F449891

General Info

Members Datasets Scaffolds Average Seq Length
467 242 934 491

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0000335|Ga0466967_0000335_17095_18690
Length 531
Sequence MEQSDQARQRGSEDEQKDGPGPAHGAASVAEYNSTLVVTKPIAGVSGDEPSDIRRARVLPVSIQLRAFARRLASIVALVTIDVSGLAGALYLALILRELYYGTRPILWGLAWQAEGKWLPFLTTVTVLVFWRAGLYATREQRAGAGRVVSSLLLVTVITLAFAIGSGYPTTTFGLYATGFVLAVIVIGSLRGAYEIVTRDVWRLAGVRRRAILLGSGERLLDLHRALGDGRGGIDYEFLGVLSDDGQELGLPVLGAAADLRRVLEREHPDELIVSGVDVRDDDLLELVGDANRAGVKVRVAPTTMELLTQRAEYVPGQGVPLFELRPPVFVGLDWATKRAFDLIVSGALIVFAAPFWAIIALAVKIDSPGPVLYRDRRIGLGEREFGMVKFRSMYVDAAQRQAALEEANEASGPLFKIKDDPRVTRVGRVLRRYSLDELPQLLNVLRGEMSLVGPRPLPLRDFVQLEDWHRKRYLVLPGMTGLWQVSGRIELTFDDLVRLDFYYLENWSIWLDISILAKTLPAVAARRGAY

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
135 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
163 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
169 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
178 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
230 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
242 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 1.07
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.93
Nodule 0
Rhizoplane 12.42
Rhizosphere 85.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0000335 3300045976 Bacteria 21534
2 JGI24744J21845_10000718 3300002077 Bacteria 6105
3 Ga0055541_1001976 3300003841 Bacteria 4227
4 Ga0070658_10004865 3300005327 Bacteria 10937
5 Ga0070658_10016816 3300005327 Bacteria 5854
6 Ga0070658_10150166 3300005327 Bacteria 1951
7 Ga0070683_100000658 3300005329 Bacteria 24951
8 Ga0070683_100045775 3300005329 Bacteria 4038
9 Ga0070683_100106179 3300005329 Bacteria 2647
10 Ga0070683_100209476 3300005329 Bacteria 1852
11 Ga0070690_100022233 3300005330 Bacteria 3879
12 Ga0070680_100010854 3300005336 Bacteria 7035
13 Ga0070680_100022115 3300005336 Bacteria 5059
14 Ga0070680_100023143 3300005336 Bacteria 4953
15 Ga0070682_100006677 3300005337 Bacteria 6468
16 Ga0070682_100052054 3300005337 Bacteria 2561
17 Ga0070660_100016428 3300005339 Bacteria 5371
18 Ga0070660_100039041 3300005339 Bacteria 3607
19 Ga0070660_100048304 3300005339 Bacteria 3268
20 Ga0070660_100060334 3300005339 Bacteria 2943
21 Ga0070660_100080484 3300005339 Bacteria 2556
22 Ga0070689_100022184 3300005340 Bacteria 4738
23 Ga0070691_10055094 3300005341 Bacteria 1904
24 Ga0070687_100002901 3300005343 Bacteria 6567
25 Ga0070661_100053392 3300005344 Bacteria 2957
26 Ga0070692_10009690 3300005345 Bacteria 4356
27 Ga0070668_100004701 3300005347 Bacteria 10118
28 Ga0070669_100093402 3300005353 Bacteria 2259
29 Ga0070688_100010065 3300005365 Bacteria 5197
30 Ga0070659_100034945 3300005366 Bacteria 3912
31 Ga0070709_10026242 3300005434 Bacteria 3451
32 Ga0070714_100032248 3300005435 Bacteria 4372
33 Ga0070714_100131974 3300005435 Bacteria 2233
34 Ga0070714_100198238 3300005435 Bacteria 1836
35 Ga0070713_100037878 3300005436 Bacteria 3902
36 Ga0070710_10003203 3300005437 Bacteria 7759
37 Ga0070701_10006687 3300005438 Bacteria 4867
38 Ga0070711_100017686 3300005439 Bacteria 4542
39 Ga0070711_100101709 3300005439 Bacteria 2092
40 Ga0070700_100010546 3300005441 Bacteria 5104
41 Ga0070708_100081539 3300005445 Bacteria 2929
42 Ga0070663_100001667 3300005455 Bacteria 12295
43 Ga0070678_100001730 3300005456 Bacteria 11723
44 Ga0070681_10038492 3300005458 Bacteria 4795
45 Ga0068867_100001632 3300005459 Bacteria 15598
46 Ga0070685_10003109 3300005466 Bacteria 8434
47 Ga0070706_100017206 3300005467 Bacteria 6675
48 Ga0070706_100019661 3300005467 Bacteria 6228
49 Ga0070707_100002182 3300005468 Bacteria 18717
50 Ga0070707_100009728 3300005468 Bacteria 8936
51 Ga0070707_100039603 3300005468 Bacteria 4505
52 Ga0070707_100232863 3300005468 Bacteria 1793
53 Ga0070698_100001402 3300005471 Bacteria 26692
54 Ga0070698_100018251 3300005471 Bacteria 7388
55 Ga0070698_100040233 3300005471 Bacteria 4806
56 Ga0070698_100050912 3300005471 Bacteria 4219
57 Ga0070679_100013914 3300005530 Bacteria 7710
58 Ga0070679_100046088 3300005530 Bacteria 4345
59 Ga0070684_100000113 3300005535 Bacteria 52618
60 Ga0070684_100000993 3300005535 Bacteria 20241
61 Ga0070684_100071902 3300005535 Bacteria 3044
62 Ga0070684_100084914 3300005535 Bacteria 2807
63 Ga0070684_100186838 3300005535 Bacteria 1885
64 Ga0070697_100083353 3300005536 Bacteria 2637
65 Ga0068853_100012011 3300005539 Bacteria 7044
66 Ga0070672_100013315 3300005543 Bacteria 5806
67 Ga0070686_100006620 3300005544 Bacteria 6448
