 Ga0501257_017396_154_894 246
147 3300049705 Ga0501225_0002080 Ga0501225_0002080_4192_4932 246
148 3300049705 Ga0501225_0046312 Ga0501225_0046312_160_900 246
149 3300049707 Ga0501234_002592 Ga0501234_002592_499_1239 246
150 3300049765 Ga0501268_007995 Ga0501268_007995_720_1460 246
151 3300049853 Ga0501226_002243 Ga0501226_002243_21_761 246
152 3300050508 nmdc:mga09592_63188_c1 nmdc:mga09592_63188_c1_2010_2750 246
153 3300050509 nmdc:mga0qj67_577204_c1 nmdc:mga0qj67_577204_c1_42_782 246
154 3300050509 nmdc:mga0qj67_597210_c1 nmdc:mga0qj67_597210_c1_102_842 246
155 3300050515 nmdc:mga0a205_43333_c1 nmdc:mga0a205_43333_c1_2991_3731 246
156 3300003320 rootH2_10242010 rootH2_102420101 247
157 3300003322 rootL2_10076314 rootL2_100763144 247
158 3300005289 Ga0065704_10097050 Ga0065704_100970503 247
159 3300005290 Ga0065712_10006595 Ga0065712_100065953 247
160 3300005290 Ga0065712_10099388 Ga0065712_100993881 247
161 3300005290 Ga0065712_10219704 Ga0065712_102197041 247
162 3300005293 Ga0065715_10010167 Ga0065715_100101672 247
163 3300005293 Ga0065715_10018518 Ga0065715_100185182 247
164 3300005293 Ga0065715_10106098 Ga0065715_101060982 247
165 3300005330 Ga0070690_100029181 Ga0070690_1000291813 247
166 3300005330 Ga0070690_100034203 Ga0070690_1000342033 247
167 3300005331 Ga0070670_100039439 Ga0070670_1000394394 247
168 3300005331 Ga0070670_100532682 Ga0070670_1005326821 247
169 3300005334 Ga0068869_100029301 Ga0068869_1000293014 247
170 3300005334 Ga0068869_100040781 Ga0068869_1000407812 247
171 3300005334 Ga0068869_100050162 Ga0068869_1000501623 247
172 3300005334 Ga0068869_100170311 Ga0068869_1001703111 247
173 3300005335 Ga0070666_10156084 Ga0070666_101560842 247
174 3300005336 Ga0070680_100385705 Ga0070680_1003857052 247
175 3300005338 Ga0068868_100033094 Ga0068868_1000330943 247
176 3300005340 Ga0070689_100008318 Ga0070689_1000083186 247
177 3300005340 Ga0070689_100129061 Ga0070689_1001290613 247
178 3300005343 Ga0070687_100208109 Ga0070687_1002081092 247
179 3300005343 Ga0070687_100224192 Ga0070687_1002241922 247
180 3300005345 Ga0070692_10021029 Ga0070692_100210294 247
181 3300005353 Ga0070669_100008246 Ga0070669_1000082463 247
182 3300005354 Ga0070675_100094481 Ga0070675_1000944812 247
183 3300005354 Ga0070675_100295847 Ga0070675_1002958471 247
184 3300005354 Ga0070675_100570559 Ga0070675_1005705591 247
185 3300005355 Ga0070671_100157580 Ga0070671_1001575803 247
186 3300005367 Ga0070667_100203329 Ga0070667_1002033292 247
187 3300005367 Ga0070667_100342871 Ga0070667_1003428711 247
188 3300005438 Ga0070701_10044736 Ga0070701_100447362 247
189 3300005438 Ga0070701_10063286 Ga0070701_100632862 247
190 3300005438 Ga0070701_10094097 Ga0070701_100940972 247
191 3300005440 Ga0070705_100132679 Ga0070705_1001326792 247
192 3300005440 Ga0070705_100205908 Ga0070705_1002059082 247
193 3300005441 Ga0070700_100003376 Ga0070700_1000033764 247
194 3300005441 Ga0070700_100033324 Ga0070700_1000333243 247
195 3300005441 Ga0070700_100046348 Ga0070700_1000463484 247
196 3300005441 Ga0070700_100052074 Ga0070700_1000520743 247
