F449915

General Info

Members Datasets Scaffolds Average Seq Length
467 241 934 256

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0118941|Ga0501031_0118941_623_1435
Length 270
Sequence MLHAMSVYADVYRYRELFGSLFRRDLRAKYKGSVLGLAWTLAHPLVLMVVYLLVFSVLWKATATDFDHYWLFLLAGLPAWVFFATSLQAASRSLLENANLIRKVRFPRQLVPLSVVATQVVAFATMLAIVIALSFVVLPEARDTLLLALPVGAAFVVFVSGLALAVASANAVFRDVEHLVSALLLPLFFLTPILYRLEDLPGAESHPWLVDLIHWGNPLTPPIEVLRSQLFFGTAPALGDVVYVVAETLVALVVGAVVFSRVDDRIAAEA

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
144 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
145 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
153 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
154 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
155 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
156 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
157 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
158 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
159 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
160 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
166 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
167 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
173 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
174 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
175 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.5
Nodule 0
Rhizoplane 8.14
Rhizosphere 90.36
Stem 0
Stem Tuber 0
Unclassified 6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0118941 3300049568 Bacteria 1726
2 JGI24738J21930_10011479 3300002075 Bacteria 1948
3 JGI24742J22300_10026624 3300002244 Bacteria 1001
4 JGI25406J46586_10001411 3300003203 Bacteria 11350
5 Ga0070658_10344463 3300005327 Unclassified 1275
6 Ga0070683_100029645 3300005329 Bacteria 4958
7 Ga0070683_100286315 3300005329 Bacteria 1567
8 Ga0070670_100109550 3300005331 Bacteria 2379
9 Ga0068869_100294069 3300005334 Bacteria 1309
10 Ga0070666_10384904 3300005335 Unclassified 1007
11 Ga0070680_100021633 3300005336 Bacteria 5114
12 Ga0070680_100027767 3300005336 Bacteria 4534
13 Ga0070682_100215354 3300005337 Bacteria 1364
14 Ga0068868_100027353 3300005338 Bacteria 4351
15 Ga0068868_100071528 3300005338 Bacteria 2766
16 Ga0070660_100033781 3300005339 Bacteria 3858
17 Ga0070660_100186290 3300005339 Bacteria 1680
18 Ga0070660_100439956 3300005339 Unclassified 1081
19 Ga0070691_10005379 3300005341 Bacteria 5822
20 Ga0070691_10116332 3300005341 Bacteria 1342
21 Ga0070687_100153587 3300005343 Bacteria 1354
22 Ga0070661_100008811 3300005344 Bacteria 6982
23 Ga0070661_100028064 3300005344 Bacteria 4058
24 Ga0070661_100110333 3300005344 Bacteria 2054
25 Ga0070692_10061998 3300005345 Bacteria 1972
26 Ga0070692_10171498 3300005345 Bacteria 1251
27 Ga0070692_10222545 3300005345 Unclassified 1116
28 Ga0070669_100132523 3300005353 Bacteria 1914
29 Ga0070669_100145642 3300005353 Bacteria 1830
30 Ga0070675_100124056 3300005354 Bacteria 2196
31 Ga0070674_100240978 3300005356 Bacteria 1416
32 Ga0070673_100116732 3300005364 Bacteria 2220
33 Ga0070688_100006422 3300005365 Bacteria 6284
34 Ga0070659_100013771 3300005366 Bacteria 6031
35 Ga0070659_100171068 3300005366 Bacteria 1780
36 Ga0070714_100421081 3300005435 Unclassified 1265
37 Ga0070701_10096420 3300005438 Bacteria 1630
38 Ga0070705_100018033 3300005440 Bacteria 3693
39 Ga0070700_100164866 3300005441 Bacteria 1529
40 Ga0070663_100173147 3300005455 Bacteria 1669
41 Ga0070678_100044263 3300005456 Bacteria 3178
42 Ga0070662_100015530 3300005457 Bacteria 5103
43 Ga0070662_100021758 3300005457 Bacteria 4382
44 Ga0070681_10080582 3300005458 Bacteria 3211
45 Ga0070681_10112619 3300005458 Bacteria 2660
46 Ga0070685_10130045 3300005466 Bacteria 1573
47 Ga0070698_100330445 3300005471 Unclassified 1455
48 Ga0070699_100112086 3300005518 Bacteria 2396
49 Ga0070679_100122496 3300005530 Bacteria 2584
50 Ga0070679_100144279 3300005530 Bacteria 2359
51 Ga0070684_100051526 3300005535 Bacteria 3576
52 Ga0070684_100078200 3300005535 Bacteria 2922
53 Ga0070684_100200686 3300005535 Bacteria 1816
54 Ga0070697_100606886 3300005536 Bacteria 962
55 Ga0068853_100016783 3300005539 Bacteria 6032
56 Ga0070672_100050346 3300005543 Bacteria 3243
57 Ga0070696_100115637 3300005546 Bacteria 1936
58 Ga0070696_100321503 3300005546 Bacteria 1191
59 Ga0070693_100026948 3300005547 Bacteria 3107
60 Ga0070665_100138744 3300005548 Bacteria 2435
61 Ga0070704_100065748 3300005549 Bacteria 2612