68 Ga0070696_100013783 3300005546 Bacteria 5428
69 Ga0070696_100013789 3300005546 Bacteria 5427
70 Ga0070693_100008797 3300005547 Bacteria 5001
71 Ga0070665_100043261 3300005548 Bacteria 4526
72 Ga0070704_100004845 3300005549 Bacteria 7801
73 Ga0068855_100042807 3300005563 Bacteria 5365
74 Ga0068855_100204513 3300005563 Bacteria 2222
75 Ga0068855_100333339 3300005563 Bacteria 1674
76 Ga0068857_100016408 3300005577 Bacteria 6490
77 Ga0068856_100007496 3300005614 Bacteria 10652
78 Ga0068856_100031153 3300005614 Bacteria 5217
79 Ga0068856_100056820 3300005614 Bacteria 3863
80 Ga0068856_100081955 3300005614 Bacteria 3201
81 Ga0070702_100004493 3300005615 Bacteria 6377
82 Ga0068852_100018773 3300005616 Bacteria 5454
83 Ga0068859_100102533 3300005617 Bacteria 2919
84 Ga0068866_10000367 3300005718 Bacteria 21182
85 Ga0068861_100025741 3300005719 Bacteria 4271
86 Ga0068860_100041191 3300005843 Bacteria 4412
87 Ga0081455_10004668 3300005937 Bacteria 15250
88 Ga0081455_10016759 3300005937 Bacteria 7052
89 Ga0081455_10018677 3300005937 Bacteria 6586
90 Ga0081455_10084040 3300005937 Bacteria 2599
91 Ga0081538_10003582 3300005981 Bacteria 14603
92 Ga0081538_10013554 3300005981 Bacteria 6446
93 Ga0081540_1009349 3300005983 Bacteria 6760
94 Ga0081539_10001397 3300005985 Bacteria 41577
95 Ga0081539_10001497 3300005985 Bacteria 39539
96 Ga0070717_10024746 3300006028 Bacteria 4770
97 Ga0070717_10041296 3300006028 Bacteria 3760
98 Ga0070717_10056427 3300006028 Bacteria 3245
99 Ga0075365_10080982 3300006038 Bacteria 2199
100 Ga0075365_10092425 3300006038 Bacteria 2063
101 Ga0075364_10030219 3300006051 Bacteria 3476
102 Ga0070712_100010988 3300006175 Bacteria 5728
103 Ga0075362_10036664 3300006177 Bacteria 2146
104 Ga0097621_100013753 3300006237 Bacteria 6042
105 Ga0068871_100006279 3300006358 Bacteria 8387
106 Ga0075428_100008003 3300006844 Bacteria 11724
107 Ga0075431_100006510 3300006847 Bacteria 11594
108 Ga0075431_100082176 3300006847 Bacteria 3326
109 Ga0075433_10010493 3300006852 Bacteria 7437
110 Ga0075433_10013279 3300006852 Bacteria 6691
111 Ga0075434_100023795 3300006871 Bacteria 5976
112 Ga0068865_100001537 3300006881 Bacteria 13461
113 Ga0075436_100002713 3300006914 Bacteria 12181
114 Ga0097620_100102535 3300006931 Bacteria 2919
115 Ga0075435_100003253 3300007076 Bacteria 11005
116 Ga0105240_10033924 3300009093 Bacteria 6590
117 Ga0111539_10058711 3300009094 Bacteria 4563
118 Ga0111539_10154689 3300009094 Bacteria 2684
119 Ga0111539_10208656 3300009094 Bacteria 2276
120 Ga0105245_10003789 3300009098 Bacteria 13453
121 Ga0105245_10061871 3300009098 Bacteria 3376
122 Ga0105245_10167337 3300009098 Bacteria 2091
123 Ga0105245_10187941 3300009098 Bacteria 1977
124 Ga0114129_10010992 3300009147 Bacteria 12897
125 Ga0114129_10016892 3300009147 Bacteria 10391
126 Ga0114129_10046926 3300009147 Bacteria 6071
127 Ga0114129_10047095 3300009147 Bacteria 6060
128 Ga0114129_10080183 3300009147 Bacteria 4537
129 Ga0105243_10026950 3300009148 Bacteria 4401
130 Ga0105242_10010892 3300009176 Bacteria 6984
131 Ga0105248_10007823 3300009177 Bacteria 11735
132 Ga0105249_10000455 3300009553 Bacteria 38320
133 Ga0105239_10022030 3300010375 Bacteria 7024
134 Ga0105239_10047341 3300010375 Bacteria 4713
135 Ga0157370_10012344 3300013104 Bacteria 8864
136 Ga0157370_10065604 3300013104 Bacteria 3435
137 Ga0157370_10174606 3300013104 Bacteria 1997
138 Ga0157369_10004681 3300013105 Bacteria 16087
139 Ga0157369_10005292 3300013105 Bacteria 15039
140 Ga0157369_10016466 3300013105 Bacteria 8314
141 Ga0157369_10054839 3300013105 Bacteria 4303
142 Ga0157374_10006638 3300013296 Bacteria 9829
143 Ga0157378_10008722 3300013297 Bacteria 8825
144 Ga0163162_10039705 3300013306 Bacteria 4704
145 Ga0157372_10112329 3300013307 Bacteria 3122
146 Ga0182008_10009394 3300014497 Bacteria 5279
147 Ga0157377_10018953 3300014745 Bacteria 3588
148 Ga0157377_10121297 3300014745 Bacteria 1585
149 Ga0157376_10004112 3300014969 Bacteria 10077
150 Ga0182006_1029917 3300015261 Bacteria 2204
151 Ga0206354_10738253 3300020081 Bacteria 2505
152 Ga0206353_10098901 3300020082 Bacteria 3542
153 Ga0206353_10858635 3300020082 Bacteria 3150
154 Ga0206353_11085992 3300020082 Bacteria 6550
155 Ga0206353_11566952 3300020082 Bacteria 7367
156 Ga0209566_100091 3300025225 Bacteria 141100
157 Ga0207692_10012460 3300025898 Bacteria 3652
158 Ga0207680_10077112 3300025903 Bacteria 2083
159 Ga0207705_10089360 3300025909 Bacteria 2255
160 Ga0207684_10028246 3300025910 Bacteria 4779
161 Ga0207707_10004035 3300025912 Bacteria 13015