197 3300005444 Ga0070694_100118121 Ga0070694_1001181212 247
198 3300005444 Ga0070694_100227780 Ga0070694_1002277802 247
199 3300005444 Ga0070694_100378696 Ga0070694_1003786961 247
200 3300005444 Ga0070694_100416024 Ga0070694_1004160241 247
201 3300005445 Ga0070708_100015570 Ga0070708_1000155705 247
202 3300005445 Ga0070708_100763713 Ga0070708_1007637131 247
203 3300005457 Ga0070662_100050413 Ga0070662_1000504133 247
204 3300005457 Ga0070662_100226391 Ga0070662_1002263911 247
205 3300005459 Ga0068867_100082686 Ga0068867_1000826863 247
206 3300005459 Ga0068867_100086858 Ga0068867_1000868582 247
207 3300005459 Ga0068867_100896181 Ga0068867_1008961811 247
208 3300005467 Ga0070706_100000019 Ga0070706_100000019113 247
209 3300005467 Ga0070706_100030351 Ga0070706_1000303514 247
210 3300005467 Ga0070706_100062091 Ga0070706_1000620913 247
211 3300005467 Ga0070706_100067407 Ga0070706_1000674073 247
212 3300005468 Ga0070707_100297758 Ga0070707_1002977582 247
213 3300005468 Ga0070707_100454386 Ga0070707_1004543862 247
214 3300005471 Ga0070698_100011152 Ga0070698_1000111526 247
215 3300005471 Ga0070698_100032837 Ga0070698_1000328375 247
216 3300005518 Ga0070699_100104626 Ga0070699_1001046263 247
217 3300005518 Ga0070699_100565447 Ga0070699_1005654471 247
218 3300005536 Ga0070697_100000042 Ga0070697_10000004263 247
219 3300005536 Ga0070697_100007191 Ga0070697_1000071915 247
220 3300005536 Ga0070697_100027035 Ga0070697_1000270353 247
221 3300005543 Ga0070672_100079998 Ga0070672_1000799981 247
222 3300005544 Ga0070686_100052380 Ga0070686_1000523802 247
223 3300005545 Ga0070695_100014195 Ga0070695_1000141952 247
224 3300005545 Ga0070695_100282126 Ga0070695_1002821262 247
225 3300005546 Ga0070696_100014545 Ga0070696_1000145453 247
226 3300005546 Ga0070696_100119608 Ga0070696_1001196082 247
227 3300005546 Ga0070696_100194185 Ga0070696_1001941851 247
228 3300005546 Ga0070696_100307883 Ga0070696_1003078831 247
229 3300005547 Ga0070693_100090281 Ga0070693_1000902813 247
230 3300005548 Ga0070665_100039350 Ga0070665_1000393504 247
231 3300005549 Ga0070704_100042465 Ga0070704_1000424653 247
232 3300005549 Ga0070704_100321982 Ga0070704_1003219822 247
233 3300005549 Ga0070704_100604155 Ga0070704_1006041551 247
234 3300005564 Ga0070664_100099365 Ga0070664_1000993654 247
235 3300005564 Ga0070664_100240852 Ga0070664_1002408522 247
236 3300005578 Ga0068854_100223178 Ga0068854_1002231782 247
237 3300005578 Ga0068854_100517464 Ga0068854_1005174641 247
238 3300005615 Ga0070702_100021748 Ga0070702_1000217484 247
239 3300005615 Ga0070702_100023865 Ga0070702_1000238653 247
240 3300005615 Ga0070702_100064177 Ga0070702_1000641772 247
241 3300005616 Ga0068852_100215395 Ga0068852_1002153952 247
242 3300005617 Ga0068859_100043802 Ga0068859_1000438023 247
243 3300005617 Ga0068859_100059139 Ga0068859_1000591393 247
244 3300005617 Ga0068859_100104769 Ga0068859_1001047692 247
245 3300005617 Ga0068859_100124202 Ga0068859_1001242024 247
246 3300005617 Ga0068859_100249193 Ga0068859_1002491932 247