62 Ga0070704_100118339 3300005549 Bacteria 2030
63 Ga0070664_100005005 3300005564 Bacteria 10618
64 Ga0070664_100012702 3300005564 Bacteria 6856
65 Ga0070664_100172203 3300005564 Bacteria 1921
66 Ga0068857_100222898 3300005577 Bacteria 1723
67 Ga0068856_100221250 3300005614 Bacteria 1908
68 Ga0068852_100160243 3300005616 Bacteria 2100
69 Ga0068852_100201052 3300005616 Bacteria 1886
70 Ga0068859_100036562 3300005617 Bacteria 4930
71 Ga0068851_10007121 3300005834 Bacteria 5123
72 Ga0068870_10027766 3300005840 Bacteria 2834
73 Ga0068870_10188600 3300005840 Bacteria 1242
74 Ga0068863_100099411 3300005841 Bacteria 2764
75 Ga0068860_100174096 3300005843 Bacteria 2080
76 Ga0068862_100149683 3300005844 Bacteria 2077
77 Ga0081455_10075068 3300005937 Bacteria 2790
78 Ga0081539_10000952 3300005985 Bacteria 54279
79 Ga0075363_100007192 3300006048 Bacteria 5100
80 Ga0075364_10011332 3300006051 Bacteria 5416
81 Ga0075367_10071524 3300006178 Bacteria 2087
82 Ga0097621_100108226 3300006237 Bacteria 2346
83 Ga0075428_100002688 3300006844 Bacteria 19332
84 Ga0075433_10237222 3300006852 Bacteria 1619
85 Ga0075433_10487946 3300006852 Unclassified 1085
86 Ga0068865_100008050 3300006881 Bacteria 6508
87 Ga0068865_100043872 3300006881 Bacteria 3058
88 Ga0097620_100036560 3300006931 Bacteria 4930
89 Ga0075435_100104158 3300007076 Bacteria 2354
90 Ga0111539_10049520 3300009094 Bacteria 5009
91 Ga0111539_10242092 3300009094 Bacteria 2100
92 Ga0105245_10004149 3300009098 Bacteria 12870
93 Ga0105245_10187014 3300009098 Bacteria 1982
94 Ga0105245_10188549 3300009098 Bacteria 1974
95 Ga0105245_10215526 3300009098 Bacteria 1850
96 Ga0114129_10003985 3300009147 Bacteria 20857
97 Ga0114129_10186484 3300009147 Bacteria 2819
98 Ga0105243_10009862 3300009148 Bacteria 7265
99 Ga0105243_10010088 3300009148 Bacteria 7184
100 Ga0105243_10026755 3300009148 Bacteria 4417
101 Ga0105243_10125100 3300009148 Bacteria 2174
102 Ga0105242_10106232 3300009176 Bacteria 2386
103 Ga0105242_10135435 3300009176 Bacteria 2131
104 Ga0105242_10137591 3300009176 Bacteria 2115
105 Ga0105242_10354737 3300009176 Bacteria 1356
106 Ga0105242_10747736 3300009176 Unclassified 962
107 Ga0105248_10013687 3300009177 Bacteria 8929
108 Ga0105248_10117363 3300009177 Bacteria 3001
109 Ga0105238_10017396 3300009551 Bacteria 7305
110 Ga0105249_10149479 3300009553 Bacteria 2247
111 Ga0105239_10024298 3300010375 Bacteria 6674
112 Ga0105239_10732907 3300010375 Unclassified 1131
113 Ga0105246_10033376 3300011119 Bacteria 3421
114 Ga0105246_10049943 3300011119 Bacteria 2867
115 Ga0157371_10020186 3300013102 Bacteria 4904
116 Ga0157370_10011606 3300013104 Bacteria 9197
117 Ga0157370_10089297 3300013104 Bacteria 2895
118 Ga0157370_10625373 3300013104 Unclassified 985
119 Ga0157369_10003174 3300013105 Bacteria 19621
120 Ga0157369_10019533 3300013105 Bacteria 7582
121 Ga0163162_10395415 3300013306 Bacteria 1515
122 Ga0157372_10042532 3300013307 Bacteria 5026
123 Ga0157372_10382870 3300013307 Bacteria 1639
124 Ga0157372_10677565 3300013307 Bacteria 1200
125 Ga0157375_10087198 3300013308 Bacteria 3173
126 Ga0157375_10216977 3300013308 Bacteria 2071
127 Ga0157375_10568009 3300013308 Bacteria 1295
128 Ga0163163_10070262 3300014325 Bacteria 3487
129 Ga0163163_10279640 3300014325 Bacteria 1720
130 Ga0157380_10010208 3300014326 Bacteria 6747
131 Ga0157377_10002485 3300014745 Bacteria 8161
132 Ga0157377_10062998 3300014745 Bacteria 2123
133 Ga0157379_10035850 3300014968 Bacteria 4423
134 Ga0163161_10161454 3300017792 Bacteria 1709
135 Ga0206353_10494957 3300020082 Bacteria 1933
136 Ga0206353_11214109 3300020082 Bacteria 2401
137 Ga0207656_10117226 3300025321 Bacteria 1236
138 Ga0207642_10067490 3300025899 Bacteria 1688
139 Ga0207688_10007944 3300025901 Bacteria 5771
140 Ga0207688_10071779 3300025901 Bacteria 1966
141 Ga0207647_10055370 3300025904 Bacteria 2437
142 Ga0207645_10025695 3300025907 Bacteria 3810
143 Ga0207645_10057676 3300025907 Bacteria 2479
144 Ga0207643_10009693 3300025908 Bacteria 5168
145 Ga0207643_10046480 3300025908 Bacteria 2454
146 Ga0207643_10068689 3300025908 Bacteria 2036
147 Ga0207705_10036628 3300025909 Bacteria 3510
148 Ga0207654_10109193 3300025911 Bacteria 1718
149 Ga0207707_10006584 3300025912 Bacteria 10133
150 Ga0207707_10088179 3300025912 Bacteria 2710
151 Ga0207693_10067472 3300025915 Bacteria 2801
152 Ga0207660_10127807 3300025917 Bacteria 1931
153 Ga0207662_10038524 3300025918 Bacteria 2801
154 Ga0207657_10006321 3300025919 Bacteria 12308
155 Ga0207657_10111523 3300025919 Bacteria 2258
