F449670

General Info

Members Datasets Scaffolds Average Seq Length
466 280 422 326

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10000055|Ga0182008_1000005553
Length 356
Sequence VPHGAALLPDRAPERARFPLQETSMRIRTRALLPAALALLALAGPALNRSAQAQQAPAWPTKPIKYVVPFSPGGVSDGVARLVAQHLGERLGQPVIVDNKPGVSGILGTQAVARSPADGYTLMGGTITTHAVNPFFTRQLGYDPVKDFAPVNLVGMVSNVLVVPAESRFNSVAQVIAELKAKPDSLTYGTAGAGTSQHLSGQLFQNITQTRMRQIIYKGGSQAMVDLVGGQIDMVFETVAAARPMIDGKRVKVLGVTAARRLPDVPGAPTLAEAGAPNFEMQSWQGVFAPAGTPKPIVDRLSREIAAIVAQPEVQQKLRNLGVEPDGRTAAAFASFQQAEILKWGKVIHDAGIQAE

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221569 Achromobacter sp. Root565 Isolate Unclassified
8 2643221594 Achromobacter sp. Root170 Isolate Unclassified
9 2643221621 Achromobacter sp. Root83 Isolate Unclassified
10 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
11 2643221658 Variovorax sp. Root411 Isolate Unclassified
12 2643221672 Variovorax sp. Root434 Isolate Unclassified
13 2643221683 Variovorax sp. Root473 Isolate Unclassified
14 2738541277 Variovorax sp. GV051 Isolate Unclassified
15 2738541307 Variovorax sp. GV008 Isolate Unclassified
16 2738543012 Acidovorax sp. CF301 Isolate Unclassified
17 2738543019 Variovorax sp. GV040 Isolate Unclassified
18 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
19 2816332133 Acidovorax radicis 2721A Isolate Unclassified
20 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
21 2842677519 Variovorax sp. R-72495 Isolate Unclassified
22 2842747753 Variovorax sp. R-72060 Isolate Unclassified
23 2855730933 Achromobacter sp. HZ28 Isolate Nodule
24 2855767633 Achromobacter sp. HZ34 Isolate Nodule
25 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
26 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
27 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
28 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
29 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
30 2904456579 Variovorax sp. 2002 Isolate Unclassified
31 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
32 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
33 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
34 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
35 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
36 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
37 2929520902 Variovorax beijingensis 502 Isolate Unclassified
38 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
39 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
40 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
41 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
42 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
43 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
44 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
45 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
46 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
47 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
48 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
49 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
50 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
51 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
52 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
53 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
54 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
55 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
56 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
57 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
58 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
59 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
60 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
61 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
62 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
63 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
64 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
65 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
66 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
67 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
68 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
69 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
70 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
97 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
98 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
119 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
120 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
121 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
122 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
123 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
124 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
135 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
155 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
162 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
163 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
164 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
165 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
181 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
182 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
183 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
184 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
185 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
186 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
187 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
188 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
189 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
190 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
191 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
192 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
193 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
194 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
195 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
196 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
197 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
198 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
199 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
200 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
201 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
204 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
205 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
206 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
207 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
210 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
211 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
214 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
215 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