247 3300005617 Ga0068859_100494730 Ga0068859_1004947302 247
248 3300005617 Ga0068859_100760263 Ga0068859_1007602631 247
249 3300005618 Ga0068864_100006010 Ga0068864_1000060105 247
250 3300005618 Ga0068864_100046596 Ga0068864_1000465962 247
251 3300005618 Ga0068864_100444281 Ga0068864_1004442811 247
252 3300005618 Ga0068864_100928214 Ga0068864_1009282141 247
253 3300005719 Ga0068861_100015826 Ga0068861_1000158265 247
254 3300005719 Ga0068861_100074211 Ga0068861_1000742112 247
255 3300005840 Ga0068870_10018105 Ga0068870_100181053 247
256 3300005840 Ga0068870_10021603 Ga0068870_100216032 247
257 3300005840 Ga0068870_10106633 Ga0068870_101066332 247
258 3300005840 Ga0068870_10223277 Ga0068870_102232771 247
259 3300005841 Ga0068863_100422890 Ga0068863_1004228901 247
260 3300005842 Ga0068858_100024283 Ga0068858_1000242833 247
261 3300005842 Ga0068858_100066756 Ga0068858_1000667564 247
262 3300005842 Ga0068858_100137713 Ga0068858_1001377135 247
263 3300005843 Ga0068860_100037258 Ga0068860_1000372583 247
264 3300005843 Ga0068860_100237076 Ga0068860_1002370763 247
265 3300005843 Ga0068860_100281445 Ga0068860_1002814454 247
266 3300005844 Ga0068862_100027762 Ga0068862_1000277624 247
267 3300005844 Ga0068862_100438480 Ga0068862_1004384801 247
268 3300005985 Ga0081539_10000360 Ga0081539_1000036026 247
269 3300005985 Ga0081539_10000669 Ga0081539_1000066940 247
270 3300006237 Ga0097621_100003835 Ga0097621_1000038354 247
271 3300006358 Ga0068871_100029981 Ga0068871_1000299812 247
272 3300006358 Ga0068871_100228178 Ga0068871_1002281781 247
273 3300006358 Ga0068871_100332210 Ga0068871_1003322102 247
274 3300006844 Ga0075428_100145235 Ga0075428_1001452352 247
275 3300006846 Ga0075430_100062246 Ga0075430_1000622464 247
276 3300006871 Ga0075434_100050025 Ga0075434_1000500254 247
277 3300006880 Ga0075429_100067871 Ga0075429_1000678714 247
278 3300006881 Ga0068865_100049198 Ga0068865_1000491982 247
279 3300006881 Ga0068865_100136679 Ga0068865_1001366792 247
280 3300006881 Ga0068865_100211868 Ga0068865_1002118682 247
281 3300006931 Ga0097620_100043803 Ga0097620_1000438033 247
282 3300006931 Ga0097620_100059141 Ga0097620_1000591413 247
283 3300006931 Ga0097620_100104771 Ga0097620_1001047714 247
284 3300006931 Ga0097620_100124195 Ga0097620_1001241954 247
285 3300006931 Ga0097620_100249199 Ga0097620_1002491992 247
286 3300006931 Ga0097620_100494736 Ga0097620_1004947362 247
287 3300006931 Ga0097620_100760233 Ga0097620_1007602332 247
288 3300007076 Ga0075435_100069875 Ga0075435_1000698752 247
289 3300007265 Ga0099794_10168414 Ga0099794_101684141 247
290 3300009094 Ga0111539_10021005 Ga0111539_100210055 247
291 3300009094 Ga0111539_10458319 Ga0111539_104583192 247
292 3300009094 Ga0111539_10561924 Ga0111539_105619242 247
293 3300009098 Ga0105245_10063460 Ga0105245_100634603 247
294 3300009101 Ga0105247_10506859 Ga0105247_105068591 247
295 3300009147 Ga0114129_10004845 Ga0114129_1000484511 247
296 3300009147 Ga0114129_10007705 Ga0114129_1000770512 247
297 3300009147 Ga0114129_10010635 Ga0114129_100106354 247