156 Ga0207657_10111994 3300025919 Bacteria 2253
157 Ga0207649_10005187 3300025920 Bacteria 7036
158 Ga0207649_10035802 3300025920 Bacteria 2985
159 Ga0207681_10077904 3300025923 Bacteria 2332
160 Ga0207659_10021611 3300025926 Bacteria 4275
161 Ga0207687_10008796 3300025927 Bacteria 6598
162 Ga0207687_10122079 3300025927 Bacteria 1950
163 Ga0207687_10602310 3300025927 Bacteria 926
164 Ga0207690_10508608 3300025932 Bacteria 975
165 Ga0207706_10028904 3300025933 Bacteria 4949
166 Ga0207706_10038373 3300025933 Bacteria 4249
167 Ga0207706_10137742 3300025933 Bacteria 2147
168 Ga0207709_10038564 3300025935 Bacteria 2847
169 Ga0207709_10076173 3300025935 Bacteria 2147
170 Ga0207709_10115126 3300025935 Bacteria 1805
171 Ga0207709_10130575 3300025935 Bacteria 1712
172 Ga0207709_10401483 3300025935 Bacteria 1048
173 Ga0207670_10140024 3300025936 Bacteria 1783
174 Ga0207669_10037370 3300025937 Bacteria 2785
175 Ga0207669_10084584 3300025937 Bacteria 2045
176 Ga0207704_10010299 3300025938 Bacteria 4553
177 Ga0207691_10020038 3300025940 Bacteria 6327
178 Ga0207691_10051182 3300025940 Bacteria 3777
179 Ga0207711_10056417 3300025941 Bacteria 3376
180 Ga0207689_10031629 3300025942 Bacteria 4403
181 Ga0207689_10130722 3300025942 Bacteria 2066
182 Ga0207661_10000481 3300025944 Bacteria 25755
183 Ga0207661_10166316 3300025944 Bacteria 1917
184 Ga0207661_10313605 3300025944 Bacteria 1408
185 Ga0207679_10236622 3300025945 Bacteria 1545
186 Ga0207667_10162238 3300025949 Unclassified 2299
187 Ga0207651_10069021 3300025960 Bacteria 2494
188 Ga0207712_10157499 3300025961 Bacteria 1761
189 Ga0207668_10084528 3300025972 Bacteria 2313
190 Ga0207640_10013637 3300025981 Bacteria 4664
191 Ga0207640_10058179 3300025981 Bacteria 2545
192 Ga0207640_10267493 3300025981 Bacteria 1336
193 Ga0207658_10368504 3300025986 Bacteria 1255
194 Ga0207677_10020889 3300026023 Bacteria 3989
195 Ga0207677_10029343 3300026023 Bacteria 3494
196 Ga0207639_10252588 3300026041 Bacteria 1538
197 Ga0207678_10031300 3300026067 Bacteria 4642
198 Ga0207708_10082115 3300026075 Bacteria 2477
199 Ga0207708_10194989 3300026075 Bacteria 1614
200 Ga0207641_10037968 3300026088 Bacteria 4025
201 Ga0207648_10024113 3300026089 Bacteria 5435
202 Ga0207648_10145281 3300026089 Bacteria 2092
203 Ga0207648_10166868 3300026089 Bacteria 1946
204 Ga0207676_10190144 3300026095 Bacteria 1806
205 Ga0207676_10289158 3300026095 Bacteria 1491
206 Ga0207674_10057234 3300026116 Bacteria 3952
207 Ga0207674_10114014 3300026116 Bacteria 2676
208 Ga0207675_100090978 3300026118 Bacteria 2869
209 Ga0207683_10074411 3300026121 Bacteria 3005
210 Ga0207683_10140729 3300026121 Bacteria 2174
211 Ga0207698_10029892 3300026142 Bacteria 3909
212 Ga0207698_10191724 3300026142 Unclassified 1821
213 Ga0207428_10000389 3300027907 Bacteria 54953
214 Ga0207428_10055972 3300027907 Bacteria 3134
215 Ga0207428_10238943 3300027907 Bacteria 1358
216 Ga0268266_10119458 3300028379 Bacteria 2344
217 Ga0268265_10235510 3300028380 Bacteria 1612
218 Ga0268264_10071904 3300028381 Bacteria 2932
219 Ga0307408_100045118 3300031548 Bacteria 3146
220 Ga0307410_10051998 3300031852 Bacteria 2764
221 Ga0307407_10186957 3300031903 Unclassified 1377
222 Ga0307412_10294539 3300031911 Bacteria 1280
223 Ga0307412_10303827 3300031911 Unclassified 1262
224 Ga0307409_100033413 3300031995 Bacteria 3743
225 Ga0307414_10219109 3300032004 Bacteria 1561
226 Ga0307415_100046660 3300032126 Bacteria 2911
227 Ga0373938_0024301 3300034957 Bacteria 1252
228 Ga0373952_0037694 3300035092 Bacteria 1104
229 Ga0373961_0126354 3300035241 Bacteria 852
230 Ga0395900_0005128 3300037418 Bacteria 13759
231 Ga0395898_0298730 3300037466 Bacteria 1536
232 Ga0395905_0013166 3300037471 Bacteria 7939
233 Ga0395901_0008723 3300038443 Bacteria 10245
234 Ga0395901_0229413 3300038443 Bacteria 1939
235 Ga0436360_1230856 3300039438 Bacteria 1121
236 Ga0436362_0722426 3300039453 Bacteria 3557
237 Ga0439439_0002856 3300041406 Bacteria 3735
238 Ga0439461_0034980 3300041410 Bacteria 1063
239 Ga0439433_0002712 3300041999 Bacteria 3767
240 Ga0450920_001332 3300042122 Bacteria 4064
241 Ga0450920_009695 3300042122 Bacteria 1775
242 Ga0450907_010242 3300042146 Bacteria 1556
243 Ga0450910_004959 3300042147 Bacteria 1810
244 Ga0439446_0000554 3300042156 Bacteria 7558
245 Ga0439446_0007215 3300042156 Bacteria 2917
246 Ga0439446_0037884 3300042156 Bacteria 1413
247 Ga0450909_017283 3300042185 Bacteria 1068
248 Ga0439434_0003435 3300042435 Bacteria 4629