216 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
219 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
220 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
224 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
225 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
226 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
227 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
228 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
229 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
230 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
240 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
247 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
248 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
249 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
251 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
256 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
257 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
258 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
259 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
260 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
261 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
262 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
263 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
264 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
265 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
266 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
267 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
268 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
269 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
270 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
271 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
272 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
273 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
274 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
275 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
276 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
277 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
278 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
279 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
280 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.13
Metatranscriptomes 0.43
Isolates 9.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 38.41
Nodule 2.15
Rhizoplane 2.15
Rhizosphere 42.7
Stem 0
Stem Tuber 0
Unclassified 14.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10014239 3300001989 Bacteria 2895
2 JGI25155J39150_1000220 3300002704 Bacteria 22848
3 JGI25156J39149_1000089 3300002705 Bacteria 68168
4 JGI25154J39366_1000115 3300002738 Bacteria 68056
5 JGI25157J39369_1000118 3300002741 Bacteria 68168
6 JGI25159J45721_1000350 3300002987 Bacteria 21268
7 JGI25159J45721_1007802 3300002987 Bacteria 3017
8 JGI25151J46595_10000410 3300003187 Bacteria 44063
9 JGI25151J46595_10001080 3300003187 Bacteria 20266
10 JGI25151J46595_10007668 3300003187 Bacteria 5263
11 JGI25151J46595_10014679 3300003187 Bacteria 3480
12 JGI25151J46595_10014750 3300003187 Bacteria 3469
13 JGI25151J46595_10036676 3300003187 Bacteria 1847
14 JGI25160J50197_1002770 3300003354 Bacteria 8034
15 JGI25161J50226_1000124 3300003374 Bacteria 56436
16 JGI25161J50226_1000228 3300003374 Bacteria 34378
17 JGI25161J50226_1003944 3300003374 Bacteria 3227
18 Ga0006562J51391_1140944 3300003578 Bacteria 3424
19 Ga0006562J51391_1140946 3300003578 Bacteria 1980
20 Ga0055526_1000286 3300003771 Bacteria 42291
21 Ga0055526_1001140 3300003771 Bacteria 19236
22 Ga0055526_1002556 3300003771 Bacteria 12210
23 Ga0055526_1007498 3300003771 Bacteria 5652
24 Ga0055526_1038333 3300003771 Bacteria 1237
25 Ga0055537_1000206 3300003773 Bacteria 44166
26 Ga0055537_1000656 3300003773 Bacteria 18177
27 Ga0055524_1000119 3300003775 Bacteria 92710
28 Ga0055536_1000075 3300003781 Bacteria 84621
29 Ga0055536_1001227 3300003781 Bacteria 15869
30 Ga0055536_1001917 3300003781 Bacteria 12061
31 Ga0055536_1022673 3300003781 Bacteria 1866
32 Ga0055534_1000197 3300003784 Bacteria 44166
33 Ga0055534_1002270 3300003784 Bacteria 6765
34 Ga0055534_1003052 3300003784 Bacteria 5483
35 Ga0055534_1007001 3300003784 Bacteria 2755
36 Ga0055528_1000352 3300003790 Bacteria 37775
37 Ga0055528_1001400 3300003790 Bacteria 14779
38 Ga0055530_10000326 3300003791 Bacteria 43089
39 Ga0055530_10000991 3300003791 Bacteria 22764
40 Ga0055530_10001150 3300003791 Bacteria 20567
41 Ga0055540_1000058 3300003792 Bacteria 136015
42 Ga0055540_1000405 3300003792 Bacteria 34908
43 Ga0055540_1001486 3300003792 Bacteria 13927
44 Ga0055531_10000515 3300003794 Bacteria 34908
45 Ga0055531_10000594 3300003794 Bacteria 31564
46 Ga0055531_10002297 3300003794 Bacteria 12923
47 Ga0055543_1000547 3300004625 Bacteria 21093
48 Ga0055543_1001172 3300004625 Bacteria 11143
49 Ga0065165_1003472 3300005262 Bacteria 11012
50 Ga0065165_1022208 3300005262 Bacteria 2182
51 Ga0065165_1031171 3300005262 Bacteria 1688
52 Ga0065714_10065432 3300005288 Bacteria 10120
53 Ga0065707_10086566 3300005295 Bacteria 5399
54 Ga0070658_10120979 3300005327 Bacteria 2175
55 Ga0070676_10093156 3300005328 Bacteria 1849
56 Ga0068869_100112565 3300005334 Bacteria 2072
57 Ga0068869_100120749 3300005334 Bacteria 2004
58 Ga0070669_100028306 3300005353 Bacteria 4036
59 Ga0070674_100005784 3300005356 Bacteria 7177
60 Ga0070678_100159214 3300005456 Bacteria 1827
61 Ga0068867_100008998 3300005459 Bacteria 7044
62 Ga0068867_100097263 3300005459 Bacteria 2242
63 Ga0070707_100482899 3300005468 Bacteria 1201
64 Ga0070684_100286259 3300005535 Bacteria 1510
65 Ga0068853_100094395 3300005539 Bacteria 2635
66 Ga0070672_100046623 3300005543 Bacteria 3359
67 Ga0070665_100023112 3300005548 Bacteria 6262
68 Ga0070664_100040086 3300005564 Bacteria 3948
69 Ga0068852_100039864 3300005616 Bacteria 3958
70 Ga0068859_100061290 3300005617 Bacteria 3791
71 Ga0068859_100147950 3300005617 Bacteria 2424
72 Ga0068861_100012323 3300005719 Bacteria 5963
73 Ga0068858_100030821 3300005842 Bacteria 4981
74 Ga0068860_100036880 3300005843 Bacteria 4681
75 Ga0068862_100023570 3300005844 Bacteria 5157
76 Ga0075365_10094734 3300006038 Bacteria 2038
77 Ga0075363_100008465 3300006048 Bacteria 4791
78 Ga0075364_10001355 3300006051 Bacteria 13215
79 Ga0075364_10015461 3300006051 Bacteria 4735
80 Ga0075364_10017594 3300006051 Bacteria 4469
81 Ga0075432_10030839 3300006058 Bacteria 1854
82 Ga0075432_10081259 3300006058 Bacteria 1175
83 Ga0075362_10015823 3300006177 Bacteria 3076
84 Ga0075369_10037554 3300006186 Bacteria 2063
85 Ga0075366_10060968 3300006195 Bacteria 2241
86 Ga0097621_100064434 3300006237 Bacteria 3014
87 Ga0075370_10024438 3300006353 Bacteria 3337
