F449990

General Info

Members Datasets Scaffolds Average Seq Length
468 218 936 204

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100010872|Ga0070707_1000108722
Length 231
Sequence MSAERDTQALKPMFTGLVEEVGHVLDRDGARLVVAADRVREDSTVGASVAVNGACLTVVEQGPGRLRFDVGPETLARTALADLSAGDPVNLERPMRLGGVVGGHLVQGHVDGVGIVASFTRQAETARLTIEWRDRSLAPLLIPQGSVAVDGVSLTVARLNARDFEIMIIPHTLAATTLGSLAPGRRVNLEMDMIGKYVQRILQLQAEGMVSRRRAERIRQTRRADTGEGSR

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
3 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
149 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
150 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
151 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
152 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
153 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
154 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
155 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
161 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
162 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
163 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
164 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
165 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
166 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.85
Rhizosphere 98.93
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100010872 3300005468 Bacteria 8478
2 JGI26128J50194_1004456 3300003347 Bacteria 925
3 JGI26129J50193_1000612 3300003349 Bacteria 2270
4 Ga0070676_10028075 3300005328 Bacteria 3195
5 Ga0070690_100252919 3300005330 Bacteria 1247
6 Ga0070670_100042383 3300005331 Bacteria 3912
7 Ga0068869_100002115 3300005334 Bacteria 11939
8 Ga0068869_100003747 3300005334 Bacteria 9355
9 Ga0068869_100005631 3300005334 Bacteria 7896
10 Ga0068869_100341808 3300005334 Bacteria 1218
11 Ga0070680_100000596 3300005336 Bacteria 24956
12 Ga0070680_100019719 3300005336 Bacteria 5348
13 Ga0070680_100146427 3300005336 Bacteria 1982
14 Ga0070682_100004894 3300005337 Bacteria 7433
15 Ga0068868_100043511 3300005338 Bacteria 3508
16 Ga0070660_100002912 3300005339 Bacteria 11784
17 Ga0070691_10002403 3300005341 Bacteria 8304
18 Ga0070691_10003799 3300005341 Bacteria 6820
19 Ga0070691_10166402 3300005341 Bacteria 1140
20 Ga0070661_100000493 3300005344 Bacteria 30240
21 Ga0070669_100364941 3300005353 Bacteria 1175
22 Ga0070675_100206776 3300005354 Bacteria 1705
23 Ga0070674_100058350 3300005356 Bacteria 2683
24 Ga0070674_100638399 3300005356 Bacteria 904
25 Ga0070659_100001178 3300005366 Bacteria 19063
26 Ga0070703_10000945 3300005406 Bacteria 9256
27 Ga0070703_10024800 3300005406 Bacteria 1775
28 Ga0070703_10086912 3300005406 Bacteria 1077
29 Ga0070709_10238520 3300005434 Bacteria 1305
30 Ga0070701_10047518 3300005438 Bacteria 2210
31 Ga0070705_100000310 3300005440 Bacteria 28815
32 Ga0070705_100009794 3300005440 Bacteria 4776
33 Ga0070705_100040264 3300005440 Bacteria 2656
34 Ga0070705_100085901 3300005440 Bacteria 1946
35 Ga0070705_100206968 3300005440 Bacteria 1349
36 Ga0070705_100440221 3300005440 Bacteria 975
37 Ga0070700_100124573 3300005441 Bacteria 1731
38 Ga0070700_100155616 3300005441 Bacteria 1568
39 Ga0070700_100223038 3300005441 Bacteria 1337
40 Ga0070694_100000449 3300005444 Bacteria 22483
41 Ga0070694_100003520 3300005444 Bacteria 9360
42 Ga0070694_100053831 3300005444 Bacteria 2725
43 Ga0070694_100096331 3300005444 Bacteria 2085
44 Ga0070694_100269840 3300005444 Bacteria 1293
45 Ga0070708_100006475 3300005445 Bacteria 9318
46 Ga0070708_100162137 3300005445 Bacteria 2084
47 Ga0070708_100169008 3300005445 Bacteria 2040
48 Ga0070708_100184027 3300005445 Bacteria 1953
49 Ga0070708_100277121 3300005445 Bacteria 1578
50 Ga0070708_100417433 3300005445 Bacteria 1265
51 Ga0070663_100004020 3300005455 Bacteria 8582
52 Ga0070662_100098940 3300005457 Bacteria 2204
53 Ga0070681_10001895 3300005458 Bacteria 18878
54 Ga0068867_100007376 3300005459 Bacteria 7779
55 Ga0068867_100201156 3300005459 Bacteria 1595
56 Ga0070706_100004500 3300005467 Bacteria 13435
57 Ga0070706_100081554 3300005467 Bacteria 2995
58 Ga0070706_100164125 3300005467 Bacteria 2074
59 Ga0070706_100477825 3300005467 Bacteria 1159
60 Ga0070706_101050139 3300005467 Bacteria 751
61 Ga0070707_100010845 3300005468 Bacteria 8487
62 Ga0070707_100024501 3300005468 Bacteria 5716
63 Ga0070707_100118376 3300005468 Bacteria 2571
64 Ga0070707_101189328 3300005468 Bacteria 728
65 Ga0070698_100001902 3300005471 Bacteria 23269
66 Ga0070698_100007225 3300005471 Bacteria 12031
67 Ga0070698_100068564 3300005471 Bacteria 3564
68 Ga0070698_100239188 3300005471 Bacteria 1749
69 Ga0070698_100261525 3300005471 Bacteria 1663
70 Ga0070698_100278143 3300005471 Bacteria 1605
71 Ga0070699_100001516 3300005518 Bacteria 21236
72 Ga0070699_100048530 3300005518 Bacteria 3675
73 Ga0070699_100082990 3300005518 Bacteria 2794
74 Ga0070699_100477404 3300005518 Bacteria 1131
75 Ga0070699_100492970 3300005518 Bacteria 1112