162 Ga0207707_10010446 3300025912 Bacteria 8056
163 Ga0207707_10056788 3300025912 Bacteria 3406
164 Ga0207695_10021843 3300025913 Bacteria 7288
165 Ga0207693_10008522 3300025915 Bacteria 8393
166 Ga0207693_10011146 3300025915 Bacteria 7282
167 Ga0207693_10018876 3300025915 Bacteria 5489
168 Ga0207693_10058737 3300025915 Bacteria 3013
169 Ga0207663_10057964 3300025916 Bacteria 2442
170 Ga0207660_10036019 3300025917 Bacteria 3438
171 Ga0207660_10052316 3300025917 Bacteria 2907
172 Ga0207660_10116406 3300025917 Bacteria 2019
173 Ga0207660_10123335 3300025917 Bacteria 1965
174 Ga0207662_10007227 3300025918 Bacteria 6040
175 Ga0207657_10002818 3300025919 Bacteria 18694
176 Ga0207657_10006085 3300025919 Bacteria 12551
177 Ga0207657_10032516 3300025919 Bacteria 4712
178 Ga0207657_10033328 3300025919 Bacteria 4644
179 Ga0207657_10063060 3300025919 Bacteria 3171
180 Ga0207652_10008087 3300025921 Bacteria 8443
181 Ga0207652_10008986 3300025921 Bacteria 8052
182 Ga0207652_10081419 3300025921 Bacteria 2832
183 Ga0207652_10129889 3300025921 Bacteria 2246
184 Ga0207652_10140053 3300025921 Bacteria 2163
185 Ga0207646_10010980 3300025922 Bacteria 8795
186 Ga0207646_10072567 3300025922 Bacteria 3075
187 Ga0207646_10074520 3300025922 Bacteria 3032
188 Ga0207646_10081920 3300025922 Bacteria 2886
189 Ga0207646_10166765 3300025922 Bacteria 1988
190 Ga0207681_10115582 3300025923 Bacteria 1959
191 Ga0207659_10110125 3300025926 Bacteria 2092
192 Ga0207687_10046765 3300025927 Bacteria 2997
193 Ga0207700_10000001 3300025928 Bacteria 1122509
194 Ga0207664_10002761 3300025929 Bacteria 11663
195 Ga0207664_10066699 3300025929 Bacteria 2886
196 Ga0207664_10075706 3300025929 Bacteria 2722
197 Ga0207664_10114100 3300025929 Bacteria 2251
198 Ga0207644_10042062 3300025931 Bacteria 3236
199 Ga0207690_10024216 3300025932 Bacteria 3799
200 Ga0207686_10008417 3300025934 Bacteria 5568
201 Ga0207709_10003892 3300025935 Bacteria 8728
202 Ga0207709_10030621 3300025935 Bacteria 3132
203 Ga0207704_10000598 3300025938 Bacteria 15955
204 Ga0207711_10158450 3300025941 Bacteria 2047
205 Ga0207661_10006127 3300025944 Bacteria 8497
206 Ga0207661_10026809 3300025944 Bacteria 4396
207 Ga0207661_10047390 3300025944 Bacteria 3411
208 Ga0207661_10094232 3300025944 Bacteria 2501
209 Ga0207661_10102093 3300025944 Bacteria 2411
210 Ga0207661_10146193 3300025944 Bacteria 2040
211 Ga0207667_10028622 3300025949 Bacteria 6050
212 Ga0207668_10005084 3300025972 Bacteria 7743
213 Ga0207639_10006531 3300026041 Bacteria 7931
214 Ga0207678_10004642 3300026067 Bacteria 12336
215 Ga0207678_10087408 3300026067 Bacteria 2664
216 Ga0207708_10012961 3300026075 Bacteria 6217
217 Ga0207702_10014176 3300026078 Bacteria 6621
218 Ga0207702_10043045 3300026078 Bacteria 3790
219 Ga0207702_10045043 3300026078 Bacteria 3711
220 Ga0207702_10120230 3300026078 Bacteria 2350
221 Ga0207648_10000545 3300026089 Bacteria 42051
222 Ga0207648_10105238 3300026089 Bacteria 2475
223 Ga0207674_10013588 3300026116 Bacteria 9021
224 Ga0207674_10055411 3300026116 Bacteria 4031
225 Ga0207674_10131526 3300026116 Bacteria 2465
226 Ga0207674_10132226 3300026116 Bacteria 2458
227 Ga0207675_100026223 3300026118 Bacteria 5426
228 Ga0207675_100210251 3300026118 Bacteria 1871
229 Ga0207683_10001146 3300026121 Bacteria 24099
230 Ga0207683_10010100 3300026121 Bacteria 8055
231 Ga0207698_10066527 3300026142 Bacteria 2837
232 Ga0207428_10008127 3300027907 Bacteria 9505
233 Ga0265336_10016551 3300028666 Bacteria 2411
234 Ga0265338_10003237 3300028800 Bacteria 23182
235 Ga0265338_10009626 3300028800 Bacteria 11473
236 Ga0265338_10020368 3300028800 Bacteria 6981
237 Ga0265338_10026701 3300028800 Bacteria 5813
238 Ga0265338_10060107 3300028800 Bacteria 3342
239 Ga0265338_10115199 3300028800 Bacteria 2155
240 Ga0265332_10014019 3300031238 Bacteria 3547
241 Ga0265328_10005336 3300031239 Bacteria 5513
242 Ga0265325_10023285 3300031241 Bacteria 3384
243 Ga0265331_10034675 3300031250 Bacteria 2487
244 Ga0265331_10047822 3300031250 Bacteria 2059
245 Ga0265313_10046916 3300031595 Bacteria 2094
246 Ga0265314_10009407 3300031711 Bacteria 8247
247 Ga0265314_10062743 3300031711 Bacteria 2524
248 Ga0265342_10042725 3300031712 Bacteria 2737
249 Ga0307416_100217097 3300032002 Bacteria 1830
250 Ga0373926_0058376 3300035083 Bacteria 1403
251 Ga0373935_0006752 3300035692 Bacteria 6854
252 Ga0373947_0018864 3300035725 Bacteria 3973
253 Ga0395899_0036883 3300037312 Bacteria 3666
254 Ga0395899_0048287 3300037312 Bacteria 3168
255 Ga0395899_0050794 3300037312 Bacteria 3078