88 Ga0075370_10127607 3300006353 Bacteria 1483
89 Ga0068865_100003924 3300006881 Bacteria 8928
90 Ga0097620_100061289 3300006931 Bacteria 3791
91 Ga0097620_100147948 3300006931 Bacteria 2424
92 Ga0079104_1005680 3300006946 Bacteria 4920
93 Ga0099826_10000012 3300006948 Bacteria 283499
94 Ga0099826_10000023 3300006948 Bacteria 154989
95 Ga0099826_10010950 3300006948 Bacteria 6811
96 Ga0105244_10000730 3300009036 Bacteria 28251
97 Ga0105240_10020735 3300009093 Bacteria 8756
98 Ga0105245_10146002 3300009098 Bacteria 2232
99 Ga0114129_10540220 3300009147 Bacteria 1517
100 Ga0105243_10000106 3300009148 Bacteria 95432
101 Ga0105243_10005183 3300009148 Bacteria 10205
102 Ga0105243_10287074 3300009148 Bacteria 1485
103 Ga0105237_10027494 3300009545 Bacteria 5806
104 Ga0105238_10086972 3300009551 Bacteria 3113
105 Ga0105249_10063378 3300009553 Bacteria 3396
106 Ga0105239_10052918 3300010375 Bacteria 4453
107 Ga0105246_10077089 3300011119 Bacteria 2364
108 Ga0105246_10125407 3300011119 Bacteria 1909
109 Ga0157373_10012365 3300013100 Bacteria 6276
110 Ga0157370_10000335 3300013104 Bacteria 59202
111 Ga0163162_10008337 3300013306 Bacteria 10109
112 Ga0163162_10033737 3300013306 Bacteria 5087
113 Ga0157375_10031440 3300013308 Bacteria 5019
114 Ga0157380_10013851 3300014326 Bacteria 5889
115 Ga0157380_10026158 3300014326 Bacteria 4430
116 Ga0182008_10000055 3300014497 Bacteria 102214
117 Ga0182008_10000288 3300014497 Bacteria 39629
118 Ga0182008_10004838 3300014497 Bacteria 7782
119 Ga0157379_10276986 3300014968 Bacteria 1526
120 Ga0182006_1000910 3300015261 Bacteria 19716
121 Ga0182007_10000119 3300015262 Bacteria 54423
122 Ga0182007_10003127 3300015262 Bacteria 7959
123 Ga0182007_10020136 3300015262 Bacteria 2390
124 Ga0163161_10002026 3300017792 Bacteria 14665
125 Ga0163161_10050333 3300017792 Bacteria 3014
126 Ga0163161_10180724 3300017792 Bacteria 1617
127 Ga0209435_100002 3300025206 Bacteria 794178
128 Ga0207425_1001269 3300025245 Bacteria 11019
129 Ga0207425_1006511 3300025245 Bacteria 3186
130 Ga0207425_1008057 3300025245 Bacteria 2729
131 Ga0207425_1011028 3300025245 Bacteria 2176
132 Ga0209646_1000001 3300025246 Bacteria 3092932
133 Ga0209026_1000001 3300025250 Bacteria 1228671
134 Ga0209759_1000001 3300025256 Bacteria 2799452
135 Ga0209129_1006258 3300025258 Bacteria 3922
136 Ga0209129_1016973 3300025258 Bacteria 1443
137 Ga0209565_1000021 3300025263 Bacteria 406281
138 Ga0209565_1000043 3300025263 Bacteria 235332
139 Ga0209565_1000147 3300025263 Bacteria 96886
140 Ga0209565_1000182 3300025263 Bacteria 77316
141 Ga0209565_1000629 3300025263 Bacteria 23126
142 Ga0209673_1000008 3300025273 Bacteria 626013
143 Ga0209673_1000106 3300025273 Bacteria 185426
144 Ga0209673_1000787 3300025273 Bacteria 42345
145 Ga0209673_1001604 3300025273 Bacteria 19856
146 Ga0209673_1016706 3300025273 Bacteria 2732
147 Ga0209130_1000276 3300025284 Bacteria 63841
148 Ga0209130_1000606 3300025284 Bacteria 34652
149 Ga0209130_1001029 3300025284 Bacteria 21394
150 Ga0209130_1006044 3300025284 Bacteria 4024
151 Ga0209675_1000040 3300025291 Bacteria 247535
152 Ga0209675_1000058 3300025291 Bacteria 185426
153 Ga0209675_1000170 3300025291 Bacteria 78095
154 Ga0209675_1000436 3300025291 Bacteria 33133
155 Ga0209675_1001297 3300025291 Bacteria 14843
156 Ga0209675_1002098 3300025291 Bacteria 10563
157 Ga0209675_1002264 3300025291 Bacteria 10037
158 Ga0209676_1000004 3300025292 Bacteria 1138360
159 Ga0209676_1000014 3300025292 Bacteria 793514
160 Ga0209676_1000023 3300025292 Bacteria 589732
161 Ga0209676_1000703 3300025292 Bacteria 46688
162 Ga0209676_1000827 3300025292 Bacteria 40175
163 Ga0209676_1001688 3300025292 Bacteria 19130
164 Ga0209676_1002758 3300025292 Bacteria 11753
165 Ga0209676_1014291 3300025292 Bacteria 2994
166 Ga0209676_1025730 3300025292 Bacteria 1882
167 Ga0209676_1036275 3300025292 Bacteria 1436
168 Ga0209025_1000018 3300025294 Bacteria 686898
169 Ga0209025_1000029 3300025294 Bacteria 488571
170 Ga0209025_1000092 3300025294 Bacteria 247020
171 Ga0209025_1000791 3300025294 Bacteria 51895
172 Ga0209025_1001431 3300025294 Bacteria 31473
173 Ga0209025_1001749 3300025294 Bacteria 26075
174 Ga0209025_1002763 3300025294 Bacteria 17729
175 Ga0209025_1005706 3300025294 Bacteria 10015
176 Ga0209025_1006655 3300025294 Bacteria 8881
177 Ga0209025_1029610 3300025294 Bacteria 2643
178 Ga0209025_1041985 3300025294 Bacteria 1949
179 Ga0209025_1058550 3300025294 Bacteria 1462
180 Ga0209564_1000159 3300025295 Bacteria 164319
181 Ga0209564_1000218 3300025295 Bacteria 130563
182 Ga0209564_1000253 3300025295 Bacteria 114335
183 Ga0209564_1000267 3300025295 Bacteria 109962
184 Ga0209564_1000651 3300025295 Bacteria 51999
185 Ga0209564_1000931 3300025295 Bacteria 37971
186 Ga0209564_1001552 3300025295 Bacteria 22658
187 Ga0209564_1001606 3300025295 Bacteria 21978
188 Ga0209564_1016687 3300025295 Bacteria 2904
189 Ga0209758_1001558 3300025297 Bacteria 26293
190 Ga0209050_1000002 3300025298 Bacteria 1792849
191 Ga0209050_1000022 3300025298 Bacteria 565239
192 Ga0209050_1000250 3300025298 Bacteria 115980
193 Ga0209050_1001805 3300025298 Bacteria 20932
194 Ga0209050_1002358 3300025298 Bacteria 16481
195 Ga0209050_1009296 3300025298 Bacteria 5055
196 Ga0209050_1034007 3300025298 Bacteria 1534
197 Ga0209256_1000001 3300025299 Bacteria 2166974
198 Ga0209256_1000166 3300025299 Bacteria 133549
199 Ga0209256_1000259 3300025299 Bacteria 94161
200 Ga0209256_1000345 3300025299 Bacteria 75475
201 Ga0209256_1001396 3300025299 Bacteria 25177
202 Ga0209256_1031441 3300025299 Bacteria 1452
203 Ga0207426_1000117 3300025302 Bacteria 224652
204 Ga0207426_1000389 3300025302 Bacteria 75042
205 Ga0207426_1003724 3300025302 Bacteria 7963
206 Ga0209051_1000002 3300025303 Bacteria 1631846
207 Ga0209051_1000013 3300025303 Bacteria 565239
208 Ga0209051_1000128 3300025303 Bacteria 142159
209 Ga0209051_1000160 3300025303 Bacteria 126473
210 Ga0209051_1003182 3300025303 Bacteria 10972
211 Ga0209257_1000002 3300025304 Bacteria 1767052
212 Ga0209257_1000042 3300025304 Bacteria 537149
213 Ga0209257_1000116 3300025304 Bacteria 228733
214 Ga0209257_1011025 3300025304 Bacteria 4435
215 Ga0209257_1024384 3300025304 Bacteria 2095
216 Ga0207655_1001409 3300025728 Bacteria 22356
217 Ga0207680_10147917 3300025903 Bacteria 1564
218 Ga0207671_10039370 3300025914 Bacteria 3501
219 Ga0207662_10251423 3300025918 Bacteria 1160
220 Ga0207681_10014951 3300025923 Bacteria 4835
221 Ga0207694_10035918 3300025924 Bacteria 3802
222 Ga0207706_10011593 3300025933 Bacteria 8030
223 Ga0207709_10000077 3300025935 Bacteria 169923
224 Ga0207709_10002008 3300025935 Bacteria 13202
225 Ga0207669_10064340 3300025937 Bacteria 2269
226 Ga0207691_10030957 3300025940 Bacteria 4997
227 Ga0207679_10240845 3300025945 Bacteria 1533