76 Ga0070699_100845311 3300005518 Bacteria 838
77 Ga0070679_100001420 3300005530 Bacteria 21184
78 Ga0070684_100628366 3300005535 Bacteria 999
79 Ga0070697_100057894 3300005536 Bacteria 3153
80 Ga0070697_100155396 3300005536 Bacteria 1931
81 Ga0070697_100159472 3300005536 Bacteria 1905
82 Ga0070697_100225317 3300005536 Bacteria 1598
83 Ga0070697_100226074 3300005536 Bacteria 1595
84 Ga0070697_100779045 3300005536 Unclassified 846
85 Ga0068853_100005309 3300005539 Bacteria 10085
86 Ga0070672_100101634 3300005543 Bacteria 2332
87 Ga0070686_100146095 3300005544 Bacteria 1651
88 Ga0070686_100321994 3300005544 Bacteria 1153
89 Ga0070695_100000383 3300005545 Bacteria 22887
90 Ga0070695_100001085 3300005545 Bacteria 14875
91 Ga0070695_100007233 3300005545 Bacteria 6580
92 Ga0070695_100069015 3300005545 Bacteria 2309
93 Ga0070695_100484680 3300005545 Bacteria 954
94 Ga0070696_100003149 3300005546 Bacteria 10981
95 Ga0070696_100025407 3300005546 Bacteria 4027
96 Ga0070696_100278111 3300005546 Bacteria 1275
97 Ga0070696_100343824 3300005546 Bacteria 1154
98 Ga0070696_100386788 3300005546 Bacteria 1091
99 Ga0070704_100000851 3300005549 Bacteria 15237
100 Ga0070704_100031238 3300005549 Bacteria 3580
101 Ga0070704_100056219 3300005549 Bacteria 2793
102 Ga0070704_100062275 3300005549 Bacteria 2673
103 Ga0068855_100113436 3300005563 Bacteria 3109
104 Ga0068855_100629715 3300005563 Bacteria 1154
105 Ga0070664_100000554 3300005564 Bacteria 28615
106 Ga0068857_100042875 3300005577 Bacteria 4014
107 Ga0068857_100071557 3300005577 Bacteria 3089
108 Ga0068857_100596339 3300005577 Bacteria 1044
109 Ga0068854_100195750 3300005578 Bacteria 1586
110 Ga0068856_100000563 3300005614 Bacteria 40616
111 Ga0068859_100015038 3300005617 Bacteria 7770
112 Ga0068859_100151780 3300005617 Bacteria 2392
113 Ga0068859_100622097 3300005617 Bacteria 1172
114 Ga0068864_100006894 3300005618 Bacteria 9314
115 Ga0068864_100121518 3300005618 Bacteria 2335
116 Ga0068864_100492877 3300005618 Bacteria 1178
117 Ga0068861_100047088 3300005719 Bacteria 3254
118 Ga0068861_100269244 3300005719 Bacteria 1462
119 Ga0068870_10002032 3300005840 Bacteria 8364
120 Ga0068863_100063277 3300005841 Bacteria 3499
121 Ga0068858_100086562 3300005842 Bacteria 2914
122 Ga0068858_100137870 3300005842 Bacteria 2290
123 Ga0068858_100374637 3300005842 Bacteria 1365
124 Ga0068860_100001904 3300005843 Bacteria 22144
125 Ga0068860_100152532 3300005843 Bacteria 2225
126 Ga0068860_100415649 3300005843 Bacteria 1332
127 Ga0068862_100006828 3300005844 Bacteria 9463
128 Ga0068862_100031323 3300005844 Bacteria 4489
129 Ga0068862_100096910 3300005844 Bacteria 2575
130 Ga0068862_100255744 3300005844 Bacteria 1597
131 Ga0068862_100300745 3300005844 Bacteria 1476
132 Ga0081455_10067814 3300005937 Bacteria 2972
133 Ga0081538_10015181 3300005981 Bacteria 5978
134 Ga0070716_100001297 3300006173 Bacteria 11037
135 Ga0075428_100096274 3300006844 Bacteria 3226
136 Ga0075430_100042584 3300006846 Bacteria 3840
137 Ga0075430_100065911 3300006846 Bacteria 3042
138 Ga0075431_100000650 3300006847 Bacteria 29465
139 Ga0075431_100043090 3300006847 Bacteria 4657
140 Ga0075431_100070537 3300006847 Bacteria 3605
141 Ga0075431_100383163 3300006847 Bacteria 1410
142 Ga0075431_100683187 3300006847 Bacteria 1005
143 Ga0075433_10021230 3300006852 Bacteria 5443
144 Ga0075433_10022497 3300006852 Bacteria 5291
145 Ga0075433_10084599 3300006852 Bacteria 2800
146 Ga0075433_10419796 3300006852 Bacteria 1180
147 Ga0075433_10619936 3300006852 Bacteria 949
148 Ga0075434_100010905 3300006871 Bacteria 8544
149 Ga0075434_100012515 3300006871 Bacteria 8047
150 Ga0075434_100026492 3300006871 Bacteria 5681
151 Ga0075434_100064596 3300006871 Bacteria 3644
152 Ga0075434_100132815 3300006871 Bacteria 2509
153 Ga0068865_100238862 3300006881 Bacteria 1429
154 Ga0097620_100015038 3300006931 Bacteria 7770
155 Ga0097620_100151782 3300006931 Bacteria 2392
156 Ga0097620_100622084 3300006931 Bacteria 1172
157 Ga0075435_100031412 3300007076 Bacteria 4183
158 Ga0075435_100041282 3300007076 Bacteria 3687
159 Ga0075435_100368056 3300007076 Bacteria 1234
160 Ga0075435_100472966 3300007076 Bacteria 1082
161 Ga0099794_10029282 3300007265 Bacteria 2565
162 Ga0111539_10001833 3300009094 Bacteria 28260
163 Ga0105245_10017193 3300009098 Bacteria 6309
164 Ga0105245_11827377 3300009098 Bacteria 660
165 Ga0105247_10036206 3300009101 Bacteria 3009
166 Ga0114129_10082748 3300009147 Bacteria 4459
167 Ga0114129_10087028 3300009147 Bacteria 4333
168 Ga0114129_10092760 3300009147 Bacteria 4183
169 Ga0114129_10097879 3300009147 Bacteria 4061
170 Ga0114129_10263985 3300009147 Bacteria 2306
171 Ga0114129_10399168 3300009147 Bacteria 1812
172 Ga0114129_10692055 3300009147 Bacteria 1311
173 Ga0105243_10036667 3300009148 Bacteria 3807
174 Ga0105243_10335831 3300009148 Bacteria 1382
175 Ga0105241_10020973 3300009174 Bacteria 4829
176 Ga0105242_10042926 3300009176 Bacteria 3655
177 Ga0105242_10061261 3300009176 Bacteria 3094