256 Ga0395899_0082665 3300037312 Bacteria 2335
257 Ga0395900_0008212 3300037418 Bacteria 10746
258 Ga0395900_0010857 3300037418 Bacteria 9316
259 Ga0395900_0020120 3300037418 Bacteria 6808
260 Ga0395900_0027944 3300037418 Bacteria 5778
261 Ga0395900_0032109 3300037418 Bacteria 5398
262 Ga0395900_0042577 3300037418 Bacteria 4679
263 Ga0395900_0069583 3300037418 Bacteria 3617
264 Ga0395900_0070318 3300037418 Bacteria 3598
265 Ga0395900_0071358 3300037418 Bacteria 3570
266 Ga0395898_0008298 3300037466 Bacteria 10981
267 Ga0395898_0012785 3300037466 Bacteria 8666
268 Ga0395898_0019992 3300037466 Bacteria 6807
269 Ga0395898_0033403 3300037466 Bacteria 5135
270 Ga0395898_0045002 3300037466 Bacteria 4339
271 Ga0395898_0048749 3300037466 Bacteria 4152
272 Ga0395898_0054214 3300037466 Bacteria 3913
273 Ga0395898_0064496 3300037466 Bacteria 3552
274 Ga0395898_0089597 3300037466 Bacteria 2960
275 Ga0395898_0095473 3300037466 Bacteria 2856
276 Ga0395905_0002931 3300037471 Bacteria 18573
277 Ga0395905_0003978 3300037471 Bacteria 15547
278 Ga0395905_0052396 3300037471 Bacteria 3820
279 Ga0395905_0100325 3300037471 Bacteria 2718
280 Ga0395905_0102786 3300037471 Bacteria 2683
281 Ga0395905_0112088 3300037471 Bacteria 2561
282 Ga0395905_0141022 3300037471 Bacteria 2267
283 Ga0395905_0229845 3300037471 Bacteria 1734
284 Ga0395901_0003419 3300038443 Bacteria 15998
285 Ga0395901_0008716 3300038443 Bacteria 10251
286 Ga0395901_0014135 3300038443 Bacteria 8127
287 Ga0395901_0015042 3300038443 Bacteria 7868
288 Ga0395901_0021492 3300038443 Bacteria 6613
289 Ga0395901_0023304 3300038443 Bacteria 6345
290 Ga0395901_0025946 3300038443 Bacteria 6017
291 Ga0395901_0044128 3300038443 Bacteria 4624
292 Ga0395901_0045603 3300038443 Bacteria 4550
293 Ga0395901_0076617 3300038443 Bacteria 3489
294 Ga0395901_0086385 3300038443 Bacteria 3280
295 Ga0395901_0106409 3300038443 Bacteria 2944
296 Ga0395901_0109206 3300038443 Bacteria 2904
297 Ga0395901_0118083 3300038443 Bacteria 2787
298 Ga0395901_0201857 3300038443 Bacteria 2084
299 Ga0466966_0004480 3300044684 Bacteria 9214
300 Ga0466963_0002737 3300044694 Bacteria 9951
301 Ga0466963_0003699 3300044694 Bacteria 8800
302 Ga0466963_0013512 3300044694 Bacteria 5014
303 Ga0466964_0052257 3300044706 Bacteria 1680
304 Ga0466957_0035768 3300044842 Bacteria 2982
305 Ga0466957_0076099 3300044842 Bacteria 2084
306 Ga0466957_0140397 3300044842 Bacteria 1556
307 Ga0466960_0086012 3300044901 Bacteria 1593
308 Ga0466959_0073361 3300045049 Bacteria 2476
309 Ga0466958_0003273 3300045836 Bacteria 8377
310 Ga0466967_0002705 3300045976 Bacteria 11203
311 Ga0466967_0005048 3300045976 Bacteria 9047
312 Ga0466967_0022834 3300045976 Bacteria 5115
313 Ga0466967_0032694 3300045976 Bacteria 4396
314 Ga0495629_0000751 3300046459 Bacteria 26237
315 Ga0495629_0050627 3300046459 Bacteria 2909
316 Ga0495629_0056229 3300046459 Bacteria 2752
317 Ga0495641_0009558 3300046461 Bacteria 5748
318 Ga0495651_0012925 3300046462 Bacteria 6451
319 Ga0495653_0046839 3300046463 Bacteria 3347
320 Ga0495653_0068397 3300046463 Bacteria 2664
321 Ga0495582_0003370 3300046473 Bacteria 8989
322 Ga0495639_0011389 3300046475 Bacteria 3834
323 Ga0495662_0001641 3300046476 Bacteria 11142
324 Ga0495664_0036196 3300046477 Bacteria 2909
325 Ga0495584_0019601 3300046491 Bacteria 3436
326 Ga0495594_0011798 3300046499 Bacteria 4544
327 Ga0495630_0035280 3300046517 Bacteria 3737
328 Ga0495630_0101747 3300046517 Bacteria 2174
329 Ga0495666_0009994 3300046526 Bacteria 4740
330 Ga0495642_0015556 3300046528 Bacteria 2959
331 Ga0495665_0007335 3300046531 Bacteria 5958
332 Ga0495640_0029547 3300046533 Bacteria 3934
333 Ga0495587_0032532 3300046536 Bacteria 3153
334 Ga0495609_0046074 3300046538 Bacteria 1953
335 Ga0495633_0032264 3300046558 Bacteria 2532
336 Ga0495634_0035249 3300046642 Bacteria 3428
337 Ga0495635_0020614 3300046663 Bacteria 4591
338 Ga0495635_0048282 3300046663 Bacteria 2935
339 Ga0495635_0057742 3300046663 Bacteria 2670
340 Ga0495659_0003121 3300046664 Bacteria 5321
341 Ga0495588_0064556 3300046674 Bacteria 1899
342 Ga0495599_0080722 3300046678 Bacteria 2031
343 Ga0495647_0007554 3300046681 Bacteria 3647
344 Ga0495658_0003447 3300046683 Bacteria 7819
345 Ga0495613_0017945 3300046689 Bacteria 5273
346 Ga0495624_0026383 3300046690 Bacteria 3808
347 Ga0495600_0010448 3300046809 Bacteria 5762
348 Ga0495600_0103912 3300046809 Bacteria 1851
349 Ga0495581_0000085 3300047315 Bacteria 37948
350 Ga0495581_0027371 3300047315 Bacteria 3306