249 Ga0439434_0051905 3300042435 Bacteria 1272
250 Ga0466972_0073805 3300044658 Bacteria 1626
251 Ga0466966_0024686 3300044684 Bacteria 3931
252 Ga0466961_0027766 3300044693 Bacteria 3640
253 Ga0466963_0032479 3300044694 Bacteria 3380
254 Ga0466963_0404061 3300044694 Unclassified 963
255 Ga0466964_0002302 3300044706 Bacteria 6773
256 Ga0466964_0013359 3300044706 Bacteria 3115
257 Ga0466971_0001843 3300044719 Bacteria 9015
258 Ga0466970_0154970 3300044765 Bacteria 1266
259 Ga0466957_0013214 3300044842 Bacteria 4788
260 Ga0466959_0020657 3300045049 Bacteria 4852
261 Ga0466958_0014861 3300045836 Bacteria 4449
262 Ga0466967_0043584 3300045976 Bacteria 3885
263 Ga0466967_0057175 3300045976 Bacteria 3442
264 Ga0466967_0068633 3300045976 Bacteria 3166
265 Ga0466967_0086411 3300045976 Bacteria 2841
266 Ga0466967_0393864 3300045976 Bacteria 1347
267 Ga0495603_0007481 3300046455 Bacteria 6567
268 Ga0495605_0245852 3300046474 Bacteria 767
269 Ga0495631_0154511 3300046518 Bacteria 985
270 Ga0495644_0051036 3300046523 Bacteria 1553
271 Ga0495644_0096930 3300046523 Unclassified 1115
272 Ga0495586_0007931 3300046535 Bacteria 5661
273 Ga0495656_0059858 3300046615 Bacteria 1658
274 Ga0495656_0229488 3300046615 Unclassified 931
275 Ga0495634_0118690 3300046642 Bacteria 1695
276 Ga0495634_0128791 3300046642 Unclassified 1615
277 Ga0495670_0237904 3300046691 Bacteria 969
278 Ga0495671_0150563 3300046692 Unclassified 1133
279 Ga0496100_0133973 3300048903 Bacteria 1748
280 Ga0496101_0027826 3300048904 Bacteria 3942
281 Ga0496101_0040170 3300048904 Bacteria 3332
282 Ga0496101_0185455 3300048904 Bacteria 1604
283 Ga0496101_0394449 3300048904 Bacteria 1090
284 Ga0496102_0091245 3300048905 Bacteria 2820
285 Ga0496102_0353746 3300048905 Bacteria 1383
286 Ga0496102_0522632 3300048905 Bacteria 1109
287 Ga0496103_0288485 3300048906 Bacteria 1056
288 Ga0496104_0008994 3300048907 Bacteria 8883
289 Ga0496104_0017057 3300048907 Bacteria 6608
290 Ga0496104_0090494 3300048907 Bacteria 2924
291 Ga0496104_0274922 3300048907 Bacteria 1597
292 Ga0496105_0002898 3300048908 Bacteria 12587
293 Ga0496105_0416532 3300048908 Bacteria 1064
294 Ga0496106_0056488 3300048909 Bacteria 2967
295 Ga0496106_0176228 3300048909 Bacteria 1696
296 Ga0496106_0179164 3300048909 Bacteria 1682
297 Ga0496107_0116948 3300048910 Bacteria 1963
298 Ga0496107_0359941 3300048910 Bacteria 1083
299 Ga0496108_0034872 3300048911 Bacteria 4180
300 Ga0496108_0035715 3300048911 Bacteria 4133
301 Ga0496108_0071846 3300048911 Bacteria 2920
302 Ga0496108_0181492 3300048911 Bacteria 1823
303 Ga0496109_0024751 3300048912 Bacteria 5340
304 Ga0496109_0156160 3300048912 Bacteria 2137
305 Ga0496109_0165110 3300048912 Bacteria 2075
306 Ga0496109_0472565 3300048912 Bacteria 1184
307 Ga0496110_0016399 3300048913 Bacteria 6184
308 Ga0496111_0023705 3300048914 Bacteria 4310
309 Ga0496111_0059581 3300048914 Bacteria 2766
310 Ga0496111_0147787 3300048914 Bacteria 1743
311 Ga0496112_0261425 3300048915 Bacteria 1680
312 Ga0496113_0051732 3300048916 Bacteria 3066
313 Ga0496113_0090933 3300048916 Bacteria 2352
314 Ga0496114_0069656 3300048917 Bacteria 2953
315 Ga0496114_0249213 3300048917 Bacteria 1563
316 Ga0496114_0277620 3300048917 Bacteria 1477
317 Ga0501031_0008060 3300049568 Bacteria 6861
318 Ga0501031_0070275 3300049568 Bacteria 2280
319 Ga0501031_0077127 3300049568 Bacteria 2170
320 Ga0501032_0023706 3300049569 Bacteria 4237
321 Ga0501032_0098735 3300049569 Bacteria 1935
322 Ga0501033_0003859 3300049570 Bacteria 12182
323 Ga0501034_0055632 3300049571 Bacteria 3981
324 Ga0501036_0010367 3300049572 Bacteria 7694
325 Ga0501036_0019502 3300049572 Bacteria 5694
326 Ga0501036_0019922 3300049572 Bacteria 5631
327 Ga0501036_0028599 3300049572 Bacteria 4710
328 Ga0501036_0260378 3300049572 Bacteria 1453
329 Ga0501037_0010624 3300049573 Bacteria 6765
330 Ga0501037_0126405 3300049573 Bacteria 1835
331 Ga0501038_0014296 3300049574 Bacteria 7232
332 Ga0501038_0030517 3300049574 Bacteria 4769
333 Ga0501038_0080461 3300049574 Bacteria 2746
334 Ga0501039_0003961 3300049575 Bacteria 11123
335 Ga0501039_0010645 3300049575 Bacteria 7007
336 Ga0501039_0016004 3300049575 Bacteria 5744
337 Ga0501039_0287854 3300049575 Bacteria 1292
338 Ga0501039_0451603 3300049575 Unclassified 1009
339 Ga0501040_0003300 3300049576 Bacteria 10431
340 Ga0501040_0047327 3300049576 Bacteria 2937
341 Ga0501040_0071995 3300049576 Bacteria 2387
342 Ga0501040_0149102 3300049576 Bacteria 1649
343 Ga0501040_0159737 3300049576 Bacteria 1593