178 Ga0105242_10428472 3300009176 Bacteria 1241
179 Ga0105242_10716889 3300009176 Bacteria 981
180 Ga0105248_10132398 3300009177 Bacteria 2813
181 Ga0105237_10392446 3300009545 Bacteria 1393
182 Ga0105249_10264807 3300009553 Bacteria 1710
183 Ga0105249_10714929 3300009553 Bacteria 1062
184 Ga0105249_10729229 3300009553 Bacteria 1052
185 Ga0105246_10047370 3300011119 Bacteria 2935
186 Ga0157373_10000190 3300013100 Bacteria 50340
187 Ga0157371_10207896 3300013102 Bacteria 1404
188 Ga0157369_10067902 3300013105 Bacteria 3831
189 Ga0163162_10830901 3300013306 Bacteria 1040
190 Ga0157372_10000571 3300013307 Bacteria 40327
191 Ga0157372_10141507 3300013307 Bacteria 2772
192 Ga0157375_10095417 3300013308 Bacteria 3045
193 Ga0157375_10402862 3300013308 Bacteria 1535
194 Ga0157380_10245417 3300014326 Bacteria 1617
195 Ga0206353_10020771 3300020082 Bacteria 1834
196 Ga0213871_10000236 3300021441 Bacteria 6617
197 Ga0207653_10005513 3300025885 Bacteria 3953
198 Ga0207653_10015453 3300025885 Bacteria 2395
199 Ga0207653_10042308 3300025885 Bacteria 1498
200 Ga0207642_10343291 3300025899 Bacteria 878
201 Ga0207699_10347433 3300025906 Bacteria 1046
202 Ga0207645_10000118 3300025907 Bacteria 59887
203 Ga0207645_10012810 3300025907 Bacteria 5678
204 Ga0207643_10000542 3300025908 Bacteria 24208
205 Ga0207643_10334610 3300025908 Bacteria 948
206 Ga0207684_10013122 3300025910 Bacteria 7171
207 Ga0207684_10014129 3300025910 Bacteria 6894
208 Ga0207684_10026226 3300025910 Bacteria 4968
209 Ga0207684_10080105 3300025910 Bacteria 2778
210 Ga0207684_10159869 3300025910 Bacteria 1940
211 Ga0207684_10901963 3300025910 Bacteria 743
212 Ga0207654_10011967 3300025911 Bacteria 4437
213 Ga0207707_10000511 3300025912 Bacteria 39829
214 Ga0207671_10242659 3300025914 Bacteria 1415
215 Ga0207660_10000476 3300025917 Bacteria 26649
216 Ga0207662_10039845 3300025918 Bacteria 2758
217 Ga0207662_10373251 3300025918 Bacteria 962
218 Ga0207657_10004376 3300025919 Bacteria 14950
219 Ga0207649_10020150 3300025920 Bacteria 3821
220 Ga0207652_10000680 3300025921 Bacteria 33219
221 Ga0207646_10002423 3300025922 Bacteria 22026
222 Ga0207646_10020606 3300025922 Bacteria 6107
223 Ga0207646_10044176 3300025922 Bacteria 3999
224 Ga0207646_10132083 3300025922 Bacteria 2247
225 Ga0207646_10133939 3300025922 Bacteria 2231
226 Ga0207646_10240204 3300025922 Bacteria 1637
227 Ga0207646_10490983 3300025922 Bacteria 1107
228 Ga0207646_10581053 3300025922 Bacteria 1006
229 Ga0207646_11157104 3300025922 Bacteria 679
230 Ga0207681_10033454 3300025923 Bacteria 3371
231 Ga0207650_10122751 3300025925 Bacteria 2024
232 Ga0207687_10404023 3300025927 Bacteria 1124
233 Ga0207690_10040187 3300025932 Bacteria 3056
234 Ga0207706_10045693 3300025933 Bacteria 3879
235 Ga0207686_10099683 3300025934 Bacteria 1937
236 Ga0207686_10174932 3300025934 Bacteria 1517
237 Ga0207686_10347163 3300025934 Bacteria 1116
238 Ga0207709_10129367 3300025935 Bacteria 1718
239 Ga0207670_10187978 3300025936 Bacteria 1561
240 Ga0207669_10017937 3300025937 Bacteria 3645
241 Ga0207669_10508945 3300025937 Bacteria 965
242 Ga0207704_10628614 3300025938 Bacteria 882
243 Ga0207665_10010785 3300025939 Bacteria 6000
244 Ga0207691_10049957 3300025940 Bacteria 3831
245 Ga0207711_10375817 3300025941 Bacteria 1318
246 Ga0207689_10000056 3300025942 Bacteria 86419
247 Ga0207689_10005126 3300025942 Bacteria 11778
248 Ga0207689_10006973 3300025942 Bacteria 9935
249 Ga0207679_10001542 3300025945 Bacteria 14407
250 Ga0207667_10001649 3300025949 Bacteria 28125
251 Ga0207712_10354755 3300025961 Bacteria 1220
252 Ga0207640_10006999 3300025981 Bacteria 6207
253 Ga0207677_10050287 3300026023 Bacteria 2819
254 Ga0207703_10304889 3300026035 Bacteria 1454
255 Ga0207703_10363880 3300026035 Bacteria 1334
256 Ga0207703_10646726 3300026035 Bacteria 1003
257 Ga0207639_10004011 3300026041 Bacteria 9938
258 Ga0207678_10009467 3300026067 Bacteria 8570
259 Ga0207708_10117501 3300026075 Bacteria 2070
260 Ga0207702_10001755 3300026078 Bacteria 21338
261 Ga0207641_10027440 3300026088 Bacteria 4702
262 Ga0207641_10095436 3300026088 Bacteria 2610
263 Ga0207648_10012991 3300026089 Bacteria 7771
264 Ga0207648_10228439 3300026089 Bacteria 1655
265 Ga0207648_10730067 3300026089 Bacteria 919
266 Ga0207676_10122407 3300026095 Bacteria 2196
267 Ga0207674_10000173 3300026116 Bacteria 78321
268 Ga0207674_10093321 3300026116 Bacteria 2998
269 Ga0207674_10266940 3300026116 Bacteria 1659
270 Ga0207675_100001847 3300026118 Bacteria 21256
271 Ga0207675_100325824 3300026118 Bacteria 1501
272 Ga0207683_10806389 3300026121 Bacteria 871
273 Ga0209969_1026268 3300027360 Bacteria 880
274 Ga0209981_1008019 3300027378 Bacteria 1430
275 Ga0209996_1002826 3300027395 Bacteria 2159
276 Ga0210000_1026362 3300027462 Bacteria 901
277 Ga0209995_1005506 3300027471 Bacteria 2032
278 Ga0209968_1010922 3300027526 Bacteria 1400
279 Ga0209982_1003386 3300027552 Bacteria 2267
280 Ga0209970_1002962 3300027614 Bacteria 2864
281 Ga0209983_1003434 3300027665 Bacteria 3387