298 3300009147 Ga0114129_10014212 Ga0114129_100142124 247
299 3300009147 Ga0114129_10015657 Ga0114129_100156572 247
300 3300009147 Ga0114129_10210834 Ga0114129_102108344 247
301 3300009147 Ga0114129_10211037 Ga0114129_102110372 247
302 3300009147 Ga0114129_10262468 Ga0114129_102624683 247
303 3300009147 Ga0114129_10533761 Ga0114129_105337613 247
304 3300009174 Ga0105241_10010731 Ga0105241_100107316 247
305 3300009174 Ga0105241_10074489 Ga0105241_100744891 247
306 3300009176 Ga0105242_10026849 Ga0105242_100268492 247
307 3300009176 Ga0105242_10069534 Ga0105242_100695343 247
308 3300009177 Ga0105248_10011605 Ga0105248_100116054 247
309 3300009545 Ga0105237_10093543 Ga0105237_100935432 247
310 3300009551 Ga0105238_10003652 Ga0105238_100036528 247
311 3300009551 Ga0105238_10137717 Ga0105238_101377173 247
312 3300009553 Ga0105249_10134878 Ga0105249_101348782 247
313 3300009553 Ga0105249_10148179 Ga0105249_101481793 247
314 3300009553 Ga0105249_10212086 Ga0105249_102120862 247
315 3300009553 Ga0105249_10910486 Ga0105249_109104861 247
316 3300010375 Ga0105239_10305649 Ga0105239_103056492 247
317 3300010375 Ga0105239_10344289 Ga0105239_103442892 247
318 3300010375 Ga0105239_10349670 Ga0105239_103496702 247
319 3300011119 Ga0105246_10034179 Ga0105246_100341792 247
320 3300013100 Ga0157373_10006382 Ga0157373_100063826 247
321 3300013296 Ga0157374_10036630 Ga0157374_100366304 247
322 3300013297 Ga0157378_10005142 Ga0157378_1000514212 247
323 3300013297 Ga0157378_10068435 Ga0157378_100684352 247
324 3300013297 Ga0157378_10147631 Ga0157378_101476313 247
325 3300013306 Ga0163162_10001625 Ga0163162_1000162518 247
326 3300013306 Ga0163162_10020033 Ga0163162_100200333 247
327 3300013306 Ga0163162_10061722 Ga0163162_100617223 247
328 3300013306 Ga0163162_10080872 Ga0163162_100808723 247
329 3300013306 Ga0163162_10156215 Ga0163162_101562151 247
330 3300013306 Ga0163162_10396065 Ga0163162_103960653 247
331 3300013308 Ga0157375_10004457 Ga0157375_100044577 247
332 3300013308 Ga0157375_10127211 Ga0157375_101272113 247
333 3300014325 Ga0163163_10013448 Ga0163163_100134482 247
334 3300014325 Ga0163163_10046876 Ga0163163_100468766 247
335 3300014325 Ga0163163_10079504 Ga0163163_100795043 247
336 3300014325 Ga0163163_10097825 Ga0163163_100978253 247
337 3300014326 Ga0157380_10002430 Ga0157380_1000243012 247
338 3300014326 Ga0157380_10011474 Ga0157380_100114742 247
339 3300014326 Ga0157380_10075729 Ga0157380_100757293 247
340 3300014326 Ga0157380_10084312 Ga0157380_100843122 247
341 3300014326 Ga0157380_10170631 Ga0157380_101706313 247
342 3300014745 Ga0157377_10007731 Ga0157377_100077312 247
343 3300014969 Ga0157376_10087853 Ga0157376_100878531 247
344 3300014969 Ga0157376_10654161 Ga0157376_106541611 247
345 3300017792 Ga0163161_10039753 Ga0163161_100397533 247
346 3300021384 Ga0213876_10016872 Ga0213876_100168723 247
347 3300025903 Ga0207680_10064868 Ga0207680_100648682 247
348 3300025908 Ga0207643_10055316 Ga0207643_100553162 247
349 3300025910 Ga0207684_10000079 Ga0207684_10000079117 247
350 3300025910 Ga0207684_10011978 Ga0207684_100119788 247