344 Ga0501041_0004475 3300049577 Bacteria 8096
345 Ga0501041_0017122 3300049577 Bacteria 4312
346 Ga0501041_0024304 3300049577 Bacteria 3636
347 Ga0501041_0045340 3300049577 Bacteria 2673
348 Ga0501042_0000234 3300049578 Bacteria 26725
349 Ga0501042_0006745 3300049578 Bacteria 7484
350 Ga0501042_0035464 3300049578 Bacteria 3539
351 Ga0501042_0041834 3300049578 Bacteria 3259
352 Ga0501042_0313429 3300049578 Unclassified 1133
353 Ga0501042_0348489 3300049578 Bacteria 1071
354 Ga0501043_0006135 3300049579 Bacteria 9653
355 Ga0501043_0399257 3300049579 Bacteria 1039
356 Ga0501046_0021685 3300049580 Bacteria 5298
357 Ga0501046_0112396 3300049580 Bacteria 2079
358 Ga0501047_0243930 3300049581 Bacteria 1646
359 Ga0501048_0008224 3300049582 Bacteria 7892
360 Ga0501048_0011002 3300049582 Bacteria 6750
361 Ga0501048_0036439 3300049582 Bacteria 3536
362 Ga0501048_0080406 3300049582 Bacteria 2299
363 Ga0501067_0312927 3300049583 Unclassified 874
364 Ga0501067_0416763 3300049583 Bacteria 749
365 Ga0501068_0004121 3300049584 Bacteria 7882
366 Ga0501068_0143362 3300049584 Bacteria 1498
367 Ga0501069_0021437 3300049585 Bacteria 3506
368 Ga0501069_0082680 3300049585 Unclassified 1810
369 Ga0501069_0340384 3300049585 Bacteria 883
370 Ga0501070_0025762 3300049586 Bacteria 4934
371 Ga0501070_0075088 3300049586 Bacteria 2798
372 Ga0501071_0015375 3300049587 Bacteria 5253
373 Ga0501071_0016878 3300049587 Bacteria 5022
374 Ga0501071_0036547 3300049587 Bacteria 3503
375 Ga0501071_0058210 3300049587 Bacteria 2793
376 Ga0501071_0119114 3300049587 Bacteria 1956
377 Ga0501071_0182464 3300049587 Bacteria 1572
378 Ga0501071_0228122 3300049587 Bacteria 1403
379 Ga0501071_0230723 3300049587 Bacteria 1394
380 Ga0501071_0245567 3300049587 Bacteria 1350
381 Ga0501072_0002396 3300049588 Bacteria 14048
382 Ga0501072_0019440 3300049588 Bacteria 5251
383 Ga0501072_0022938 3300049588 Bacteria 4845
384 Ga0501072_0033806 3300049588 Bacteria 4006
385 Ga0501072_0155637 3300049588 Bacteria 1823
386 Ga0501072_0155655 3300049588 Bacteria 1822
387 Ga0501072_0520319 3300049588 Unclassified 941
388 Ga0501073_0016930 3300049589 Bacteria 5279
389 Ga0501074_0023095 3300049590 Bacteria 4522
390 Ga0501074_0027465 3300049590 Bacteria 4127
391 Ga0501074_0042103 3300049590 Bacteria 3305
392 Ga0501075_0000777 3300049591 Bacteria 19921
393 Ga0501075_0004141 3300049591 Bacteria 9786
394 Ga0501075_0021866 3300049591 Bacteria 4667
395 Ga0501075_0449144 3300049591 Bacteria 983
396 Ga0501076_0004413 3300049592 Bacteria 10002
397 Ga0501076_0007059 3300049592 Bacteria 8161
398 Ga0501076_0016391 3300049592 Bacteria 5619
399 Ga0501076_0049368 3300049592 Bacteria 3328
400 Ga0501076_0142121 3300049592 Bacteria 1950
401 Ga0501076_0143741 3300049592 Bacteria 1939
402 Ga0501077_0006265 3300049593 Bacteria 7276
403 Ga0501077_0007560 3300049593 Bacteria 6704
404 Ga0501077_0007573 3300049593 Bacteria 6699
405 Ga0501077_0369785 3300049593 Bacteria 915
406 Ga0501079_0002598 3300049741 Bacteria 13123
407 Ga0501079_0004780 3300049741 Bacteria 10036
408 Ga0501079_0140881 3300049741 Bacteria 1878
409 Ga0501079_0148530 3300049741 Bacteria 1827
410 Ga0501079_0433873 3300049741 Unclassified 1031
411 Ga0501080_0002879 3300049742 Bacteria 15130
412 Ga0501080_0087885 3300049742 Bacteria 2887
413 Ga0501080_0176034 3300049742 Bacteria 1970
414 Ga0501081_0008327 3300049743 Bacteria 6729
415 Ga0501081_0010643 3300049743 Bacteria 6009
416 Ga0501081_0013349 3300049743 Bacteria 5403
417 Ga0501081_0037802 3300049743 Bacteria 3294
418 Ga0501081_0236463 3300049743 Bacteria 1331
419 Ga0501081_0599148 3300049743 Bacteria 825
420 Ga0501083_0008995 3300049744 Bacteria 7049
421 Ga0501083_0054545 3300049744 Bacteria 2682
422 Ga0501035_0016877 3300049822 Bacteria 6732
423 Ga0501035_0057906 3300049822 Bacteria 3454
424 Ga0501035_0104682 3300049822 Bacteria 2481
425 Ga0501044_0022546 3300049823 Bacteria 6709
426 Ga0501044_0309920 3300049823 Bacteria 1505
427 Ga0501045_0000885 3300049824 Bacteria 19468
428 Ga0501045_0016453 3300049824 Bacteria 5254
429 Ga0501045_0034952 3300049824 Bacteria 3648
430 Ga0501045_0035329 3300049824 Bacteria 3628
431 Ga0501045_0053593 3300049824 Bacteria 2947
432 Ga0501045_0183714 3300049824 Unclassified 1558
433 Ga0501045_0203098 3300049824 Bacteria 1477
434 nmdc:mga00v17_337754_c1 3300050491 Bacteria 979
435 nmdc:mga00v17_5343_c1 3300050491 Bacteria 6764
436 nmdc:mga0yw44_293875_c1 3300050492 Unclassified 1088
437 nmdc:mga06z11_75722_c1 3300050494 Unclassified 1793