282 Ga0209588_1008964 3300027671 Bacteria 2978
283 Ga0209971_1000021 3300027682 Bacteria 57229
284 Ga0209971_1022771 3300027682 Bacteria 1493
285 Ga0209966_1000061 3300027695 Bacteria 48200
286 Ga0209998_10000036 3300027717 Bacteria 54408
287 Ga0209974_10017355 3300027876 Bacteria 2387
288 Ga0207428_10001404 3300027907 Bacteria 25409
289 Ga0268265_10004254 3300028380 Bacteria 9997
290 Ga0268265_10191070 3300028380 Bacteria 1768
291 Ga0268265_10215391 3300028380 Bacteria 1677
292 Ga0268265_10290872 3300028380 Bacteria 1466
293 Ga0268264_10009315 3300028381 Bacteria 8130
294 Ga0268264_10271482 3300028381 Bacteria 1584
295 Ga0373959_0014477 3300034820 Bacteria 1436
296 Ga0373926_0165681 3300035083 Bacteria 845
297 Ga0373949_0002437 3300035090 Bacteria 4790
298 Ga0373951_0014665 3300035091 Bacteria 1763
299 Ga0373952_0004944 3300035092 Bacteria 2425
300 Ga0373941_0253901 3300035115 Bacteria 687
301 Ga0373954_0049582 3300035118 Bacteria 1969
302 Ga0373960_0017116 3300035121 Bacteria 1874
303 Ga0373933_0111204 3300035724 Bacteria 1709
304 Ga0373947_0187368 3300035725 Bacteria 1349
305 Ga0373937_0605199 3300036401 Bacteria 1040
306 Ga0373925_0478281 3300037068 Bacteria 1021
307 Ga0400489_51562 3300039093 Bacteria 5671
308 Ga0436360_1194011 3300039438 Bacteria 13382
309 Ga0439441_010018 3300042001 Bacteria 1581
310 Ga0439448_0001835 3300042005 Bacteria 5623
311 Ga0439448_0031507 3300042005 Bacteria 1684
312 Ga0439463_110747 3300042016 Bacteria 709
313 Ga0439459_0000096 3300042438 Bacteria 8000
314 Ga0439460_0001483 3300042461 Bacteria 5530
315 Ga0451577_0002554 3300042876 Bacteria 21475
316 Ga0451577_0007383 3300042876 Bacteria 10792
317 Ga0451577_0569085 3300042876 Bacteria 1028
318 Ga0451577_0848350 3300042876 Bacteria 824
319 Ga0453683_0004078 3300044673 Bacteria 10505
320 Ga0453683_0121240 3300044673 Bacteria 1646
321 Ga0453683_0244027 3300044673 Bacteria 1144
322 Ga0453684_0018936 3300044712 Bacteria 10527
323 Ga0453684_0125927 3300044712 Bacteria 3083
324 Ga0453684_0812560 3300044712 Bacteria 1007
325 Ga0451576_0024487 3300045051 Bacteria 6520
326 Ga0451576_0055726 3300045051 Bacteria 4134
327 Ga0451576_0080728 3300045051 Bacteria 3383
328 Ga0451576_0116814 3300045051 Bacteria 2777
329 Ga0451576_0173725 3300045051 Bacteria 2249
330 Ga0451576_1520394 3300045051 Bacteria 695
331 Ga0466967_0270247 3300045976 Unclassified 1629
332 Ga0495629_0449455 3300046459 Bacteria 873
333 Ga0495580_0153648 3300046472 Bacteria 1594
334 Ga0495580_0402908 3300046472 Bacteria 922
335 Ga0495647_0215685 3300046681 Bacteria 846
336 Ga0495674_0046667 3300047319 Bacteria 3845
337 Ga0495676_0133367 3300047321 Bacteria 1790
338 Ga0496109_0378158 3300048912 Bacteria 1338
339 Ga0496112_0190059 3300048915 Bacteria 2016
340 Ga0496112_0383721 3300048915 Bacteria 1346
341 Ga0496112_0954080 3300048915 Bacteria 778
342 Ga0501032_0056422 3300049569 Bacteria 2640
343 Ga0501033_0121300 3300049570 Bacteria 1897
344 Ga0501036_0037784 3300049572 Bacteria 4084
345 Ga0501036_0050862 3300049572 Bacteria 3509
346 Ga0501036_0171973 3300049572 Bacteria 1825
347 Ga0501036_0838803 3300049572 Bacteria 756
348 Ga0501037_0125460 3300049573 Bacteria 1843
349 Ga0501038_0405031 3300049574 Bacteria 1055
350 Ga0501038_0590673 3300049574 Bacteria 841
351 Ga0501039_0072819 3300049575 Bacteria 2670
352 Ga0501039_0096582 3300049575 Bacteria 2304
353 Ga0501039_0522331 3300049575 Bacteria 932
354 Ga0501039_0582517 3300049575 Bacteria 877
355 Ga0501040_0004909 3300049576 Bacteria 8657
356 Ga0501040_0012280 3300049576 Bacteria 5611
357 Ga0501040_0051046 3300049576 Bacteria 2830
358 Ga0501040_0130912 3300049576 Bacteria 1764
359 Ga0501040_0779968 3300049576 Bacteria 691
360 Ga0501040_0923948 3300049576 Bacteria 632
361 Ga0501041_0003779 3300049577 Bacteria 8712
362 Ga0501041_0024931 3300049577 Bacteria 3592
363 Ga0501041_0283190 3300049577 Bacteria 1043
364 Ga0501042_0014277 3300049578 Bacteria 5420
365 Ga0501042_0115907 3300049578 Bacteria 1929
366 Ga0501042_0165771 3300049578 Bacteria 1594
367 Ga0501042_0674438 3300049578 Bacteria 751
368 Ga0501043_0126383 3300049579 Bacteria 2005
369 Ga0501043_0236774 3300049579 Bacteria 1409
370 Ga0501043_0427627 3300049579 Bacteria 998
371 Ga0501046_0007433 3300049580 Bacteria 9630
372 Ga0501046_0014397 3300049580 Bacteria 6677
373 Ga0501046_0229201 3300049580 Bacteria 1373
374 Ga0501046_0402138 3300049580 Bacteria 989
375 Ga0501047_0177470 3300049581 Bacteria 1997
376 Ga0501047_0205818 3300049581 Bacteria 1827
377 Ga0501048_0014242 3300049582 Bacteria 5890
378 Ga0501068_0017917 3300049584 Bacteria 4100
379 Ga0501068_0566981 3300049584 Bacteria 739
380 Ga0501070_0063752 3300049586 Bacteria 3052
381 Ga0501071_0077649 3300049587 Bacteria 2426
382 Ga0501071_0266192 3300049587 Bacteria 1295
383 Ga0501071_0451524 3300049587 Bacteria 984
384 Ga0501072_0133787 3300049588 Bacteria 1977
385 Ga0501072_0264949 3300049588 Bacteria 1367
386 Ga0501072_0359904 3300049588 Bacteria 1155