351 3300025910 Ga0207684_10049450 Ga0207684_100494503 247
352 3300025912 Ga0207707_10097478 Ga0207707_100974784 247
353 3300025917 Ga0207660_10015697 Ga0207660_100156976 247
354 3300025918 Ga0207662_10058218 Ga0207662_100582183 247
355 3300025918 Ga0207662_10254878 Ga0207662_102548781 247
356 3300025918 Ga0207662_10465033 Ga0207662_104650331 247
357 3300025922 Ga0207646_10110864 Ga0207646_101108642 247
358 3300025923 Ga0207681_10005287 Ga0207681_100052878 247
359 3300025923 Ga0207681_10067150 Ga0207681_100671503 247
360 3300025924 Ga0207694_10002743 Ga0207694_100027432 247
361 3300025925 Ga0207650_10000511 Ga0207650_1000051117 247
362 3300025925 Ga0207650_10106643 Ga0207650_101066432 247
363 3300025925 Ga0207650_10391903 Ga0207650_103919032 247
364 3300025926 Ga0207659_10321703 Ga0207659_103217031 247
365 3300025931 Ga0207644_10013351 Ga0207644_100133518 247
366 3300025931 Ga0207644_10043332 Ga0207644_100433323 247
367 3300025933 Ga0207706_10123703 Ga0207706_101237032 247
368 3300025933 Ga0207706_10175161 Ga0207706_101751612 247
369 3300025933 Ga0207706_10289353 Ga0207706_102893531 247
370 3300025934 Ga0207686_10021258 Ga0207686_100212582 247
371 3300025935 Ga0207709_10080448 Ga0207709_100804482 247
372 3300025936 Ga0207670_10113012 Ga0207670_101130123 247
373 3300025938 Ga0207704_10092231 Ga0207704_100922313 247
374 3300025938 Ga0207704_10216569 Ga0207704_102165692 247
375 3300025938 Ga0207704_10326561 Ga0207704_103265612 247
376 3300025939 Ga0207665_10006407 Ga0207665_100064075 247
377 3300025940 Ga0207691_10011463 Ga0207691_100114633 247
378 3300025940 Ga0207691_10124447 Ga0207691_101244473 247
379 3300025941 Ga0207711_10186560 Ga0207711_101865603 247
380 3300025942 Ga0207689_10002487 Ga0207689_100024879 247
381 3300025942 Ga0207689_10004823 Ga0207689_1000482310 247
382 3300025942 Ga0207689_10102581 Ga0207689_101025812 247
383 3300025942 Ga0207689_10110925 Ga0207689_101109252 247
384 3300025942 Ga0207689_10426443 Ga0207689_104264431 247
385 3300025945 Ga0207679_10178178 Ga0207679_101781781 247
386 3300025960 Ga0207651_10581725 Ga0207651_105817252 247
387 3300025961 Ga0207712_10068783 Ga0207712_100687832 247
388 3300025961 Ga0207712_10069521 Ga0207712_100695215 247
389 3300025961 Ga0207712_10271117 Ga0207712_102711172 247
390 3300025961 Ga0207712_10273087 Ga0207712_102730872 247
391 3300025972 Ga0207668_10357950 Ga0207668_103579502 247
392 3300025981 Ga0207640_10600158 Ga0207640_106001581 247
393 3300025986 Ga0207658_10062360 Ga0207658_100623603 247
394 3300025986 Ga0207658_10265725 Ga0207658_102657252 247
395 3300026023 Ga0207677_10048232 Ga0207677_100482322 247
396 3300026023 Ga0207677_10280532 Ga0207677_102805321 247
397 3300026035 Ga0207703_10019071 Ga0207703_100190714 247
398 3300026035 Ga0207703_10578349 Ga0207703_105783491 247
399 3300026075 Ga0207708_10006841 Ga0207708_100068413 247
400 3300026089 Ga0207648_10121392 Ga0207648_101213922 247
401 3300026095 Ga0207676_10008472 Ga0207676_100084722 247
402 3300026095 Ga0207676_10235118 Ga0207676_102351181 247