228 Ga0207712_10071718 3300025961 Bacteria 2492
229 Ga0207639_10060691 3300026041 Bacteria 2918
230 Ga0207639_10077397 3300026041 Bacteria 2622
231 Ga0207639_10291989 3300026041 Bacteria 1438
232 Ga0207708_10014098 3300026075 Bacteria 5973
233 Ga0207648_10000476 3300026089 Bacteria 44737
234 Ga0207675_100000846 3300026118 Bacteria 30438
235 Ga0207698_10175444 3300026142 Bacteria 1892
236 Ga0209281_1013317 3300027111 Bacteria 1779
237 Ga0209282_1000010 3300027666 Bacteria 231627
238 Ga0209282_1000047 3300027666 Bacteria 114735
239 Ga0209282_1027574 3300027666 Bacteria 3528
240 Ga0207428_10029142 3300027907 Bacteria 4579
241 Ga0268266_10247366 3300028379 Bacteria 1648
242 Ga0268265_10017961 3300028380 Bacteria 4894
243 Ga0268264_10036052 3300028381 Bacteria 4072
244 Ga0307515_10175302 3300028794 Bacteria 2118
245 Ga0307511_10000043 3300030521 Bacteria 101232
246 Ga0316178_1176130 3300030735 Bacteria 1353
247 Ga0316183_1122424 3300030742 Bacteria 4383
248 Ga0316181_1001445 3300030744 Bacteria 3645
249 Ga0316182_1339543 3300030745 Bacteria 5853
250 Ga0307513_10000006 3300031456 Bacteria 470848
251 Ga0307513_10000256 3300031456 Bacteria 76296
252 Ga0307513_10000922 3300031456 Bacteria 42476
253 Ga0307408_100017899 3300031548 Bacteria 4749
254 Ga0307408_100047480 3300031548 Bacteria 3075
255 Ga0307408_100051824 3300031548 Bacteria 2958
256 Ga0307514_10003247 3300031649 Bacteria 15881
257 Ga0307514_10006603 3300031649 Bacteria 10068
258 Ga0307516_10132284 3300031730 Bacteria 2272
259 Ga0307405_10032264 3300031731 Bacteria 3094
260 Ga0307405_10175097 3300031731 Bacteria 1534
261 Ga0307410_10211704 3300031852 Bacteria 1486
262 Ga0307406_10001083 3300031901 Bacteria 15154
263 Ga0307412_10000078 3300031911 Bacteria 94880
264 Ga0307412_10052414 3300031911 Bacteria 2701
265 Ga0307412_10067131 3300031911 Bacteria 2434
266 Ga0307414_10080409 3300032004 Bacteria 2383
267 Ga0307414_10219236 3300032004 Bacteria 1561
268 Ga0307507_10028225 3300033179 Bacteria 5987
269 Ga0373927_0092187 3300035695 Bacteria 1968
270 Ga0373947_0079028 3300035725 Bacteria 2032
271 Ga0373925_0002246 3300037068 Bacteria 15638
272 Ga0395905_0004609 3300037471 Bacteria 14265
273 Ga0439436_0008527 3300041404 Bacteria 3152
274 Ga0439436_0028228 3300041404 Bacteria 1638
275 Ga0439439_0001277 3300041406 Bacteria 4915
276 Ga0439439_0012339 3300041406 Bacteria 2065
277 Ga0439465_0001337 3300041413 Bacteria 7919
278 Ga0451793_1028782 3300041452 Bacteria 1224
279 Ga0439431_0013369 3300041997 Bacteria 1893
280 Ga0439431_0040903 3300041997 Bacteria 1180
281 Ga0439433_0000393 3300041999 Bacteria 7867
282 Ga0439432_004303 3300042006 Bacteria 5205
283 Ga0439449_0000440 3300042007 Bacteria 15398
284 Ga0439449_0000524 3300042007 Bacteria 14275
285 Ga0439449_0001348 3300042007 Bacteria 9624
286 Ga0439452_002764 3300042010 Bacteria 6338
287 Ga0439452_020872 3300042010 Bacteria 1713
288 Ga0439457_018025 3300042014 Bacteria 1567
289 Ga0439462_0003030 3300042015 Bacteria 3991
290 Ga0439462_0007225 3300042015 Bacteria 2779
291 Ga0450923_015904 3300042125 Bacteria 1411
292 Ga0450897_001389 3300042128 Bacteria 1646
293 Ga0450894_009065 3300042131 Bacteria 1288
294 Ga0450896_006406 3300042133 Bacteria 1614
295 Ga0450898_008431 3300042134 Bacteria 1626
296 Ga0450889_005050 3300042144 Bacteria 1309
297 Ga0450906_012668 3300042145 Bacteria 1561
298 Ga0450908_001161 3300042184 Bacteria 5108
299 Ga0450908_003232 3300042184 Bacteria 3170
300 Ga0450909_002449 3300042185 Bacteria 2629
301 Ga0450918_002781 3300042531 Bacteria 3280
302 Ga0453683_0001518 3300044673 Bacteria 19816
303 Ga0451576_0001358 3300045051 Bacteria 42179
304 Ga0451576_0142537 3300045051 Bacteria 2499
305 Ga0495627_010818 3300046453 Bacteria 3298
306 Ga0495627_012259 3300046453 Bacteria 3049
307 Ga0495605_0030930 3300046474 Bacteria 2738
308 Ga0495584_0011697 3300046491 Bacteria 4489
309 Ga0495596_0000019 3300046500 Bacteria 114118
310 Ga0495607_0005103 3300046501 Bacteria 9501
311 Ga0495607_0009706 3300046501 Bacteria 6499
312 Ga0495606_0098357 3300046507 Bacteria 1786
313 Ga0495610_0000236 3300046512 Bacteria 58261
314 Ga0495610_0000335 3300046512 Bacteria 49783
315 Ga0495616_0000910 3300046513 Bacteria 21315
316 Ga0495616_0003531 3300046513 Bacteria 9994
317 Ga0495616_0005308 3300046513 Bacteria 7942
318 Ga0495620_0004438 3300046515 Bacteria 7910
319 Ga0495631_0000426 3300046518 Bacteria 29159
320 Ga0495637_0024045 3300046520 Bacteria 2758
321 Ga0495648_0048702 3300046524 Bacteria 2606
322 Ga0495609_0000303 3300046538 Bacteria 45167
323 Ga0495609_0001301 3300046538 Bacteria 17021
324 Ga0495597_0032162 3300046542 Bacteria 2382
325 Ga0495668_0079397 3300046616 Bacteria 1801
326 Ga0495625_0000052 3300046660 Bacteria 190656
327 Ga0495661_0001190 3300046665 Bacteria 22598
328 Ga0495661_0009903 3300046665 Bacteria 6520
329 Ga0495588_0018296 3300046674 Bacteria 3414
330 Ga0495658_0130125 3300046683 Bacteria 1531
331 Ga0495669_0059285 3300046684 Bacteria 1728
332 Ga0495670_0025593 3300046691 Bacteria 2919
333 Ga0495671_0000179 3300046692 Bacteria 56305
334 Ga0495671_0000844 3300046692 Bacteria 21889
335 Ga0495671_0013694 3300046692 Bacteria 4383
336 Ga0495649_0001931 3300046694 Bacteria 15113
337 Ga0495649_0004858 3300046694 Bacteria 8687
338 Ga0495649_0081312 3300046694 Bacteria 1732
339 Ga0495589_0073834 3300046794 Bacteria 1664
340 Ga0495687_040098 3300047443 Bacteria 2066
341 Ga0495673_0062114 3300047469 Bacteria 1597
342 Ga0495593_0003390 3300047673 Bacteria 9548
343 Ga0495602_0134475 3300048088 Bacteria 1967
344 Ga0496101_0037371 3300048904 Bacteria 3444
345 Ga0496102_0222979 3300048905 Bacteria 1778
346 Ga0496102_0248489 3300048905 Bacteria 1677
347 Ga0496104_0304826 3300048907 Bacteria 1505
348 Ga0496106_0193558 3300048909 Bacteria 1617
349 Ga0496107_0364628 3300048910 Bacteria 1075
350 Ga0496116_0001387 3300048919 Bacteria 27308
351 Ga0496116_0001641 3300048919 Bacteria 24629
352 Ga0496116_0027514 3300048919 Bacteria 4139
353 Ga0496116_0044202 3300048919 Bacteria 3028
354 Ga0496117_0018840 3300048920 Bacteria 5696
355 Ga0496121_0002946 3300048924 Bacteria 24853
356 Ga0496121_0004777 3300048924 Bacteria 17872
357 Ga0496121_0007804 3300048924 Bacteria 12815
358 Ga0496121_0092971 3300048924 Bacteria 2349
359 Ga0496121_0236980 3300048924 Bacteria 1274
360 Ga0496122_0000909 3300048925 Bacteria 54439
361 Ga0496122_0010767 3300048925 Bacteria 9379
362 Ga0496122_0021263 3300048925 Bacteria 5815
363 Ga0496122_0109589 3300048925 Bacteria 1817
364 Ga0496123_0000340 3300048926 Bacteria 88113
365 Ga0496123_0001714 3300048926 Bacteria 29271
366 Ga0496123_0005612 3300048926 Bacteria 12538
367 Ga0496123_0046315 3300048926 Bacteria 2951
368 Ga0496124_0000007 3300048927 Bacteria 883534
369 Ga0496124_0084568 3300048927 Bacteria 2601