387 Ga0501072_0473088 3300049588 Bacteria 992
388 Ga0501073_0588177 3300049589 Bacteria 769
389 Ga0501074_0056998 3300049590 Bacteria 2815
390 Ga0501074_0175245 3300049590 Bacteria 1530
391 Ga0501074_0221153 3300049590 Bacteria 1348
392 Ga0501075_0013575 3300049591 Bacteria 5817
393 Ga0501075_0020832 3300049591 Bacteria 4773
394 Ga0501075_0070706 3300049591 Bacteria 2637
395 Ga0501075_0290586 3300049591 Bacteria 1245
396 Ga0501076_0020404 3300049592 Bacteria 5073
397 Ga0501076_0046805 3300049592 Bacteria 3418
398 Ga0501076_0122093 3300049592 Bacteria 2109
399 Ga0501076_0376864 3300049592 Bacteria 1166
400 Ga0501076_0704480 3300049592 Bacteria 833
401 Ga0501077_0005991 3300049593 Bacteria 7427
402 Ga0501077_0016046 3300049593 Bacteria 4718
403 Ga0501077_0016206 3300049593 Bacteria 4694
404 Ga0501077_0107361 3300049593 Bacteria 1769
405 Ga0501079_0002682 3300049741 Bacteria 12946
406 Ga0501079_0004483 3300049741 Bacteria 10360
407 Ga0501079_0189587 3300049741 Bacteria 1604
408 Ga0501079_0253495 3300049741 Bacteria 1375
409 Ga0501079_0636465 3300049741 Bacteria 840
410 Ga0501080_0031476 3300049742 Bacteria 4943
411 Ga0501080_0139297 3300049742 Bacteria 2244
412 Ga0501081_0001924 3300049743 Bacteria 12889
413 Ga0501081_0020397 3300049743 Bacteria 4417
414 Ga0501081_0021972 3300049743 Bacteria 4264
415 Ga0501081_0104647 3300049743 Bacteria 2004
416 Ga0501081_0380881 3300049743 Bacteria 1042
417 Ga0501081_0629215 3300049743 Bacteria 804
418 Ga0501083_0041151 3300049744 Bacteria 3134
419 Ga0501083_0164219 3300049744 Bacteria 1452
420 Ga0501035_0258560 3300049822 Bacteria 1477
421 Ga0501035_0385118 3300049822 Bacteria 1169
422 Ga0501045_0001693 3300049824 Bacteria 14849
423 Ga0501045_0042093 3300049824 Bacteria 3325
424 Ga0501045_0174396 3300049824 Bacteria 1602
425 Ga0501045_0385363 3300049824 Bacteria 1043
426 nmdc:mga05p37_104242_c1 3300050507 Bacteria 3489
427 nmdc:mga05p37_1078039_c1 3300050507 Bacteria 844
428 nmdc:mga05p37_33784_c1 3300050507 Bacteria 6265
429 nmdc:mga05p37_72751_c1 3300050507 Bacteria 4230
430 nmdc:mga05p37_95544_c1 3300050507 Bacteria 3661
431 nmdc:mga09592_367440_c1 3300050508 Bacteria 1244
432 nmdc:mga0qj67_38696_c1 3300050509 Bacteria 3742
433 nmdc:mga0qj67_51290_c1 3300050509 Bacteria 3262
434 nmdc:mga06r32_398839_c1 3300050510 Bacteria 1358
435 nmdc:mga06r32_97869_c1 3300050510 Bacteria 2875
436 nmdc:mga06r32_97933_c1 3300050510 Bacteria 2874
437 nmdc:mga08y16_1116525_c1 3300050511 Bacteria 763
438 nmdc:mga08y16_29407_c1 3300050511 Bacteria 5790
439 nmdc:mga08y16_311758_c1 3300050511 Bacteria 1620
440 nmdc:mga0n895_11446_c1 3300050512 Bacteria 7916
441 nmdc:mga0n895_12810_c1 3300050512 Bacteria 7534
442 nmdc:mga0n895_317563_c1 3300050512 Bacteria 1579
443 nmdc:mga0n895_3243_c1 3300050512 Bacteria 13040
444 nmdc:mga0n895_59078_c1 3300050512 Bacteria 3784
445 nmdc:mga0n895_84454_c1 3300050512 Bacteria 3168
446 nmdc:mga0rr50_533909_c1 3300050513 Bacteria 998
447 nmdc:mga0rr50_6241_c1 3300050513 Bacteria 7228
448 nmdc:mga08x19_4988_c1 3300050514 Bacteria 7849
449 nmdc:mga0a205_111729_c1 3300050515 Bacteria 2632
450 nmdc:mga0a205_13250_c1 3300050515 Bacteria 7668
451 nmdc:mga0a205_17130_c1 3300050515 Bacteria 6786
452 nmdc:mga0a205_52687_c1 3300050515 Bacteria 3927
453 nmdc:mga0a205_661704_c1 3300050515 Bacteria 895
454 Ga0501084_0005005 3300054114 Bacteria 10834
455 Ga0501084_0047139 3300054114 Bacteria 3609
456 Ga0501084_0075621 3300054114 Bacteria 2821
457 Ga0501084_0522128 3300054114 Bacteria 1004
458 Ga0501084_0806693 3300054114 Bacteria 790
459 Ga0501082_0003560 3300060353 Bacteria 13600
460 Ga0501082_0004075 3300060353 Bacteria 12750
461 Ga0501082_0034110 3300060353 Bacteria 4390
462 Ga0501082_0240665 3300060353 Bacteria 1575
463 Ga0530510_0000644 3300061734 Bacteria 22487
464 Ga0530510_0010241 3300061734 Bacteria 6569
465 Ga0530510_0014552 3300061734 Bacteria 5551
466 Ga0530510_0023314 3300061734 Bacteria 4409
467 Ga0530510_0045217 3300061734 Bacteria 3181
468 Ga0530510_0076073 3300061734 Bacteria 2439
469 Ga0070707_100010872
470 JGI26128J50194_1004456
471 JGI26129J50193_1000612
472 Ga0070676_10028075
473 Ga0070690_100252919
474 Ga0070670_100042383
475 Ga0068869_100002115
476 Ga0068869_100003747
477 Ga0068869_100005631
478 Ga0068869_100341808
479 Ga0070680_100000596
480 Ga0070680_100019719
481 Ga0070680_100146427
482 Ga0070682_100004894
483 Ga0068868_100043511
484 Ga0070660_100002912
485 Ga0070691_10002403
486 Ga0070691_10003799
487 Ga0070691_10166402
488 Ga0070661_100000493
489 Ga0070669_100364941
490 Ga0070675_100206776
491 Ga0070674_100058350
492 Ga0070674_100638399
493 Ga0070659_100001178
494 Ga0070703_10000945
495 Ga0070703_10024800
496 Ga0070703_10086912
497 Ga0070709_10238520
498 Ga0070701_10047518
499 Ga0070705_100000310
500 Ga0070705_100009794
501 Ga0070705_100040264
502 Ga0070705_100085901
503 Ga0070705_100206968
504 Ga0070705_100440221
505 Ga0070700_100124573
506 Ga0070700_100155616
507 Ga0070700_100223038
508 Ga0070694_100000449