351 Ga0495676_0004108 3300047321 Bacteria 13268
352 Ga0495676_0041156 3300047321 Bacteria 3805
353 Ga0495680_0010033 3300047322 Bacteria 8471
354 Ga0495675_0038268 3300047444 Bacteria 3054
355 Ga0495684_0002707 3300047471 Bacteria 14028
356 Ga0495684_0061940 3300047471 Bacteria 2846
357 Ga0495593_0022576 3300047673 Bacteria 3504
358 Ga0495614_0010240 3300048089 Bacteria 4137
359 Ga0496100_0001687 3300048903 Bacteria 10973
360 Ga0496100_0022323 3300048903 Bacteria 3830
361 Ga0496101_0120824 3300048904 Bacteria 1980
362 Ga0496102_0001796 3300048905 Bacteria 18599
363 Ga0496102_0007525 3300048905 Bacteria 9310
364 Ga0496102_0066683 3300048905 Bacteria 3299
365 Ga0496102_0117954 3300048905 Bacteria 2477
366 Ga0496103_0010837 3300048906 Bacteria 5395
367 Ga0496103_0024202 3300048906 Bacteria 3663
368 Ga0496103_0048268 3300048906 Bacteria 2630
369 Ga0496103_0054793 3300048906 Bacteria 2472
370 Ga0496103_0070044 3300048906 Bacteria 2194
371 Ga0496104_0001866 3300048907 Bacteria 18242
372 Ga0496104_0037925 3300048907 Bacteria 4507
373 Ga0496104_0076662 3300048907 Bacteria 3184
374 Ga0496105_0001252 3300048908 Bacteria 17720
375 Ga0496105_0028647 3300048908 Bacteria 4555
376 Ga0496105_0029174 3300048908 Bacteria 4515
377 Ga0496105_0110217 3300048908 Bacteria 2272
378 Ga0496106_0005910 3300048909 Bacteria 9045
379 Ga0496106_0006937 3300048909 Bacteria 8376
380 Ga0496106_0098721 3300048909 Bacteria 2263
381 Ga0496107_0001701 3300048910 Bacteria 13784
382 Ga0496107_0004774 3300048910 Bacteria 9206
383 Ga0496108_0000913 3300048911 Bacteria 22979
384 Ga0496108_0022964 3300048911 Bacteria 5133
385 Ga0496109_0000515 3300048912 Bacteria 32878
386 Ga0496109_0001552 3300048912 Bacteria 19115
387 Ga0496109_0003818 3300048912 Bacteria 12582
388 Ga0496109_0006655 3300048912 Bacteria 9730
389 Ga0496109_0010139 3300048912 Bacteria 8040
390 Ga0496109_0125040 3300048912 Bacteria 2397
391 Ga0496109_0238960 3300048912 Bacteria 1709
392 Ga0496110_0000913 3300048913 Bacteria 20733
393 Ga0496110_0038457 3300048913 Bacteria 4164
394 Ga0496110_0082238 3300048913 Bacteria 2872
395 Ga0496111_0002620 3300048914 Bacteria 10905
396 Ga0496111_0003042 3300048914 Bacteria 10287
397 Ga0496111_0026071 3300048914 Bacteria 4126
398 Ga0496111_0041576 3300048914 Bacteria 3299
399 Ga0496112_0002099 3300048915 Bacteria 15821
400 Ga0496112_0008408 3300048915 Bacteria 9243
401 Ga0496112_0008988 3300048915 Bacteria 8969
402 Ga0496112_0009671 3300048915 Bacteria 8700
403 Ga0496112_0022852 3300048915 Bacteria 5966
404 Ga0496112_0035040 3300048915 Bacteria 4885
405 Ga0496112_0073344 3300048915 Bacteria 3383
406 Ga0496113_0001382 3300048916 Bacteria 13467
407 Ga0496113_0083492 3300048916 Bacteria 2451
408 Ga0496113_0173279 3300048916 Bacteria 1709
409 Ga0496114_0012984 3300048917 Bacteria 6675
410 Ga0496114_0014998 3300048917 Bacteria 6230
411 Ga0496114_0021725 3300048917 Bacteria 5223
412 Ga0496114_0042008 3300048917 Bacteria 3789
413 Ga0496114_0068832 3300048917 Bacteria 2972
414 Ga0496114_0174111 3300048917 Bacteria 1877
415 Ga0496115_0004912 3300048918 Bacteria 9706
416 Ga0496115_0030696 3300048918 Bacteria 4230
417 Ga0501032_0022963 3300049569 Bacteria 4319
418 Ga0501033_0007070 3300049570 Bacteria 8764
419 Ga0501034_0068190 3300049571 Bacteria 3568
420 Ga0501036_0001804 3300049572 Bacteria 16596
421 Ga0501038_0011884 3300049574 Bacteria 7946
422 Ga0501040_0032223 3300049576 Bacteria 3546
423 Ga0501043_0020623 3300049579 Bacteria 5171
424 Ga0501067_0032870 3300049583 Bacteria 2879
425 Ga0501067_0040887 3300049583 Bacteria 2575
426 Ga0501068_0005667 3300049584 Bacteria 6839
427 Ga0501069_0020514 3300049585 Bacteria 3581
428 Ga0501070_0014628 3300049586 Bacteria 6603
429 Ga0501070_0056368 3300049586 Bacteria 3257
430 Ga0501072_0082428 3300049588 Bacteria 2550
431 Ga0501073_0010225 3300049589 Bacteria 6893
432 Ga0501073_0026546 3300049589 Bacteria 4148
433 Ga0501074_0015032 3300049590 Bacteria 5631
434 Ga0501077_0002494 3300049593 Bacteria 11023
435 Ga0501079_0041013 3300049741 Bacteria 3572
436 Ga0501079_0049373 3300049741 Bacteria 3247
437 Ga0501080_0004694 3300049742 Bacteria 12188
438 Ga0501080_0012605 3300049742 Bacteria 7751
439 Ga0501081_0032604 3300049743 Bacteria 3535
440 Ga0501083_0001091 3300049744 Bacteria 18157
441 Ga0501083_0023980 3300049744 Bacteria 4229
442 Ga0501035_0007364 3300049822 Bacteria 10284
443 Ga0501045_0000874 3300049824 Bacteria 19549
444 nmdc:mga00v17_13818_c1 3300050491 Bacteria 4490
445 nmdc:mga0yw44_19945_c1 3300050492 Bacteria 3709