370 Ga0496124_0097094 3300048927 Bacteria 2393
371 Ga0496124_0124835 3300048927 Bacteria 2052
372 Ga0496125_0000826 3300048928 Bacteria 49960
373 Ga0496125_0009240 3300048928 Bacteria 10180
374 Ga0496125_0032747 3300048928 Bacteria 4613
375 Ga0496125_0167272 3300048928 Bacteria 1484
376 Ga0496125_0180673 3300048928 Bacteria 1406
377 Ga0501033_0096677 3300049570 Bacteria 2158
378 Ga0501034_0024664 3300049571 Bacteria 6116
379 Ga0501072_0072088 3300049588 Bacteria 2730
380 Ga0501249_012870 3300049679 Bacteria 1773
381 Ga0501262_000456 3300049759 Bacteria 4867
382 nmdc:mga03683_139712_c1 3300050489 Bacteria 1088
383 nmdc:mga03683_32210_c1 3300050489 Bacteria 2108
384 nmdc:mga03n38_2646_c1 3300050490 Bacteria 5591
385 nmdc:mga03n38_6498_c1 3300050490 Bacteria 4066
386 nmdc:mga00v17_14083_c1 3300050491 Bacteria 4457
387 nmdc:mga00v17_42075_c1 3300050491 Bacteria 2746
388 nmdc:mga00v17_527_c1 3300050491 Bacteria 21481
389 nmdc:mga0yw44_38766_c1 3300050492 Bacteria 2822
390 nmdc:mga0k408_4275_c1 3300050493 Bacteria 7582
391 nmdc:mga07m45_70902_c1 3300050496 Bacteria 1983
392 nmdc:mga05p37_272254_c1 3300050507 Bacteria 2022
393 nmdc:mga05p37_399788_c1 3300050507 Bacteria 1604
394 nmdc:mga0sz30_10778_c1 3300050516 Bacteria 3510
395 Ga0500610_0042921 3300053079 Bacteria 2341
396 Ga0500610_0048965 3300053079 Bacteria 2197
397 Ga0500578_0062060 3300053086 Bacteria 2386
398 Ga0500643_019981 3300053087 Bacteria 2198
399 Ga0500646_0000249 3300053090 Bacteria 16508
400 Ga0500651_0022849 3300053093 Bacteria 3910
401 Ga0500562_025654 3300053108 Bacteria 1543
402 Ga0500571_000041 3300053110 Bacteria 40237
403 Ga0500592_008293 3300053116 Bacteria 1649
404 Ga0500593_003219 3300053117 Bacteria 6130
405 Ga0500594_0007488 3300053118 Bacteria 2470
406 Ga0500597_013321 3300053120 Bacteria 3047
407 Ga0500607_001827 3300053121 Bacteria 18349
408 Ga0500618_015165 3300053125 Bacteria 1952
409 Ga0500655_000865 3300053133 Bacteria 5886
410 Ga0500658_0000058 3300053134 Bacteria 55299
411 Ga0500658_0000614 3300053134 Bacteria 14765
412 Ga0500559_0027061 3300053136 Bacteria 2446
413 Ga0500564_029172 3300053138 Bacteria 2541
414 Ga0500568_0001884 3300053139 Bacteria 12913
415 Ga0500574_019333 3300053141 Bacteria 1694
416 Ga0500590_008005 3300053148 Bacteria 5260
417 Ga0500604_0000152 3300053151 Bacteria 20372
418 Ga0500634_0008806 3300053161 Bacteria 5064
419 Ga0500634_0172652 3300053161 Unclassified 983
420 Ga0500638_074683 3300053162 Bacteria 1616
421 Ga0500645_000596 3300053730 Bacteria 23287
422 Ga0500645_001272 3300053730 Bacteria 13207

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042131 Ga0450894_009065 Ga0450894_009065_423_1262 279
2 3300048910 Ga0496107_0364628 Ga0496107_0364628_191_1063 290
3 3300053161 Ga0500634_0172652 Ga0500634_0172652_47_922 291
4 3300050489 nmdc:mga03683_139712_c1 nmdc:mga03683_139712_c1_162_1046 294
5 3300005617 Ga0068859_100061290 Ga0068859_1000612903 299
6 3300006931 Ga0097620_100061289 Ga0097620_1000612893 299
7 3300025918 Ga0207662_10251423 Ga0207662_102514231 300
8 3300030521 Ga0307511_10000043 Ga0307511_1000004367 302
9 3300003187 JGI25151J46595_10000410 JGI25151J46595_1000041020 304
10 3300006051 Ga0075364_10001355 Ga0075364_1000135512 304
11 3300025294 Ga0209025_1000018 Ga0209025_1000018229 304
12 3300048904 Ga0496101_0037371 Ga0496101_0037371_791_1765 304
13 3300050491 nmdc:mga00v17_527_c1 nmdc:mga00v17_527_c1_12814_13791 304
14 3300031456 Ga0307513_10000006 Ga0307513_10000006285 308
15 3300031730 Ga0307516_10132284 Ga0307516_101322843 308
16 3300031911 Ga0307412_10067131 Ga0307412_100671312 309
17 3300046474 Ga0495605_0030930 Ga0495605_0030930_16_954 309
18 3300046501 Ga0495607_0009706 Ga0495607_0009706_415_1353 309
19 3300046512 Ga0495610_0000236 Ga0495610_0000236_51958_52896 309
20 3300046513 Ga0495616_0000910 Ga0495616_0000910_16800_17738 309
21 3300046524 Ga0495648_0048702 Ga0495648_0048702_363_1301 309
22 3300046538 Ga0495609_0000303 Ga0495609_0000303_5317_6255 309
23 3300046542 Ga0495597_0032162 Ga0495597_0032162_1051_1989 309
24 3300046665 Ga0495661_0001190 Ga0495661_0001190_4276_5214 309
25 3300046684 Ga0495669_0059285 Ga0495669_0059285_590_1528 309
26 3300046694 Ga0495649_0004858 Ga0495649_0004858_2468_3406 309
27 3300046794 Ga0495589_0073834 Ga0495589_0073834_90_1028 309
28 3300048919 Ga0496116_0001387 Ga0496116_0001387_5350_6288 309
29 3300048924 Ga0496121_0002946 Ga0496121_0002946_18824_19762 309
30 3300048925 Ga0496122_0000909 Ga0496122_0000909_4372_5310 309
31 3300048926 Ga0496123_0001714 Ga0496123_0001714_22862_23800 309
32 3300048928 Ga0496125_0180673 Ga0496125_0180673_94_1032 309
33 3300053090 Ga0500646_0000249 Ga0500646_0000249_10298_11305 310
34 3300053151 Ga0500604_0000152 Ga0500604_0000152_6663_7670 310
35 3300002704 JGI25155J39150_1000220 JGI25155J39150_100022014 311
36 3300002705 JGI25156J39149_1000089 JGI25156J39149_100008954 311
37 3300002738 JGI25154J39366_1000115 JGI25154J39366_100011554 311
38 3300002741 JGI25157J39369_1000118 JGI25157J39369_100011815 311
39 3300005334 Ga0068869_100120749 Ga0068869_1001207492 311
40 3300005353 Ga0070669_100028306 Ga0070669_1000283064 311
41 3300005356 Ga0070674_100005784 Ga0070674_1000057846 311
42 3300005459 Ga0068867_100008998 Ga0068867_1000089986 311
43 3300005543 Ga0070672_100046623 Ga0070672_1000466233 311
44 3300005617 Ga0068859_100147950 Ga0068859_1001479502 311
45 3300005719 Ga0068861_100012323 Ga0068861_1000123234 311
46 3300005843 Ga0068860_100036880 Ga0068860_1000368802 311
47 3300005844 Ga0068862_100023570 Ga0068862_1000235703 311
48 3300006881 Ga0068865_100003924 Ga0068865_1000039243 311
49 3300006931 Ga0097620_100147948 Ga0097620_1001479482 311
50 3300009553 Ga0105249_10063378 Ga0105249_100633783 311
51 3300013306 Ga0163162_10008337 Ga0163162_100083378 311
52 3300013308 Ga0157375_10031440 Ga0157375_100314405 311
53 3300014326 Ga0157380_10026158 Ga0157380_100261582 311
54 3300014968 Ga0157379_10276986 Ga0157379_102769862 311
55 3300017792 Ga0163161_10050333 Ga0163161_100503333 311
56 3300025206 Ga0209435_100002 Ga0209435_10000242 311
57 3300025246 Ga0209646_1000001 Ga0209646_10000012185 311
58 3300025250 Ga0209026_1000001 Ga0209026_1000001842 311
59 3300025256 Ga0209759_1000001 Ga0209759_10000011816 311
60 3300025923 Ga0207681_10014951 Ga0207681_100149514 311
61 3300025937 Ga0207669_10064340 Ga0207669_100643402 311
62 3300025940 Ga0207691_10030957 Ga0207691_100309573 311
63 3300025961 Ga0207712_10071718 Ga0207712_100717182 311
64 3300026075 Ga0207708_10014098 Ga0207708_100140985 311
65 3300026089 Ga0207648_10000476 Ga0207648_1000047630 311
66 3300026118 Ga0207675_100000846 Ga0207675_1000008464 311
67 3300028380 Ga0268265_10017961 Ga0268265_100179613 311
68 3300028381 Ga0268264_10036052 Ga0268264_100360524 311