509 Ga0070694_100003520
510 Ga0070694_100053831
511 Ga0070694_100096331
512 Ga0070694_100269840
513 Ga0070708_100006475
514 Ga0070708_100162137
515 Ga0070708_100169008
516 Ga0070708_100184027
517 Ga0070708_100277121
518 Ga0070708_100417433
519 Ga0070663_100004020
520 Ga0070662_100098940
521 Ga0070681_10001895
522 Ga0068867_100007376
523 Ga0068867_100201156
524 Ga0070706_100004500
525 Ga0070706_100081554
526 Ga0070706_100164125
527 Ga0070706_100477825
528 Ga0070706_101050139
529 Ga0070707_100010845
530 Ga0070707_100024501
531 Ga0070707_100118376
532 Ga0070707_101189328
533 Ga0070698_100001902
534 Ga0070698_100007225
535 Ga0070698_100068564
536 Ga0070698_100239188
537 Ga0070698_100261525
538 Ga0070698_100278143
539 Ga0070699_100001516
540 Ga0070699_100048530
541 Ga0070699_100082990
542 Ga0070699_100477404
543 Ga0070699_100492970
544 Ga0070699_100845311
545 Ga0070679_100001420
546 Ga0070684_100628366
547 Ga0070697_100057894
548 Ga0070697_100155396
549 Ga0070697_100159472
550 Ga0070697_100225317
551 Ga0070697_100226074
552 Ga0070697_100779045
553 Ga0068853_100005309
554 Ga0070672_100101634
555 Ga0070686_100146095
556 Ga0070686_100321994
557 Ga0070695_100000383
558 Ga0070695_100001085
559 Ga0070695_100007233
560 Ga0070695_100069015
561 Ga0070695_100484680
562 Ga0070696_100003149
563 Ga0070696_100025407
564 Ga0070696_100278111
565 Ga0070696_100343824
566 Ga0070696_100386788
567 Ga0070704_100000851
568 Ga0070704_100031238
569 Ga0070704_100056219
570 Ga0070704_100062275
571 Ga0068855_100113436
572 Ga0068855_100629715
573 Ga0070664_100000554
574 Ga0068857_100042875
575 Ga0068857_100071557
576 Ga0068857_100596339
577 Ga0068854_100195750
578 Ga0068856_100000563
579 Ga0068859_100015038
580 Ga0068859_100151780
581 Ga0068859_100622097
582 Ga0068864_100006894
583 Ga0068864_100121518
584 Ga0068864_100492877
585 Ga0068861_100047088
586 Ga0068861_100269244
587 Ga0068870_10002032
588 Ga0068863_100063277
589 Ga0068858_100086562
590 Ga0068858_100137870
591 Ga0068858_100374637
592 Ga0068860_100001904
593 Ga0068860_100152532
594 Ga0068860_100415649
595 Ga0068862_100006828
596 Ga0068862_100031323
597 Ga0068862_100096910
598 Ga0068862_100255744
599 Ga0068862_100300745
600 Ga0081455_10067814
601 Ga0081538_10015181
602 Ga0070716_100001297
603 Ga0075428_100096274
604 Ga0075430_100042584
605 Ga0075430_100065911
606 Ga0075431_100000650
607 Ga0075431_100043090
608 Ga0075431_100070537
609 Ga0075431_100383163
610 Ga0075431_100683187
611 Ga0075433_10021230
612 Ga0075433_10022497
613 Ga0075433_10084599
614 Ga0075433_10419796
615 Ga0075433_10619936
616 Ga0075434_100010905
617 Ga0075434_100012515
618 Ga0075434_100026492
619 Ga0075434_100064596
620 Ga0075434_100132815
621 Ga0068865_100238862
622 Ga0097620_100015038
623 Ga0097620_100151782
624 Ga0097620_100622084
625 Ga0075435_100031412
626 Ga0075435_100041282
627 Ga0075435_100368056
628 Ga0075435_100472966
629 Ga0099794_10029282
630 Ga0111539_10001833
631 Ga0105245_10017193
632 Ga0105245_11827377
633 Ga0105247_10036206
634 Ga0114129_10082748
635 Ga0114129_10087028
636 Ga0114129_10092760
637 Ga0114129_10097879
638 Ga0114129_10263985
639 Ga0114129_10399168
640 Ga0114129_10692055
641 Ga0105243_10036667
642 Ga0105243_10335831
643 Ga0105241_10020973
644 Ga0105242_10042926
645 Ga0105242_10061261
646 Ga0105242_10428472
647 Ga0105242_10716889
648 Ga0105248_10132398
649 Ga0105237_10392446
650 Ga0105249_10264807
651 Ga0105249_10714929
652 Ga0105249_10729229
653 Ga0105246_10047370
654 Ga0157373_10000190
655 Ga0157371_10207896
656 Ga0157369_10067902
657 Ga0163162_10830901
658 Ga0157372_10000571
659 Ga0157372_10141507
660 Ga0157375_10095417
661 Ga0157375_10402862
662 Ga0157380_10245417
663 Ga0206353_10020771
664 Ga0213871_10000236
665 Ga0207653_10005513
666 Ga0207653_10015453
667 Ga0207653_10042308
668 Ga0207642_10343291
669 Ga0207699_10347433
670 Ga0207645_10000118
671 Ga0207645_10012810
672 Ga0207643_10000542
673 Ga0207643_10334610
674 Ga0207684_10013122
675 Ga0207684_10014129
676 Ga0207684_10026226
677 Ga0207684_10080105
678 Ga0207684_10159869
679 Ga0207684_10901963
680 Ga0207654_10011967
681 Ga0207707_10000511
682 Ga0207671_10242659
683 Ga0207660_10000476
684 Ga0207662_10039845
685 Ga0207662_10373251
686 Ga0207657_10004376
687 Ga0207649_10020150
688 Ga0207652_10000680
689 Ga0207646_10002423
690 Ga0207646_10020606
691 Ga0207646_10044176
692 Ga0207646_10132083
693 Ga0207646_10133939
694 Ga0207646_10240204
695 Ga0207646_10490983
696 Ga0207646_10581053
697 Ga0207646_11157104
698 Ga0207681_10033454
699 Ga0207650_10122751
700 Ga0207687_10404023
701 Ga0207690_10040187
702 Ga0207706_10045693
703 Ga0207686_10099683
704 Ga0207686_10174932
705 Ga0207686_10347163
706 Ga0207709_10129367
707 Ga0207670_10187978
708 Ga0207669_10017937
709 Ga0207669_10508945
710 Ga0207704_10628614
711 Ga0207665_10010785
712 Ga0207691_10049957
713 Ga0207711_10375817
714 Ga0207689_10000056
715 Ga0207689_10005126
716 Ga0207689_10006973
717 Ga0207679_10001542
718 Ga0207667_10001649
719 Ga0207712_10354755