403 3300026095 Ga0207676_10697549 Ga0207676_106975491 247
404 3300026116 Ga0207674_10082868 Ga0207674_100828683 247
405 3300026118 Ga0207675_100020124 Ga0207675_1000201243 247
406 3300026118 Ga0207675_100059018 Ga0207675_1000590181 247
407 3300026118 Ga0207675_100059492 Ga0207675_1000594925 247
408 3300026118 Ga0207675_100114790 Ga0207675_1001147903 247
409 3300026118 Ga0207675_100476969 Ga0207675_1004769691 247
410 3300026142 Ga0207698_10122011 Ga0207698_101220112 247
411 3300026142 Ga0207698_10477281 Ga0207698_104772812 247
412 3300027907 Ga0207428_10075967 Ga0207428_100759672 247
413 3300028380 Ga0268265_10080866 Ga0268265_100808662 247
414 3300028380 Ga0268265_10119660 Ga0268265_101196601 247
415 3300028381 Ga0268264_10119148 Ga0268264_101191483 247
416 3300028381 Ga0268264_10156855 Ga0268264_101568551 247
417 3300028381 Ga0268264_10171815 Ga0268264_101718154 247
418 3300028794 Ga0307515_10137599 Ga0307515_101375991 247
419 3300031901 Ga0307406_10269305 Ga0307406_102693051 247
420 3300031911 Ga0307412_10158436 Ga0307412_101584361 247
421 3300032002 Ga0307416_100677046 Ga0307416_1006770461 247
422 3300032005 Ga0307411_10004380 Ga0307411_100043803 247
423 3300032005 Ga0307411_10694280 Ga0307411_106942801 247
424 3300036401 Ga0373937_0211268 Ga0373937_0211268_912_1670 247
425 3300037418 Ga0395900_0106164 Ga0395900_0106164_1713_2471 247
426 3300038443 Ga0395901_0477537 Ga0395901_0477537_62_820 247
427 3300039437 Ga0436365_0325727 Ga0436365_0325727_5861_6616 247
428 3300039437 Ga0436365_1023949 Ga0436365_1023949_19199_19969 247
429 3300042156 Ga0439446_0019691 Ga0439446_0019691_97_858 247
430 3300046472 Ga0495580_0089521 Ga0495580_0089521_81_839 247
431 3300046519 Ga0495632_0012621 Ga0495632_0012621_3327_4079 247
432 3300047318 Ga0495636_0065896 Ga0495636_0065896_733_1494 247
433 3300048905 Ga0496102_0016105 Ga0496102_0016105_2037_2834 247
434 3300048906 Ga0496103_0006385 Ga0496103_0006385_2395_3192 247
435 3300048909 Ga0496106_0024733 Ga0496106_0024733_3312_4076 247
436 3300048911 Ga0496108_0114793 Ga0496108_0114793_1086_1856 247
437 3300048915 Ga0496112_0060757 Ga0496112_0060757_946_1689 247
438 3300048915 Ga0496112_0201026 Ga0496112_0201026_382_1143 247
439 3300048916 Ga0496113_0093515 Ga0496113_0093515_947_1744 247
440 3300049574 Ga0501038_0002878 Ga0501038_0002878_872_1639 247
441 3300049592 Ga0501076_0094708 Ga0501076_0094708_89_835 247
442 3300049593 Ga0501077_0301575 Ga0501077_0301575_146_901 247
443 3300049649 Ga0501198_002784 Ga0501198_002784_662_1408 247
444 3300049666 Ga0501228_005642 Ga0501228_005642_225_971 247
445 3300049667 Ga0501230_005991 Ga0501230_005991_191_937 247
446 3300049679 Ga0501249_005074 Ga0501249_005074_296_1042 247
447 3300049704 Ga0501221_009940 Ga0501221_009940_387_1133 247
448 3300049706 Ga0501229_006358 Ga0501229_006358_337_1083 247
449 3300049770 Ga0501273_007057 Ga0501273_007057_464_1231 247
450 3300049770 Ga0501273_016108 Ga0501273_016108_145_891 247
451 3300049775 Ga0501279_021114 Ga0501279_021114_117_863 247