69 3300037471 Ga0395905_0004609 Ga0395905_0004609_3140_4126 311
70 3300025903 Ga0207680_10147917 Ga0207680_101479171 312
71 3300005295 Ga0065707_10086566 Ga0065707_100865662 313
72 3300048905 Ga0496102_0248489 Ga0496102_0248489_178_1218 313
73 3300006058 Ga0075432_10030839 Ga0075432_100308392 314
74 3300006195 Ga0075366_10060968 Ga0075366_100609682 314
75 3300025294 Ga0209025_1058550 Ga0209025_10585501 314
76 3300046660 Ga0495625_0000052 Ga0495625_0000052_114424_115419 314
77 3300048919 Ga0496116_0027514 Ga0496116_0027514_2729_3694 314
78 3300048920 Ga0496117_0018840 Ga0496117_0018840_45_1010 314
79 3300048926 Ga0496123_0046315 Ga0496123_0046315_1968_2933 314
80 3300048927 Ga0496124_0000007 Ga0496124_0000007_344403_345386 314
81 3300049570 Ga0501033_0096677 Ga0501033_0096677_1153_2118 314
82 3300049571 Ga0501034_0024664 Ga0501034_0024664_3496_4461 314
83 3300050492 nmdc:mga0yw44_38766_c1 nmdc:mga0yw44_38766_c1_928_1923 314
84 3300050493 nmdc:mga0k408_4275_c1 nmdc:mga0k408_4275_c1_6540_7535 314
85 3300042134 Ga0450898_008431 Ga0450898_008431_485_1510 315
86 3300046507 Ga0495606_0098357 Ga0495606_0098357_767_1741 315
87 3300048924 Ga0496121_0007804 Ga0496121_0007804_6724_7719 315
88 3300048925 Ga0496122_0021263 Ga0496122_0021263_879_1853 315
89 3300048926 Ga0496123_0005612 Ga0496123_0005612_3499_4473 315
90 3300031456 Ga0307513_10000922 Ga0307513_1000092210 316
91 3300005328 Ga0070676_10093156 Ga0070676_100931561 317
92 3300005456 Ga0070678_100159214 Ga0070678_1001592142 317
93 3300005459 Ga0068867_100097263 Ga0068867_1000972632 317
94 3300005842 Ga0068858_100030821 Ga0068858_1000308215 317
95 3300009147 Ga0114129_10540220 Ga0114129_105402201 317
96 3300013306 Ga0163162_10033737 Ga0163162_100337372 317
97 3300014326 Ga0157380_10013851 Ga0157380_100138518 317
98 3300014497 Ga0182008_10000288 Ga0182008_1000028823 317
99 3300015262 Ga0182007_10000119 Ga0182007_1000011925 317
100 3300017792 Ga0163161_10180724 Ga0163161_101807242 317
101 3300044673 Ga0453683_0001518 Ga0453683_0001518_14083_15051 317
102 3300045051 Ga0451576_0001358 Ga0451576_0001358_18487_19455 317
103 3300046500 Ga0495596_0000019 Ga0495596_0000019_38813_39787 317
104 3300046692 Ga0495671_0000844 Ga0495671_0000844_5332_6306 317
105 3300048928 Ga0496125_0167272 Ga0496125_0167272_238_1257 317
106 3300049588 Ga0501072_0072088 Ga0501072_0072088_1574_2542 317
107 3300050507 nmdc:mga05p37_272254_c1 nmdc:mga05p37_272254_c1_901_1866 317
108 3300050507 nmdc:mga05p37_399788_c1 nmdc:mga05p37_399788_c1_480_1448 317
109 3300042184 Ga0450908_003232 Ga0450908_003232_1901_2869 318
110 iso_pu_bacteria 2904541872 2904542759 318
111 iso_pu_bacteria 2929160207 2929168008 318
112 iso_pu_bacteria 2945984333 2945985870 318
113 3300002987 JGI25159J45721_1007802 JGI25159J45721_10078024 319
114 3300003781 Ga0055536_1022673 Ga0055536_10226732 319
115 3300003791 Ga0055530_10001150 Ga0055530_1000115013 319
116 3300003792 Ga0055540_1000058 Ga0055540_100005813 319
117 3300003794 Ga0055531_10002297 Ga0055531_100022975 319
118 3300005262 Ga0065165_1022208 Ga0065165_10222082 319
119 3300009148 Ga0105243_10000106 Ga0105243_1000010610 319
120 3300017792 Ga0163161_10002026 Ga0163161_100020265 319
121 3300025284 Ga0209130_1000276 Ga0209130_100027614 319
122 3300025292 Ga0209676_1000023 Ga0209676_1000023137 319
123 3300025295 Ga0209564_1001552 Ga0209564_100155215 319
124 3300025298 Ga0209050_1000022 Ga0209050_1000022119 319
125 3300025302 Ga0207426_1003724 Ga0207426_10037246 319
126 3300025303 Ga0209051_1000013 Ga0209051_1000013119 319
127 3300025304 Ga0209257_1000042 Ga0209257_1000042367 319
128 3300025935 Ga0207709_10000077 Ga0207709_10000077158 319
129 3300048924 Ga0496121_0236980 Ga0496121_0236980_87_1094 319
130 3300053730 Ga0500645_001272 Ga0500645_001272_4912_5925 319
131 iso_pu_bacteria 2643221569 2643858655 319
132 iso_pu_bacteria 2643221594 2643982289 319
133 iso_pu_bacteria 2643221621 2644120891 319
134 iso_pu_bacteria 2738541277 2738722356 319
135 iso_pu_bacteria 2738541307 2738883155 319
136 iso_pu_bacteria 2738543012 2739242370 319
137 iso_pu_bacteria 2738543019 2739282720 319
138 iso_pu_bacteria 2808606395 2809034405 319
139 iso_pu_bacteria 2816332133 2816470013 319
140 iso_pu_bacteria 2842747753 2842752980 319
141 iso_pu_bacteria 2857537821 2857542398 319
142 iso_pu_bacteria 2857542790 2857544016 319
143 iso_pu_bacteria 2881412998 2881413392 319
144 iso_pu_bacteria 2939631187 2939632822 319
145 3300002987 JGI25159J45721_1000350 JGI25159J45721_100035010 320
146 3300003187 JGI25151J46595_10014750 JGI25151J46595_100147502 320
147 3300003187 JGI25151J46595_10036676 JGI25151J46595_100366761 320
148 3300003354 JGI25160J50197_1002770 JGI25160J50197_100277010 320
149 3300003374 JGI25161J50226_1000124 JGI25161J50226_10001243 320
150 3300003374 JGI25161J50226_1000228 JGI25161J50226_100022812 320
151 3300003771 Ga0055526_1001140 Ga0055526_100114012 320
152 3300003773 Ga0055537_1000656 Ga0055537_10006566 320
153 3300003775 Ga0055524_1000119 Ga0055524_100011971 320
154 3300003784 Ga0055534_1002270 Ga0055534_10022704 320
155 3300003790 Ga0055528_1001400 Ga0055528_100140012 320
156 3300004625 Ga0055543_1000547 Ga0055543_10005477 320
157 3300005262 Ga0065165_1031171 Ga0065165_10311712 320
158 3300025245 Ga0207425_1008057 Ga0207425_10080572 320
159 3300025245 Ga0207425_1011028 Ga0207425_10110282 320
160 3300025263 Ga0209565_1000043 Ga0209565_100004370 320
161 3300025273 Ga0209673_1000008 Ga0209673_1000008297 320
162 3300025284 Ga0209130_1000606 Ga0209130_100060612 320
163 3300025291 Ga0209675_1000170 Ga0209675_100017045 320
164 3300025292 Ga0209676_1002758 Ga0209676_100275810 320
165 3300025292 Ga0209676_1014291 Ga0209676_10142914 320
166 3300025294 Ga0209025_1001431 Ga0209025_10014319 320
167 3300025294 Ga0209025_1041985 Ga0209025_10419852 320
168 3300025295 Ga0209564_1000931 Ga0209564_100093118 320
169 3300025295 Ga0209564_1016687 Ga0209564_10166873 320
170 3300025298 Ga0209050_1009296 Ga0209050_10092962 320
171 3300025298 Ga0209050_1034007 Ga0209050_10340072 320
172 3300025299 Ga0209256_1000001 Ga0209256_10000011604 320
173 3300025302 Ga0207426_1000117 Ga0207426_1000117191 320
174 3300025304 Ga0209257_1011025 Ga0209257_10110252 320
175 3300025304 Ga0209257_1024384 Ga0209257_10243842 320
176 3300026041 Ga0207639_10077397 Ga0207639_100773973 320
177 3300031456 Ga0307513_10000256 Ga0307513_1000025664 320
178 3300046453 Ga0495627_012259 Ga0495627_012259_746_1741 320
179 iso_pu_bacteria 2855730933 2855731700 320
180 iso_pu_bacteria 2855767633 2855768406 320
181 iso_pu_bacteria 2904479285 2904482893 320
182 3300041997 Ga0439431_0013369 Ga0439431_0013369_568_1569 321
183 3300048909 Ga0496106_0193558 Ga0496106_0193558_298_1332 321
184 3300053086 Ga0500578_0062060 Ga0500578_0062060_671_1705 321