446 nmdc:mga0yw44_23362_c1 3300050492 Bacteria 3483
447 nmdc:mga05p37_32946_c1 3300050507 Bacteria 6343
448 nmdc:mga05p37_66538_c1 3300050507 Bacteria 4433
449 nmdc:mga05p37_8376_c1 3300050507 Bacteria 12226
450 nmdc:mga09592_36024_c1 3300050508 Bacteria 4145
451 nmdc:mga0qj67_55637_c1 3300050509 Bacteria 3135
452 nmdc:mga06r32_165132_c1 3300050510 Bacteria 2197
453 nmdc:mga06r32_98353_c1 3300050510 Bacteria 2868
454 nmdc:mga08y16_25814_c1 3300050511 Bacteria 6200
455 nmdc:mga08y16_59606_c1 3300050511 Bacteria 3986
456 nmdc:mga0n895_219091_c1 3300050512 Bacteria 1932
457 nmdc:mga0n895_80745_c1 3300050512 Bacteria 3241
458 nmdc:mga0rr50_4408_c1 3300050513 Bacteria 8272
459 nmdc:mga0a205_4507_c1 3300050515 Bacteria 6175
460 nmdc:mga0a205_7907_c1 3300050515 Bacteria 9658
461 Ga0495655_0004989 3300053083 Bacteria 2314
462 Ga0495619_0002855 3300053085 Bacteria 11246
463 Ga0495619_0055795 3300053085 Bacteria 2618
464 Ga0495619_0085255 3300053085 Bacteria 2133
465 Ga0530510_0052782 3300061734 Bacteria 2936
466 Ga0530510_0105031 3300061734 Bacteria 2067
467 8002317736 8002317523 Bacteria 8051857
468 Ga0466967_0000335
469 JGI24744J21845_10000718
470 Ga0055541_1001976
471 Ga0070658_10004865
472 Ga0070658_10016816
473 Ga0070658_10150166
474 Ga0070683_100000658
475 Ga0070683_100045775
476 Ga0070683_100106179
477 Ga0070683_100209476
478 Ga0070690_100022233
479 Ga0070680_100010854
480 Ga0070680_100022115
481 Ga0070680_100023143
482 Ga0070682_100006677
483 Ga0070682_100052054
484 Ga0070660_100016428
485 Ga0070660_100039041
486 Ga0070660_100048304
487 Ga0070660_100060334
488 Ga0070660_100080484
489 Ga0070689_100022184
490 Ga0070691_10055094
491 Ga0070687_100002901
492 Ga0070661_100053392
493 Ga0070692_10009690
494 Ga0070668_100004701
495 Ga0070669_100093402
496 Ga0070688_100010065
497 Ga0070659_100034945
498 Ga0070709_10026242
499 Ga0070714_100032248
500 Ga0070714_100131974
501 Ga0070714_100198238
502 Ga0070713_100037878
503 Ga0070710_10003203
504 Ga0070701_10006687
505 Ga0070711_100017686
506 Ga0070711_100101709
507 Ga0070700_100010546
508 Ga0070708_100081539
509 Ga0070663_100001667
510 Ga0070678_100001730
511 Ga0070681_10038492
512 Ga0068867_100001632
513 Ga0070685_10003109
514 Ga0070706_100017206
515 Ga0070706_100019661
516 Ga0070707_100002182
517 Ga0070707_100009728
518 Ga0070707_100039603
519 Ga0070707_100232863
520 Ga0070698_100001402
521 Ga0070698_100018251
522 Ga0070698_100040233
523 Ga0070698_100050912
524 Ga0070679_100013914
525 Ga0070679_100046088
526 Ga0070684_100000113
527 Ga0070684_100000993
528 Ga0070684_100071902
529 Ga0070684_100084914
530 Ga0070684_100186838
531 Ga0070697_100083353
532 Ga0068853_100012011
533 Ga0070672_100013315
534 Ga0070686_100006620
535 Ga0070696_100013783
536 Ga0070696_100013789
537 Ga0070693_100008797
538 Ga0070665_100043261
539 Ga0070704_100004845
540 Ga0068855_100042807
541 Ga0068855_100204513
542 Ga0068855_100333339
543 Ga0068857_100016408
544 Ga0068856_100007496
545 Ga0068856_100031153
546 Ga0068856_100056820
547 Ga0068856_100081955
548 Ga0070702_100004493
549 Ga0068852_100018773
550 Ga0068859_100102533
551 Ga0068866_10000367
552 Ga0068861_100025741
553 Ga0068860_100041191
554 Ga0081455_10004668
555 Ga0081455_10016759
556 Ga0081455_10018677
557 Ga0081455_10084040
558 Ga0081538_10003582
559 Ga0081538_10013554
560 Ga0081540_1009349
561 Ga0081539_10001397
562 Ga0081539_10001497
563 Ga0070717_10024746
564 Ga0070717_10041296
565 Ga0070717_10056427
566 Ga0075365_10080982
567 Ga0075365_10092425
568 Ga0075364_10030219
569 Ga0070712_100010988
570 Ga0075362_10036664
571 Ga0097621_100013753
572 Ga0068871_100006279
573 Ga0075428_100008003
574 Ga0075431_100006510
575 Ga0075431_100082176
576 Ga0075433_10010493
577 Ga0075433_10013279
578 Ga0075434_100023795
579 Ga0068865_100001537
580 Ga0075436_100002713
581 Ga0097620_100102535
582 Ga0075435_100003253
583 Ga0105240_10033924
584 Ga0111539_10058711
585 Ga0111539_10154689
586 Ga0111539_10208656
587 Ga0105245_10003789
588 Ga0105245_10061871
589 Ga0105245_10167337
590 Ga0105245_10187941
591 Ga0114129_10010992
592 Ga0114129_10016892
593 Ga0114129_10046926
594 Ga0114129_10047095
595 Ga0114129_10080183
596 Ga0105243_10026950
597 Ga0105242_10010892
598 Ga0105248_10007823
599 Ga0105249_10000455
600 Ga0105239_10022030
601 Ga0105239_10047341
602 Ga0157370_10012344
603 Ga0157370_10065604
604 Ga0157370_10174606
605 Ga0157369_10004681
606 Ga0157369_10005292
607 Ga0157369_10016466
608 Ga0157369_10054839
609 Ga0157374_10006638
610 Ga0157378_10008722
611 Ga0163162_10039705
612 Ga0157372_10112329