452 3300049851 Ga0501212_023737 Ga0501212_023737_65_811 247
453 3300050507 nmdc:mga05p37_118214_c1 nmdc:mga05p37_118214_c1_919_1674 247
454 3300050507 nmdc:mga05p37_210337_c1 nmdc:mga05p37_210337_c1_1242_1988 247
455 3300050507 nmdc:mga05p37_560834_c1 nmdc:mga05p37_560834_c1_247_996 247
456 3300050507 nmdc:mga05p37_72732_c1 nmdc:mga05p37_72732_c1_1890_2648 247
457 3300050509 nmdc:mga0qj67_50805_c1 nmdc:mga0qj67_50805_c1_638_1393 247
458 3300050511 nmdc:mga08y16_160984_c1 nmdc:mga08y16_160984_c1_259_1005 247
459 3300050511 nmdc:mga08y16_18914_c1 nmdc:mga08y16_18914_c1_4223_4966 247
460 3300050511 nmdc:mga08y16_9954_c1 nmdc:mga08y16_9954_c1_1383_2129 247
461 3300050512 nmdc:mga0n895_243120_c1 nmdc:mga0n895_243120_c1_587_1330 247
462 3300050512 nmdc:mga0n895_59619_c1 nmdc:mga0n895_59619_c1_1995_2744 247
463 3300050513 nmdc:mga0rr50_146662_c1 nmdc:mga0rr50_146662_c1_780_1541 247
464 3300050515 nmdc:mga0a205_23175_c1 nmdc:mga0a205_23175_c1_1457_2200 247
465 3300050515 nmdc:mga0a205_419483_c1 nmdc:mga0a205_419483_c1_107_850 247
466 3300050515 nmdc:mga0a205_86764_c1 nmdc:mga0a205_86764_c1_1194_1943 247
467 3300053153 Ga0500616_0001248 Ga0500616_0001248_1943_2686 247
468 3300061734 Ga0530510_0045465 Ga0530510_0045465_968_1723 247

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01728

FtsJ

FtsJ-like methyltransferase

62

235

0.95

PF01479

S4

S4 domain

3

50

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3opn-assembly1.cif.gz_A the crystal structure of a putative hemolysin from lactococcus lactis 0.9772 62 245
5eov-assembly1.cif.gz_A c-terminal domain of the 16s/23s rrna (cytidine-2'-o)-methyltransferase tlya. 0.9709 65 247
2cqj-assembly1.cif.gz_A solution structure of the s4 domain of u3 small nucleolar ribonucleoprotein protein imp3 homolog 0.9498 2 45
5wxm-assembly1.cif.gz_A crystal structure of the imp3 and mpp10 complex 0.9473 4 53
8d8l-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 3) 0.9276 4 54
ID Description Score Start End Superfamily
af_C0P590_106_292_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9848 70 247 3.40.50.150
3opnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9743 62 245 3.40.50.150
5eovA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9709 65 247 3.40.50.150
af_Q8I5D3_12_67_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9399 5 54 3.10.290.10
af_P02355_88_184_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9355 5 54 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A3E0KKI0-F1-model_v4 TlyA family rRNA (Cytidine-2'-O)-methyltransferase 0.9912 66 245 GO:0008168
GO:0032259
AF-A0A812A551-F1-model_v4 deleted 0.991 165 246
AF-A0A7W1FBX5-F1-model_v4 TlyA family rRNA (Cytidine-2'-O)-methyltransferase 0.9898 170 244 GO:0008168
GO:0032259
AF-A0A645GDA7-F1-model_v4 16S/23S rRNA (Cytidine-2'-O)-methyltransferase TlyA (EC 2.1.1.226) 0.989 135 246 GO:0008168
GO:0032259
AF-A0A7Z9ZZR2-F1-model_v4 TlyA family RNA methyltransferase 0.9883 74 245 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
91.32 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map