720 Ga0207640_10006999
721 Ga0207677_10050287
722 Ga0207703_10304889
723 Ga0207703_10363880
724 Ga0207703_10646726
725 Ga0207639_10004011
726 Ga0207678_10009467
727 Ga0207708_10117501
728 Ga0207702_10001755
729 Ga0207641_10027440
730 Ga0207641_10095436
731 Ga0207648_10012991
732 Ga0207648_10228439
733 Ga0207648_10730067
734 Ga0207676_10122407
735 Ga0207674_10000173
736 Ga0207674_10093321
737 Ga0207674_10266940
738 Ga0207675_100001847
739 Ga0207675_100325824
740 Ga0207683_10806389
741 Ga0209969_1026268
742 Ga0209981_1008019
743 Ga0209996_1002826
744 Ga0210000_1026362
745 Ga0209995_1005506
746 Ga0209968_1010922
747 Ga0209982_1003386
748 Ga0209970_1002962
749 Ga0209983_1003434
750 Ga0209588_1008964
751 Ga0209971_1000021
752 Ga0209971_1022771
753 Ga0209966_1000061
754 Ga0209998_10000036
755 Ga0209974_10017355
756 Ga0207428_10001404
757 Ga0268265_10004254
758 Ga0268265_10191070
759 Ga0268265_10215391
760 Ga0268265_10290872
761 Ga0268264_10009315
762 Ga0268264_10271482
763 Ga0373959_0014477
764 Ga0373926_0165681
765 Ga0373949_0002437
766 Ga0373951_0014665
767 Ga0373952_0004944
768 Ga0373941_0253901
769 Ga0373954_0049582
770 Ga0373960_0017116
771 Ga0373933_0111204
772 Ga0373947_0187368
773 Ga0373937_0605199
774 Ga0373925_0478281
775 Ga0400489_51562
776 Ga0436360_1194011
777 Ga0439441_010018
778 Ga0439448_0001835
779 Ga0439448_0031507
780 Ga0439463_110747
781 Ga0439459_0000096
782 Ga0439460_0001483
783 Ga0451577_0002554
784 Ga0451577_0007383
785 Ga0451577_0569085
786 Ga0451577_0848350
787 Ga0453683_0004078
788 Ga0453683_0121240
789 Ga0453683_0244027
790 Ga0453684_0018936
791 Ga0453684_0125927
792 Ga0453684_0812560
793 Ga0451576_0024487
794 Ga0451576_0055726
795 Ga0451576_0080728
796 Ga0451576_0116814
797 Ga0451576_0173725
798 Ga0451576_1520394
799 Ga0466967_0270247
800 Ga0495629_0449455
801 Ga0495580_0153648
802 Ga0495580_0402908
803 Ga0495647_0215685
804 Ga0495674_0046667
805 Ga0495676_0133367
806 Ga0496109_0378158
807 Ga0496112_0190059
808 Ga0496112_0383721
809 Ga0496112_0954080
810 Ga0501032_0056422
811 Ga0501033_0121300
812 Ga0501036_0037784
813 Ga0501036_0050862
814 Ga0501036_0171973
815 Ga0501036_0838803
816 Ga0501037_0125460
817 Ga0501038_0405031
818 Ga0501038_0590673
819 Ga0501039_0072819
820 Ga0501039_0096582
821 Ga0501039_0522331
822 Ga0501039_0582517
823 Ga0501040_0004909
824 Ga0501040_0012280
825 Ga0501040_0051046
826 Ga0501040_0130912
827 Ga0501040_0779968
828 Ga0501040_0923948
829 Ga0501041_0003779
830 Ga0501041_0024931
831 Ga0501041_0283190
832 Ga0501042_0014277
833 Ga0501042_0115907
834 Ga0501042_0165771
835 Ga0501042_0674438
836 Ga0501043_0126383
837 Ga0501043_0236774
838 Ga0501043_0427627
839 Ga0501046_0007433
840 Ga0501046_0014397
841 Ga0501046_0229201
842 Ga0501046_0402138
843 Ga0501047_0177470
844 Ga0501047_0205818
845 Ga0501048_0014242
846 Ga0501068_0017917
847 Ga0501068_0566981
848 Ga0501070_0063752
849 Ga0501071_0077649
850 Ga0501071_0266192
851 Ga0501071_0451524
852 Ga0501072_0133787
853 Ga0501072_0264949
854 Ga0501072_0359904
855 Ga0501072_0473088
856 Ga0501073_0588177
857 Ga0501074_0056998
858 Ga0501074_0175245
859 Ga0501074_0221153
860 Ga0501075_0013575
861 Ga0501075_0020832
862 Ga0501075_0070706
863 Ga0501075_0290586
864 Ga0501076_0020404
865 Ga0501076_0046805
866 Ga0501076_0122093
867 Ga0501076_0376864
868 Ga0501076_0704480
869 Ga0501077_0005991
870 Ga0501077_0016046
871 Ga0501077_0016206
872 Ga0501077_0107361
873 Ga0501079_0002682
874 Ga0501079_0004483
875 Ga0501079_0189587
876 Ga0501079_0253495
877 Ga0501079_0636465
878 Ga0501080_0031476
879 Ga0501080_0139297
880 Ga0501081_0001924
881 Ga0501081_0020397
882 Ga0501081_0021972
883 Ga0501081_0104647
884 Ga0501081_0380881
885 Ga0501081_0629215
886 Ga0501083_0041151
887 Ga0501083_0164219
888 Ga0501035_0258560
889 Ga0501035_0385118
890 Ga0501045_0001693
891 Ga0501045_0042093
892 Ga0501045_0174396
893 Ga0501045_0385363
894 nmdc:mga05p37_104242_c1
895 nmdc:mga05p37_1078039_c1
896 nmdc:mga05p37_33784_c1
897 nmdc:mga05p37_72751_c1
898 nmdc:mga05p37_95544_c1
899 nmdc:mga09592_367440_c1
900 nmdc:mga0qj67_38696_c1
901 nmdc:mga0qj67_51290_c1
902 nmdc:mga06r32_398839_c1
903 nmdc:mga06r32_97869_c1
904 nmdc:mga06r32_97933_c1
905 nmdc:mga08y16_1116525_c1
906 nmdc:mga08y16_29407_c1
907 nmdc:mga08y16_311758_c1
908 nmdc:mga0n895_11446_c1
909 nmdc:mga0n895_12810_c1
910 nmdc:mga0n895_317563_c1
911 nmdc:mga0n895_3243_c1
912 nmdc:mga0n895_59078_c1
913 nmdc:mga0n895_84454_c1
914 nmdc:mga0rr50_533909_c1
915 nmdc:mga0rr50_6241_c1
916 nmdc:mga08x19_4988_c1
917 nmdc:mga0a205_111729_c1
918 nmdc:mga0a205_13250_c1
919 nmdc:mga0a205_17130_c1
920 nmdc:mga0a205_52687_c1
921 nmdc:mga0a205_661704_c1
922 Ga0501084_0005005
923 Ga0501084_0047139
924 Ga0501084_0075621
925 Ga0501084_0522128
926 Ga0501084_0806693
927 Ga0501082_0003560
928 Ga0501082_0004075
929 Ga0501082_0034110
930 Ga0501082_0240665
931 Ga0530510_0000644
932 Ga0530510_0010241
933 Ga0530510_0014552
934 Ga0530510_0023314
935 Ga0530510_0045217
936 Ga0530510_0076073