613 Ga0182008_10009394
614 Ga0157377_10018953
615 Ga0157377_10121297
616 Ga0157376_10004112
617 Ga0182006_1029917
618 Ga0206354_10738253
619 Ga0206353_10098901
620 Ga0206353_10858635
621 Ga0206353_11085992
622 Ga0206353_11566952
623 Ga0209566_100091
624 Ga0207692_10012460
625 Ga0207680_10077112
626 Ga0207705_10089360
627 Ga0207684_10028246
628 Ga0207707_10004035
629 Ga0207707_10010446
630 Ga0207707_10056788
631 Ga0207695_10021843
632 Ga0207693_10008522
633 Ga0207693_10011146
634 Ga0207693_10018876
635 Ga0207693_10058737
636 Ga0207663_10057964
637 Ga0207660_10036019
638 Ga0207660_10052316
639 Ga0207660_10116406
640 Ga0207660_10123335
641 Ga0207662_10007227
642 Ga0207657_10002818
643 Ga0207657_10006085
644 Ga0207657_10032516
645 Ga0207657_10033328
646 Ga0207657_10063060
647 Ga0207652_10008087
648 Ga0207652_10008986
649 Ga0207652_10081419
650 Ga0207652_10129889
651 Ga0207652_10140053
652 Ga0207646_10010980
653 Ga0207646_10072567
654 Ga0207646_10074520
655 Ga0207646_10081920
656 Ga0207646_10166765
657 Ga0207681_10115582
658 Ga0207659_10110125
659 Ga0207687_10046765
660 Ga0207700_10000001
661 Ga0207664_10002761
662 Ga0207664_10066699
663 Ga0207664_10075706
664 Ga0207664_10114100
665 Ga0207644_10042062
666 Ga0207690_10024216
667 Ga0207686_10008417
668 Ga0207709_10003892
669 Ga0207709_10030621
670 Ga0207704_10000598
671 Ga0207711_10158450
672 Ga0207661_10006127
673 Ga0207661_10026809
674 Ga0207661_10047390
675 Ga0207661_10094232
676 Ga0207661_10102093
677 Ga0207661_10146193
678 Ga0207667_10028622
679 Ga0207668_10005084
680 Ga0207639_10006531
681 Ga0207678_10004642
682 Ga0207678_10087408
683 Ga0207708_10012961
684 Ga0207702_10014176
685 Ga0207702_10043045
686 Ga0207702_10045043
687 Ga0207702_10120230
688 Ga0207648_10000545
689 Ga0207648_10105238
690 Ga0207674_10013588
691 Ga0207674_10055411
692 Ga0207674_10131526
693 Ga0207674_10132226
694 Ga0207675_100026223
695 Ga0207675_100210251
696 Ga0207683_10001146
697 Ga0207683_10010100
698 Ga0207698_10066527
699 Ga0207428_10008127
700 Ga0265336_10016551
701 Ga0265338_10003237
702 Ga0265338_10009626
703 Ga0265338_10020368
704 Ga0265338_10026701
705 Ga0265338_10060107
706 Ga0265338_10115199
707 Ga0265332_10014019
708 Ga0265328_10005336
709 Ga0265325_10023285
710 Ga0265331_10034675
711 Ga0265331_10047822
712 Ga0265313_10046916
713 Ga0265314_10009407
714 Ga0265314_10062743
715 Ga0265342_10042725
716 Ga0307416_100217097
717 Ga0373926_0058376
718 Ga0373935_0006752
719 Ga0373947_0018864
720 Ga0395899_0036883
721 Ga0395899_0048287
722 Ga0395899_0050794
723 Ga0395899_0082665
724 Ga0395900_0008212
725 Ga0395900_0010857
726 Ga0395900_0020120
727 Ga0395900_0027944
728 Ga0395900_0032109
729 Ga0395900_0042577
730 Ga0395900_0069583
731 Ga0395900_0070318
732 Ga0395900_0071358
733 Ga0395898_0008298
734 Ga0395898_0012785
735 Ga0395898_0019992
736 Ga0395898_0033403
737 Ga0395898_0045002
738 Ga0395898_0048749
739 Ga0395898_0054214
740 Ga0395898_0064496
741 Ga0395898_0089597
742 Ga0395898_0095473
743 Ga0395905_0002931
744 Ga0395905_0003978
745 Ga0395905_0052396
746 Ga0395905_0100325
747 Ga0395905_0102786
748 Ga0395905_0112088
749 Ga0395905_0141022
750 Ga0395905_0229845
751 Ga0395901_0003419
752 Ga0395901_0008716
753 Ga0395901_0014135
754 Ga0395901_0015042
755 Ga0395901_0021492
756 Ga0395901_0023304
757 Ga0395901_0025946
758 Ga0395901_0044128
759 Ga0395901_0045603
760 Ga0395901_0076617
761 Ga0395901_0086385
762 Ga0395901_0106409
763 Ga0395901_0109206
764 Ga0395901_0118083
765 Ga0395901_0201857
766 Ga0466966_0004480
767 Ga0466963_0002737
768 Ga0466963_0003699
769 Ga0466963_0013512
770 Ga0466964_0052257
771 Ga0466957_0035768
772 Ga0466957_0076099
773 Ga0466957_0140397
774 Ga0466960_0086012
775 Ga0466959_0073361
776 Ga0466958_0003273
777 Ga0466967_0002705
778 Ga0466967_0005048
779 Ga0466967_0022834
780 Ga0466967_0032694
781 Ga0495629_0000751
782 Ga0495629_0050627
783 Ga0495629_0056229
784 Ga0495641_0009558
785 Ga0495651_0012925
786 Ga0495653_0046839
787 Ga0495653_0068397
788 Ga0495582_0003370
789 Ga0495639_0011389
790 Ga0495662_0001641
791 Ga0495664_0036196
792 Ga0495584_0019601
793 Ga0495594_0011798
794 Ga0495630_0035280
795 Ga0495630_0101747
796 Ga0495666_0009994
797 Ga0495642_0015556
798 Ga0495665_0007335
799 Ga0495640_0029547
800 Ga0495587_0032532
801 Ga0495609_0046074
802 Ga0495633_0032264
803 Ga0495634_0035249
804 Ga0495635_0020614
805 Ga0495635_0048282
806 Ga0495635_0057742
807 Ga0495659_0003121
808 Ga0495588_0064556
809 Ga0495599_0080722
810 Ga0495647_0007554
811 Ga0495658_0003447
812 Ga0495613_0017945