438 nmdc:mga05p37_5758_c1 3300050507 Bacteria 14581
439 nmdc:mga05p37_77855_c1 3300050507 Bacteria 4082
440 nmdc:mga08y16_135329_c1 3300050511 Bacteria 2561
441 nmdc:mga08y16_41758_c1 3300050511 Bacteria 4804
442 nmdc:mga0n895_910487_c1 3300050512 Bacteria 864
443 nmdc:mga08x19_105212_c1 3300050514 Bacteria 1876
444 nmdc:mga0a205_342201_c1 3300050515 Bacteria 1364
445 nmdc:mga0a205_415659_c1 3300050515 Bacteria 1207
446 nmdc:mga0a205_559316_c1 3300050515 Bacteria 999
447 Ga0495619_0101314 3300053085 Bacteria 1961
448 Ga0501084_0001593 3300054114 Bacteria 17970
449 Ga0501084_0008421 3300054114 Bacteria 8521
450 Ga0501084_0034970 3300054114 Bacteria 4201
451 Ga0501084_0041798 3300054114 Bacteria 3835
452 Ga0501084_0043711 3300054114 Bacteria 3748
453 Ga0501084_0122653 3300054114 Bacteria 2185
454 Ga0590075_003528 3300059424 Bacteria 3717
455 Ga0590075_006266 3300059424 Bacteria 2822
456 Ga0501082_0029740 3300060353 Bacteria 4706
457 Ga0501082_0040389 3300060353 Bacteria 4025
458 Ga0501082_0047053 3300060353 Bacteria 3718
459 Ga0501082_0059255 3300060353 Bacteria 3300
460 Ga0501082_0091663 3300060353 Bacteria 2624
461 Ga0501082_0163409 3300060353 Bacteria 1935
462 Ga0501082_0256340 3300060353 Bacteria 1522
463 Ga0501082_0463531 3300060353 Bacteria 1107
464 Ga0466962_0005027 3300061719 Bacteria 6359
465 Ga0530510_0009596 3300061734 Bacteria 6787
466 Ga0530510_0021543 3300061734 Bacteria 4586
467 Ga0530510_0352729 3300061734 Bacteria 1105
468 Ga0501031_0118941
469 JGI24738J21930_10011479
470 JGI24742J22300_10026624
471 JGI25406J46586_10001411
472 Ga0070658_10344463
473 Ga0070683_100029645
474 Ga0070683_100286315
475 Ga0070670_100109550
476 Ga0068869_100294069
477 Ga0070666_10384904
478 Ga0070680_100021633
479 Ga0070680_100027767
480 Ga0070682_100215354
481 Ga0068868_100027353
482 Ga0068868_100071528
483 Ga0070660_100033781
484 Ga0070660_100186290
485 Ga0070660_100439956
486 Ga0070691_10005379
487 Ga0070691_10116332
488 Ga0070687_100153587
489 Ga0070661_100008811
490 Ga0070661_100028064
491 Ga0070661_100110333
492 Ga0070692_10061998
493 Ga0070692_10171498
494 Ga0070692_10222545
495 Ga0070669_100132523
496 Ga0070669_100145642
497 Ga0070675_100124056
498 Ga0070674_100240978
499 Ga0070673_100116732
500 Ga0070688_100006422
501 Ga0070659_100013771
502 Ga0070659_100171068
503 Ga0070714_100421081
504 Ga0070701_10096420
505 Ga0070705_100018033
506 Ga0070700_100164866
507 Ga0070663_100173147
508 Ga0070678_100044263
509 Ga0070662_100015530
510 Ga0070662_100021758
511 Ga0070681_10080582
512 Ga0070681_10112619
513 Ga0070685_10130045
514 Ga0070698_100330445
515 Ga0070699_100112086
516 Ga0070679_100122496
517 Ga0070679_100144279
518 Ga0070684_100051526
519 Ga0070684_100078200
520 Ga0070684_100200686
521 Ga0070697_100606886
522 Ga0068853_100016783
523 Ga0070672_100050346
524 Ga0070696_100115637
525 Ga0070696_100321503
526 Ga0070693_100026948
527 Ga0070665_100138744
528 Ga0070704_100065748
529 Ga0070704_100118339
530 Ga0070664_100005005
531 Ga0070664_100012702
532 Ga0070664_100172203
533 Ga0068857_100222898
534 Ga0068856_100221250
535 Ga0068852_100160243
536 Ga0068852_100201052
537 Ga0068859_100036562
538 Ga0068851_10007121
539 Ga0068870_10027766
540 Ga0068870_10188600
541 Ga0068863_100099411
542 Ga0068860_100174096
543 Ga0068862_100149683
544 Ga0081455_10075068
545 Ga0081539_10000952
546 Ga0075363_100007192
547 Ga0075364_10011332
548 Ga0075367_10071524
549 Ga0097621_100108226
550 Ga0075428_100002688
551 Ga0075433_10237222
552 Ga0075433_10487946
553 Ga0068865_100008050
554 Ga0068865_100043872
555 Ga0097620_100036560
556 Ga0075435_100104158
557 Ga0111539_10049520
558 Ga0111539_10242092
559 Ga0105245_10004149
560 Ga0105245_10187014
561 Ga0105245_10188549
562 Ga0105245_10215526
563 Ga0114129_10003985
564 Ga0114129_10186484
565 Ga0105243_10009862
566 Ga0105243_10010088
567 Ga0105243_10026755
568 Ga0105243_10125100
569 Ga0105242_10106232
570 Ga0105242_10135435
571 Ga0105242_10137591
572 Ga0105242_10354737
573 Ga0105242_10747736
574 Ga0105248_10013687
575 Ga0105248_10117363
576 Ga0105238_10017396
577 Ga0105249_10149479
578 Ga0105239_10024298
579 Ga0105239_10732907
580 Ga0105246_10033376
581 Ga0105246_10049943
582 Ga0157371_10020186
583 Ga0157370_10011606
584 Ga0157370_10089297
585 Ga0157370_10625373
586 Ga0157369_10003174
587 Ga0157369_10019533
588 Ga0163162_10395415
589 Ga0157372_10042532
590 Ga0157372_10382870
591 Ga0157372_10677565
592 Ga0157375_10087198
593 Ga0157375_10216977
594 Ga0157375_10568009
595 Ga0163163_10070262