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00677

Lum_binding

Lumazine binding domain

107

192

0.97

PF00677

Lum_binding

Lumazine binding domain

15

94

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g6i-assembly1.cif.gz_B crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with roseoflavin 0.9515 1 193
1kzl-assembly1.cif.gz_A riboflavin synthase from s.pombe bound to carboxyethyllumazine 0.9488 1 196
4fxu-assembly1.cif.gz_B crystallographic structure of trimeric riboflavin synthase from brucella abortus 0.9452 1 193
4fxu-assembly1.cif.gz_B crystallographic structure of trimeric riboflavin synthase from brucella abortus 0.9398 1 193
4fxu-assembly1.cif.gz_A crystallographic structure of trimeric riboflavin synthase from brucella abortus 0.939 1 191
ID Description Score Start End Superfamily
af_Q2FXG0_101_204_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9737 97 193 2.40.30.20
af_P9WK35_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9712 1 83 2.40.30.20
af_Q9SKU8_64_151_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9613 1 83 2.40.30.20
af_P9WK35_102_200_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9563 97 191 2.40.30.20
af_A0A1D8PP67_110_218_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9543 97 197 2.40.30.20
ID Description Score Start End GO Terms
AF-A0A7X8AJN6-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9822 1 194 GO:0004746
GO:0009231
AF-A0A161SEK3-F1-model_v4 deleted 0.9799 1 191
AF-A0A2E9DB65-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9773 1 190 GO:0004746
GO:0009231
AF-A0A7C3MF41-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9764 1 193 GO:0004746
GO:0009231
AF-A0A537WZP2-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9757 1 194 GO:0004746
GO:0009231

Map