185 iso_pu_bacteria 2513020051 2513228574 321
186 iso_pu_bacteria 2599185214 2599622559 321
187 iso_pu_bacteria 2599185226 2599671038 321
188 iso_pu_bacteria 2599185227 2599679925 321
189 iso_pu_bacteria 2599185229 2599691941 321
190 iso_pu_bacteria 2643221658 2644327803 321
191 iso_pu_bacteria 2643221672 2644400500 321
192 iso_pu_bacteria 2643221683 2644464878 321
193 iso_pu_bacteria 2831265667 2831267599 321
194 iso_pu_bacteria 2885192300 2885194904 321
195 iso_pu_bacteria 2928084124 2928088337 321
196 iso_pu_bacteria 2928115317 2928115699 321
197 iso_pu_bacteria 2945984333 2945986700 321
198 3300003187 JGI25151J46595_10001080 JGI25151J46595_1000108010 322
199 3300005535 Ga0070684_100286259 Ga0070684_1002862592 322
200 3300005548 Ga0070665_100023112 Ga0070665_1000231125 322
201 3300006051 Ga0075364_10015461 Ga0075364_100154614 322
202 3300006051 Ga0075364_10017594 Ga0075364_100175942 322
203 3300006353 Ga0075370_10127607 Ga0075370_101276072 322
204 3300025291 Ga0209675_1002264 Ga0209675_10022645 322
205 3300025292 Ga0209676_1001688 Ga0209676_10016882 322
206 3300025292 Ga0209676_1025730 Ga0209676_10257302 322
207 3300025294 Ga0209025_1000029 Ga0209025_1000029398 322
208 3300025294 Ga0209025_1029610 Ga0209025_10296103 322
209 3300025298 Ga0209050_1001805 Ga0209050_10018053 322
210 3300025298 Ga0209050_1002358 Ga0209050_100235812 322
211 3300028379 Ga0268266_10247366 Ga0268266_102473661 322
212 3300031911 Ga0307412_10000078 Ga0307412_100000786 322
213 3300032004 Ga0307414_10219236 Ga0307414_102192362 322
214 3300041452 Ga0451793_1028782 Ga0451793_1028782_179_1165 322
215 3300046491 Ga0495584_0011697 Ga0495584_0011697_3156_4136 322
216 3300046501 Ga0495607_0005103 Ga0495607_0005103_7431_8411 322
217 3300046512 Ga0495610_0000335 Ga0495610_0000335_42824_43804 322
218 3300046513 Ga0495616_0003531 Ga0495616_0003531_6094_7074 322
219 3300046538 Ga0495609_0001301 Ga0495609_0001301_256_1236 322
220 3300046665 Ga0495661_0009903 Ga0495661_0009903_4519_5499 322
221 3300046692 Ga0495671_0000179 Ga0495671_0000179_7588_8568 322
222 3300046694 Ga0495649_0001931 Ga0495649_0001931_4191_5171 322
223 3300046694 Ga0495649_0081312 Ga0495649_0081312_534_1514 322
224 3300047469 Ga0495673_0062114 Ga0495673_0062114_445_1425 322
225 3300048919 Ga0496116_0001641 Ga0496116_0001641_6860_7840 322
226 3300048924 Ga0496121_0004777 Ga0496121_0004777_9130_10110 322
227 3300048925 Ga0496122_0010767 Ga0496122_0010767_7483_8463 322
228 3300048926 Ga0496123_0000340 Ga0496123_0000340_79597_80577 322
229 3300048927 Ga0496124_0097094 Ga0496124_0097094_429_1415 322
230 3300048927 Ga0496124_0124835 Ga0496124_0124835_1006_1983 322
231 3300048928 Ga0496125_0000826 Ga0496125_0000826_11057_12034 322
232 3300050491 nmdc:mga00v17_14083_c1 nmdc:mga00v17_14083_c1_2536_3513 322
233 3300050491 nmdc:mga00v17_42075_c1 nmdc:mga00v17_42075_c1_735_1724 322
234 3300003187 JGI25151J46595_10007668 JGI25151J46595_100076684 323
235 3300003771 Ga0055526_1002556 Ga0055526_100255614 323
236 3300003771 Ga0055526_1038333 Ga0055526_10383332 323
237 3300003781 Ga0055536_1000075 Ga0055536_100007558 323
238 3300003784 Ga0055534_1003052 Ga0055534_10030524 323
239 3300005539 Ga0068853_100094395 Ga0068853_1000943952 323
240 3300006948 Ga0099826_10000012 Ga0099826_1000001235 323
241 3300009093 Ga0105240_10020735 Ga0105240_100207355 323
242 3300009545 Ga0105237_10027494 Ga0105237_100274944 323
243 3300014497 Ga0182008_10000055 Ga0182008_1000005553 323
244 3300025263 Ga0209565_1000021 Ga0209565_1000021156 323
245 3300025273 Ga0209673_1016706 Ga0209673_10167062 323
246 3300025284 Ga0209130_1006044 Ga0209130_10060442 323
247 3300025291 Ga0209675_1000040 Ga0209675_100004061 323
248 3300025291 Ga0209675_1001297 Ga0209675_10012979 323
249 3300025292 Ga0209676_1000014 Ga0209676_1000014593 323
250 3300025294 Ga0209025_1000092 Ga0209025_100009261 323
251 3300025294 Ga0209025_1001749 Ga0209025_100174915 323
252 3300025294 Ga0209025_1002763 Ga0209025_100276314 323
253 3300025295 Ga0209564_1000159 Ga0209564_100015985 323
254 3300025295 Ga0209564_1000218 Ga0209564_100021848 323
255 3300025295 Ga0209564_1001606 Ga0209564_100160614 323
256 3300025299 Ga0209256_1000345 Ga0209256_100034562 323
257 3300025299 Ga0209256_1001396 Ga0209256_10013965 323
258 3300025303 Ga0209051_1003182 Ga0209051_10031824 323
259 3300025914 Ga0207671_10039370 Ga0207671_100393702 323
260 3300026041 Ga0207639_10060691 Ga0207639_100606912 323
261 3300027666 Ga0209282_1000010 Ga0209282_100001038 323
262 3300031649 Ga0307514_10006603 Ga0307514_100066036 323
263 3300033179 Ga0307507_10028225 Ga0307507_100282256 323
264 3300035695 Ga0373927_0092187 Ga0373927_0092187_388_1383 323
265 3300035725 Ga0373947_0079028 Ga0373947_0079028_288_1283 323
266 3300037068 Ga0373925_0002246 Ga0373925_0002246_1370_2365 323
267 3300042144 Ga0450889_005050 Ga0450889_005050_94_1068 323
268 3300045051 Ga0451576_0142537 Ga0451576_0142537_1157_2149 323
269 iso_pu_bacteria 2643221628 2644158792 323
270 iso_pu_bacteria 2842677519 2842678519 323
271 iso_pu_bacteria 2904449895 2904453792 323
272 iso_pu_bacteria 2904456579 2904462980 323
273 iso_pu_bacteria 2919462493 2919465063 323
274 iso_pu_bacteria 2929520902 2929525024 323
275 iso_pu_bacteria 2945945610 2945948652 323
276 iso_pu_bacteria 2945972063 2945972551 323
277 iso_pu_bacteria 2954767861 2954768084 323
278 3300003771 Ga0055526_1000286 Ga0055526_10002866 324
279 3300003784 Ga0055534_1007001 Ga0055534_10070013 324
280 3300005327 Ga0070658_10120979 Ga0070658_101209792 324
281 3300006186 Ga0075369_10037554 Ga0075369_100375542 324
282 3300006948 Ga0099826_10000023 Ga0099826_1000002391 324
283 3300025263 Ga0209565_1000147 Ga0209565_100014724 324
284 3300025291 Ga0209675_1000436 Ga0209675_10004364 324
285 3300025294 Ga0209025_1006655 Ga0209025_10066556 324
286 3300025295 Ga0209564_1000253 Ga0209564_100025389 324
287 3300025295 Ga0209564_1000651 Ga0209564_100065124 324
288 3300025299 Ga0209256_1000259 Ga0209256_100025924 324
289 3300026041 Ga0207639_10291989 Ga0207639_102919892 324
290 3300026142 Ga0207698_10175444 Ga0207698_101754442 324
291 3300027666 Ga0209282_1000047 Ga0209282_100004738 324
292 3300042007 Ga0439449_0000524 Ga0439449_0000524_5217_6200 324
293 3300042015 Ga0439462_0007225 Ga0439462_0007225_894_1877 324
294 3300048928 Ga0496125_0009240 Ga0496125_0009240_5586_6575 324
295 3300050516 nmdc:mga0sz30_10778_c1 nmdc:mga0sz30_10778_c1_2344_3330 324
296 iso_pu_bacteria 2511231002 2511242985 324
297 iso_pu_bacteria 8003400568 8003404981 324
298 3300003374 JGI25161J50226_1003944 JGI25161J50226_10039444 325
299 3300003771 Ga0055526_1007498 Ga0055526_10074986 325
300 3300003781 Ga0055536_1001227 Ga0055536_100122711 325
301 3300003781 Ga0055536_1001917 Ga0055536_10019179 325