596 Ga0163163_10279640
597 Ga0157380_10010208
598 Ga0157377_10002485
599 Ga0157377_10062998
600 Ga0157379_10035850
601 Ga0163161_10161454
602 Ga0206353_10494957
603 Ga0206353_11214109
604 Ga0207656_10117226
605 Ga0207642_10067490
606 Ga0207688_10007944
607 Ga0207688_10071779
608 Ga0207647_10055370
609 Ga0207645_10025695
610 Ga0207645_10057676
611 Ga0207643_10009693
612 Ga0207643_10046480
613 Ga0207643_10068689
614 Ga0207705_10036628
615 Ga0207654_10109193
616 Ga0207707_10006584
617 Ga0207707_10088179
618 Ga0207693_10067472
619 Ga0207660_10127807
620 Ga0207662_10038524
621 Ga0207657_10006321
622 Ga0207657_10111523
623 Ga0207657_10111994
624 Ga0207649_10005187
625 Ga0207649_10035802
626 Ga0207681_10077904
627 Ga0207659_10021611
628 Ga0207687_10008796
629 Ga0207687_10122079
630 Ga0207687_10602310
631 Ga0207690_10508608
632 Ga0207706_10028904
633 Ga0207706_10038373
634 Ga0207706_10137742
635 Ga0207709_10038564
636 Ga0207709_10076173
637 Ga0207709_10115126
638 Ga0207709_10130575
639 Ga0207709_10401483
640 Ga0207670_10140024
641 Ga0207669_10037370
642 Ga0207669_10084584
643 Ga0207704_10010299
644 Ga0207691_10020038
645 Ga0207691_10051182
646 Ga0207711_10056417
647 Ga0207689_10031629
648 Ga0207689_10130722
649 Ga0207661_10000481
650 Ga0207661_10166316
651 Ga0207661_10313605
652 Ga0207679_10236622
653 Ga0207667_10162238
654 Ga0207651_10069021
655 Ga0207712_10157499
656 Ga0207668_10084528
657 Ga0207640_10013637
658 Ga0207640_10058179
659 Ga0207640_10267493
660 Ga0207658_10368504
661 Ga0207677_10020889
662 Ga0207677_10029343
663 Ga0207639_10252588
664 Ga0207678_10031300
665 Ga0207708_10082115
666 Ga0207708_10194989
667 Ga0207641_10037968
668 Ga0207648_10024113
669 Ga0207648_10145281
670 Ga0207648_10166868
671 Ga0207676_10190144
672 Ga0207676_10289158
673 Ga0207674_10057234
674 Ga0207674_10114014
675 Ga0207675_100090978
676 Ga0207683_10074411
677 Ga0207683_10140729
678 Ga0207698_10029892
679 Ga0207698_10191724
680 Ga0207428_10000389
681 Ga0207428_10055972
682 Ga0207428_10238943
683 Ga0268266_10119458
684 Ga0268265_10235510
685 Ga0268264_10071904
686 Ga0307408_100045118
687 Ga0307410_10051998
688 Ga0307407_10186957
689 Ga0307412_10294539
690 Ga0307412_10303827
691 Ga0307409_100033413
692 Ga0307414_10219109
693 Ga0307415_100046660
694 Ga0373938_0024301
695 Ga0373952_0037694
696 Ga0373961_0126354
697 Ga0395900_0005128
698 Ga0395898_0298730
699 Ga0395905_0013166
700 Ga0395901_0008723
701 Ga0395901_0229413
702 Ga0436360_1230856
703 Ga0436362_0722426
704 Ga0439439_0002856
705 Ga0439461_0034980
706 Ga0439433_0002712
707 Ga0450920_001332
708 Ga0450920_009695
709 Ga0450907_010242
710 Ga0450910_004959
711 Ga0439446_0000554
712 Ga0439446_0007215
713 Ga0439446_0037884
714 Ga0450909_017283
715 Ga0439434_0003435
716 Ga0439434_0051905
717 Ga0466972_0073805
718 Ga0466966_0024686
719 Ga0466961_0027766
720 Ga0466963_0032479
721 Ga0466963_0404061
722 Ga0466964_0002302
723 Ga0466964_0013359
724 Ga0466971_0001843
725 Ga0466970_0154970
726 Ga0466957_0013214
727 Ga0466959_0020657
728 Ga0466958_0014861
729 Ga0466967_0043584
730 Ga0466967_0057175
731 Ga0466967_0068633
732 Ga0466967_0086411
733 Ga0466967_0393864
734 Ga0495603_0007481
735 Ga0495605_0245852
736 Ga0495631_0154511
737 Ga0495644_0051036
738 Ga0495644_0096930
739 Ga0495586_0007931
740 Ga0495656_0059858
741 Ga0495656_0229488
742 Ga0495634_0118690
743 Ga0495634_0128791
744 Ga0495670_0237904
745 Ga0495671_0150563
746 Ga0496100_0133973
747 Ga0496101_0027826
748 Ga0496101_0040170
749 Ga0496101_0185455
750 Ga0496101_0394449
751 Ga0496102_0091245
752 Ga0496102_0353746
753 Ga0496102_0522632
754 Ga0496103_0288485
755 Ga0496104_0008994
756 Ga0496104_0017057
757 Ga0496104_0090494
758 Ga0496104_0274922
759 Ga0496105_0002898
760 Ga0496105_0416532
761 Ga0496106_0056488
762 Ga0496106_0176228
763 Ga0496106_0179164
764 Ga0496107_0116948
765 Ga0496107_0359941
766 Ga0496108_0034872
767 Ga0496108_0035715
768 Ga0496108_0071846
769 Ga0496108_0181492
770 Ga0496109_0024751
771 Ga0496109_0156160
772 Ga0496109_0165110
773 Ga0496109_0472565
774 Ga0496110_0016399
775 Ga0496111_0023705
776 Ga0496111_0059581
777 Ga0496111_0147787
778 Ga0496112_0261425
779 Ga0496113_0051732
780 Ga0496113_0090933
781 Ga0496114_0069656
782 Ga0496114_0249213
783 Ga0496114_0277620
784 Ga0501031_0008060
785 Ga0501031_0070275
786 Ga0501031_0077127
787 Ga0501032_0023706
788 Ga0501032_0098735
789 Ga0501033_0003859
790 Ga0501034_0055632
791 Ga0501036_0010367
792 Ga0501036_0019502
793 Ga0501036_0019922
794 Ga0501036_0028599