813 Ga0495624_0026383
814 Ga0495600_0010448
815 Ga0495600_0103912
816 Ga0495581_0000085
817 Ga0495581_0027371
818 Ga0495676_0004108
819 Ga0495676_0041156
820 Ga0495680_0010033
821 Ga0495675_0038268
822 Ga0495684_0002707
823 Ga0495684_0061940
824 Ga0495593_0022576
825 Ga0495614_0010240
826 Ga0496100_0001687
827 Ga0496100_0022323
828 Ga0496101_0120824
829 Ga0496102_0001796
830 Ga0496102_0007525
831 Ga0496102_0066683
832 Ga0496102_0117954
833 Ga0496103_0010837
834 Ga0496103_0024202
835 Ga0496103_0048268
836 Ga0496103_0054793
837 Ga0496103_0070044
838 Ga0496104_0001866
839 Ga0496104_0037925
840 Ga0496104_0076662
841 Ga0496105_0001252
842 Ga0496105_0028647
843 Ga0496105_0029174
844 Ga0496105_0110217
845 Ga0496106_0005910
846 Ga0496106_0006937
847 Ga0496106_0098721
848 Ga0496107_0001701
849 Ga0496107_0004774
850 Ga0496108_0000913
851 Ga0496108_0022964
852 Ga0496109_0000515
853 Ga0496109_0001552
854 Ga0496109_0003818
855 Ga0496109_0006655
856 Ga0496109_0010139
857 Ga0496109_0125040
858 Ga0496109_0238960
859 Ga0496110_0000913
860 Ga0496110_0038457
861 Ga0496110_0082238
862 Ga0496111_0002620
863 Ga0496111_0003042
864 Ga0496111_0026071
865 Ga0496111_0041576
866 Ga0496112_0002099
867 Ga0496112_0008408
868 Ga0496112_0008988
869 Ga0496112_0009671
870 Ga0496112_0022852
871 Ga0496112_0035040
872 Ga0496112_0073344
873 Ga0496113_0001382
874 Ga0496113_0083492
875 Ga0496113_0173279
876 Ga0496114_0012984
877 Ga0496114_0014998
878 Ga0496114_0021725
879 Ga0496114_0042008
880 Ga0496114_0068832
881 Ga0496114_0174111
882 Ga0496115_0004912
883 Ga0496115_0030696
884 Ga0501032_0022963
885 Ga0501033_0007070
886 Ga0501034_0068190
887 Ga0501036_0001804
888 Ga0501038_0011884
889 Ga0501040_0032223
890 Ga0501043_0020623
891 Ga0501067_0032870
892 Ga0501067_0040887
893 Ga0501068_0005667
894 Ga0501069_0020514
895 Ga0501070_0014628
896 Ga0501070_0056368
897 Ga0501072_0082428
898 Ga0501073_0010225
899 Ga0501073_0026546
900 Ga0501074_0015032
901 Ga0501077_0002494
902 Ga0501079_0041013
903 Ga0501079_0049373
904 Ga0501080_0004694
905 Ga0501080_0012605
906 Ga0501081_0032604
907 Ga0501083_0001091
908 Ga0501083_0023980
909 Ga0501035_0007364
910 Ga0501045_0000874
911 nmdc:mga00v17_13818_c1
912 nmdc:mga0yw44_19945_c1
913 nmdc:mga0yw44_23362_c1
914 nmdc:mga05p37_32946_c1
915 nmdc:mga05p37_66538_c1
916 nmdc:mga05p37_8376_c1
917 nmdc:mga09592_36024_c1
918 nmdc:mga0qj67_55637_c1
919 nmdc:mga06r32_165132_c1
920 nmdc:mga06r32_98353_c1
921 nmdc:mga08y16_25814_c1
922 nmdc:mga08y16_59606_c1
923 nmdc:mga0n895_219091_c1
924 nmdc:mga0n895_80745_c1
925 nmdc:mga0rr50_4408_c1
926 nmdc:mga0a205_4507_c1
927 nmdc:mga0a205_7907_c1
928 Ga0495655_0004989
929 Ga0495619_0002855
930 Ga0495619_0055795
931 Ga0495619_0085255
932 Ga0530510_0052782
933 Ga0530510_0105031
934 8002317736

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02397

Bac_transf

Bacterial sugar transferase

338

526

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g1n-assembly1.cif.gz_A structure of campylobacter concisus pglc i57m/q175m variant with modeled c-terminus 0.8171 306 494
8g1n-assembly2.cif.gz_B structure of campylobacter concisus pglc i57m/q175m variant with modeled c-terminus 0.8142 306 496
8e37-assembly4.cif.gz_D structure of campylobacter concisus wild-type semet pglc 0.8099 306 496
8e37-assembly4.cif.gz_D structure of campylobacter concisus wild-type semet pglc 0.7778 306 496
8g1n-assembly2.cif.gz_B structure of campylobacter concisus pglc i57m/q175m variant with modeled c-terminus 0.7519 306 496
ID Description Score Start End Superfamily
af_Q2FXY4_446_708_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8 225 270 3.60.15.10
af_A0A0R4IUQ4_322_512_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.763 226 269 3.80.10.10
af_Q9M3B6_236_303_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.7437 225 273 3.20.20.60
af_Q2G1K5_138_265_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7248 176 295 3.40.50.720
af_Q57630_173_255_3.40.50.10700 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;AF0625-like 0.7242 179 269 3.40.50.10700
ID Description Score Start End GO Terms
AF-A0A3L7UAT2-F1-model_v4 Sugar transferase 0.9613 304 426 GO:0016020
GO:0016780
AF-A0A2N1QQS5-F1-model_v4 Glycosyl transferase 0.9601 302 428 GO:0016020
GO:0016780
AF-A0A5C5SSE5-F1-model_v4 Sugar transferase 0.9321 307 500 GO:0016020
GO:0016780
AF-A0A2N5H7M1-F1-model_v4 Multidrug MFS transporter 0.9264 311 500 GO:0016020
GO:0016780
AF-A0A1I5X7K9-F1-model_v4 Sugar transferase 0.926 302 448 GO:0016020
GO:0016780

Map