795 Ga0501036_0260378
796 Ga0501037_0010624
797 Ga0501037_0126405
798 Ga0501038_0014296
799 Ga0501038_0030517
800 Ga0501038_0080461
801 Ga0501039_0003961
802 Ga0501039_0010645
803 Ga0501039_0016004
804 Ga0501039_0287854
805 Ga0501039_0451603
806 Ga0501040_0003300
807 Ga0501040_0047327
808 Ga0501040_0071995
809 Ga0501040_0149102
810 Ga0501040_0159737
811 Ga0501041_0004475
812 Ga0501041_0017122
813 Ga0501041_0024304
814 Ga0501041_0045340
815 Ga0501042_0000234
816 Ga0501042_0006745
817 Ga0501042_0035464
818 Ga0501042_0041834
819 Ga0501042_0313429
820 Ga0501042_0348489
821 Ga0501043_0006135
822 Ga0501043_0399257
823 Ga0501046_0021685
824 Ga0501046_0112396
825 Ga0501047_0243930
826 Ga0501048_0008224
827 Ga0501048_0011002
828 Ga0501048_0036439
829 Ga0501048_0080406
830 Ga0501067_0312927
831 Ga0501067_0416763
832 Ga0501068_0004121
833 Ga0501068_0143362
834 Ga0501069_0021437
835 Ga0501069_0082680
836 Ga0501069_0340384
837 Ga0501070_0025762
838 Ga0501070_0075088
839 Ga0501071_0015375
840 Ga0501071_0016878
841 Ga0501071_0036547
842 Ga0501071_0058210
843 Ga0501071_0119114
844 Ga0501071_0182464
845 Ga0501071_0228122
846 Ga0501071_0230723
847 Ga0501071_0245567
848 Ga0501072_0002396
849 Ga0501072_0019440
850 Ga0501072_0022938
851 Ga0501072_0033806
852 Ga0501072_0155637
853 Ga0501072_0155655
854 Ga0501072_0520319
855 Ga0501073_0016930
856 Ga0501074_0023095
857 Ga0501074_0027465
858 Ga0501074_0042103
859 Ga0501075_0000777
860 Ga0501075_0004141
861 Ga0501075_0021866
862 Ga0501075_0449144
863 Ga0501076_0004413
864 Ga0501076_0007059
865 Ga0501076_0016391
866 Ga0501076_0049368
867 Ga0501076_0142121
868 Ga0501076_0143741
869 Ga0501077_0006265
870 Ga0501077_0007560
871 Ga0501077_0007573
872 Ga0501077_0369785
873 Ga0501079_0002598
874 Ga0501079_0004780
875 Ga0501079_0140881
876 Ga0501079_0148530
877 Ga0501079_0433873
878 Ga0501080_0002879
879 Ga0501080_0087885
880 Ga0501080_0176034
881 Ga0501081_0008327
882 Ga0501081_0010643
883 Ga0501081_0013349
884 Ga0501081_0037802
885 Ga0501081_0236463
886 Ga0501081_0599148
887 Ga0501083_0008995
888 Ga0501083_0054545
889 Ga0501035_0016877
890 Ga0501035_0057906
891 Ga0501035_0104682
892 Ga0501044_0022546
893 Ga0501044_0309920
894 Ga0501045_0000885
895 Ga0501045_0016453
896 Ga0501045_0034952
897 Ga0501045_0035329
898 Ga0501045_0053593
899 Ga0501045_0183714
900 Ga0501045_0203098
901 nmdc:mga00v17_337754_c1
902 nmdc:mga00v17_5343_c1
903 nmdc:mga0yw44_293875_c1
904 nmdc:mga06z11_75722_c1
905 nmdc:mga05p37_5758_c1
906 nmdc:mga05p37_77855_c1
907 nmdc:mga08y16_135329_c1
908 nmdc:mga08y16_41758_c1
909 nmdc:mga0n895_910487_c1
910 nmdc:mga08x19_105212_c1
911 nmdc:mga0a205_342201_c1
912 nmdc:mga0a205_415659_c1
913 nmdc:mga0a205_559316_c1
914 Ga0495619_0101314
915 Ga0501084_0001593
916 Ga0501084_0008421
917 Ga0501084_0034970
918 Ga0501084_0041798
919 Ga0501084_0043711
920 Ga0501084_0122653
921 Ga0590075_003528
922 Ga0590075_006266
923 Ga0501082_0029740
924 Ga0501082_0040389
925 Ga0501082_0047053
926 Ga0501082_0059255
927 Ga0501082_0091663
928 Ga0501082_0163409
929 Ga0501082_0256340
930 Ga0501082_0463531
931 Ga0466962_0005027
932 Ga0530510_0009596
933 Ga0530510_0021543
934 Ga0530510_0352729

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

16

231

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.8828 10 266
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.8795 10 266
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.8687 10 266
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.8656 10 266
6jbh-assembly1.cif.gz_D cryo-em structure and transport mechanism of a wall teichoic acid abc transporter 0.8622 1 264
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6978 65 255 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6412 60 253 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6394 42 254 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5249 65 255 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5247 42 254 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A7W0PW99-F1-model_v4 Transport permease protein 0.9731 2 266 GO:0015920
GO:0043190
GO:0140359
AF-A0A7W0PW99-F1-model_v4 Transport permease protein 0.966 2 266 GO:0015920
GO:0043190
GO:0140359
AF-A0A7V9MAC9-F1-model_v4 Transport permease protein 0.9654 1 266 GO:0015920
GO:0043190
GO:0140359
AF-A0A7V9MAC9-F1-model_v4 Transport permease protein 0.9619 1 266 GO:0015920
GO:0043190
GO:0140359
AF-A0A538AER6-F1-model_v4 Transport permease protein 0.9611 1 266 GO:0005886
GO:0015920
GO:0140359

Map