302 3300003791 Ga0055530_10000326 Ga0055530_1000032612 325
303 3300003791 Ga0055530_10000991 Ga0055530_1000099116 325
304 3300003792 Ga0055540_1000405 Ga0055540_100040519 325
305 3300003792 Ga0055540_1001486 Ga0055540_10014865 325
306 3300003794 Ga0055531_10000515 Ga0055531_1000051519 325
307 3300003794 Ga0055531_10000594 Ga0055531_1000059413 325
308 3300004625 Ga0055543_1001172 Ga0055543_10011725 325
309 3300005262 Ga0065165_1003472 Ga0065165_10034725 325
310 3300005334 Ga0068869_100112565 Ga0068869_1001125652 325
311 3300005564 Ga0070664_100040086 Ga0070664_1000400863 325
312 3300005616 Ga0068852_100039864 Ga0068852_1000398644 325
313 3300006237 Ga0097621_100064434 Ga0097621_1000644342 325
314 3300006353 Ga0075370_10024438 Ga0075370_100244383 325
315 3300009036 Ga0105244_10000730 Ga0105244_1000073012 325
316 3300009098 Ga0105245_10146002 Ga0105245_101460022 325
317 3300009148 Ga0105243_10005183 Ga0105243_100051832 325
318 3300009551 Ga0105238_10086972 Ga0105238_100869723 325
319 3300010375 Ga0105239_10052918 Ga0105239_100529181 325
320 3300011119 Ga0105246_10077089 Ga0105246_100770893 325
321 3300013104 Ga0157370_10000335 Ga0157370_1000033555 325
322 3300014497 Ga0182008_10004838 Ga0182008_100048383 325
323 3300015261 Ga0182006_1000910 Ga0182006_100091022 325
324 3300015262 Ga0182007_10003127 Ga0182007_100031277 325
325 3300025245 Ga0207425_1001269 Ga0207425_10012694 325
326 3300025258 Ga0209129_1006258 Ga0209129_10062583 325
327 3300025263 Ga0209565_1000629 Ga0209565_10006298 325
328 3300025273 Ga0209673_1000787 Ga0209673_100078722 325
329 3300025284 Ga0209130_1001029 Ga0209130_100102912 325
330 3300025291 Ga0209675_1002098 Ga0209675_10020986 325
331 3300025292 Ga0209676_1000004 Ga0209676_1000004122 325
332 3300025292 Ga0209676_1000703 Ga0209676_100070331 325
333 3300025292 Ga0209676_1000827 Ga0209676_100082717 325
334 3300025294 Ga0209025_1000791 Ga0209025_100079123 325
335 3300025295 Ga0209564_1000267 Ga0209564_100026712 325
336 3300025297 Ga0209758_1001558 Ga0209758_10015585 325
337 3300025298 Ga0209050_1000002 Ga0209050_1000002632 325
338 3300025298 Ga0209050_1000250 Ga0209050_100025054 325
339 3300025299 Ga0209256_1000166 Ga0209256_100016618 325
340 3300025302 Ga0207426_1000389 Ga0207426_100038946 325
341 3300025303 Ga0209051_1000002 Ga0209051_1000002400 325
342 3300025303 Ga0209051_1000160 Ga0209051_100016062 325
343 3300025304 Ga0209257_1000002 Ga0209257_1000002541 325
344 3300025304 Ga0209257_1000116 Ga0209257_100011661 325
345 3300025728 Ga0207655_1001409 Ga0207655_10014096 325
346 3300025924 Ga0207694_10035918 Ga0207694_100359184 325
347 3300025933 Ga0207706_10011593 Ga0207706_100115939 325
348 3300025935 Ga0207709_10002008 Ga0207709_100020082 325
349 3300025945 Ga0207679_10240845 Ga0207679_102408451 325
350 3300031548 Ga0307408_100017899 Ga0307408_1000178993 325
351 3300031731 Ga0307405_10032264 Ga0307405_100322643 325
352 3300031911 Ga0307412_10052414 Ga0307412_100524142 325
353 3300041404 Ga0439436_0008527 Ga0439436_0008527_1395_2375 325
354 3300041404 Ga0439436_0028228 Ga0439436_0028228_64_1044 325
355 3300041406 Ga0439439_0001277 Ga0439439_0001277_2513_3493 325
356 3300041406 Ga0439439_0012339 Ga0439439_0012339_609_1589 325
357 3300041413 Ga0439465_0001337 Ga0439465_0001337_5888_6868 325
358 3300041997 Ga0439431_0040903 Ga0439431_0040903_32_1012 325
359 3300041999 Ga0439433_0000393 Ga0439433_0000393_6286_7266 325
360 3300042006 Ga0439432_004303 Ga0439432_004303_2382_3362 325
361 3300042007 Ga0439449_0000440 Ga0439449_0000440_5727_6707 325
362 3300042007 Ga0439449_0001348 Ga0439449_0001348_3665_4645 325
363 3300042010 Ga0439452_002764 Ga0439452_002764_3019_3999 325
364 3300042010 Ga0439452_020872 Ga0439452_020872_690_1670 325
365 3300042014 Ga0439457_018025 Ga0439457_018025_564_1544 325
366 3300042015 Ga0439462_0003030 Ga0439462_0003030_1058_2038 325
367 3300042125 Ga0450923_015904 Ga0450923_015904_28_1008 325
368 3300042128 Ga0450897_001389 Ga0450897_001389_209_1189 325
369 3300042133 Ga0450896_006406 Ga0450896_006406_572_1552 325
370 3300042145 Ga0450906_012668 Ga0450906_012668_212_1192 325
371 3300042184 Ga0450908_001161 Ga0450908_001161_1734_2714 325
372 3300042185 Ga0450909_002449 Ga0450909_002449_774_1754 325
373 3300046453 Ga0495627_010818 Ga0495627_010818_2289_3269 325
374 3300046513 Ga0495616_0005308 Ga0495616_0005308_774_1754 325
375 3300046515 Ga0495620_0004438 Ga0495620_0004438_1444_2424 325
376 3300046518 Ga0495631_0000426 Ga0495631_0000426_1622_2602 325
377 3300046520 Ga0495637_0024045 Ga0495637_0024045_294_1274 325
378 3300046616 Ga0495668_0079397 Ga0495668_0079397_380_1360 325
379 3300046674 Ga0495588_0018296 Ga0495588_0018296_1796_2776 325
380 3300046683 Ga0495658_0130125 Ga0495658_0130125_331_1311 325
381 3300046691 Ga0495670_0025593 Ga0495670_0025593_1351_2331 325
382 3300046692 Ga0495671_0013694 Ga0495671_0013694_1369_2349 325
383 3300047443 Ga0495687_040098 Ga0495687_040098_710_1699 325
384 3300047673 Ga0495593_0003390 Ga0495593_0003390_2596_3576 325
385 3300048088 Ga0495602_0134475 Ga0495602_0134475_190_1170 325
386 3300048905 Ga0496102_0222979 Ga0496102_0222979_693_1673 325
387 3300048907 Ga0496104_0304826 Ga0496104_0304826_461_1474 325
388 3300048919 Ga0496116_0044202 Ga0496116_0044202_460_1440 325
389 3300048924 Ga0496121_0092971 Ga0496121_0092971_109_1089 325
390 3300048925 Ga0496122_0109589 Ga0496122_0109589_228_1208 325
391 3300048927 Ga0496124_0084568 Ga0496124_0084568_515_1495 325
392 3300048928 Ga0496125_0032747 Ga0496125_0032747_1099_2079 325
393 3300049679 Ga0501249_012870 Ga0501249_012870_276_1259 325
394 3300050496 nmdc:mga07m45_70902_c1 nmdc:mga07m45_70902_c1_819_1799 325
395 3300053079 Ga0500610_0042921 Ga0500610_0042921_331_1311 325
396 3300053079 Ga0500610_0048965 Ga0500610_0048965_77_1057 325
397 3300053087 Ga0500643_019981 Ga0500643_019981_1141_2121 325
398 3300053093 Ga0500651_0022849 Ga0500651_0022849_2084_3064 325
399 3300053108 Ga0500562_025654 Ga0500562_025654_192_1172 325
400 3300053110 Ga0500571_000041 Ga0500571_000041_3443_4423 325
401 3300053116 Ga0500592_008293 Ga0500592_008293_238_1218 325
402 3300053117 Ga0500593_003219 Ga0500593_003219_1794_2774 325
403 3300053118 Ga0500594_0007488 Ga0500594_0007488_1327_2307 325
404 3300053120 Ga0500597_013321 Ga0500597_013321_439_1419 325
405 3300053121 Ga0500607_001827 Ga0500607_001827_1578_2558 325
406 3300053125 Ga0500618_015165 Ga0500618_015165_325_1305 325
407 3300053133 Ga0500655_000865 Ga0500655_000865_593_1573 325
408 3300053134 Ga0500658_0000058 Ga0500658_0000058_52518_53498 325
409 3300053134 Ga0500658_0000614 Ga0500658_0000614_11964_12944 325
410 3300053136 Ga0500559_0027061 Ga0500559_0027061_656_1636 325
411 3300053138 Ga0500564_029172 Ga0500564_029172_621_1601 325
412 3300053139 Ga0500568_0001884 Ga0500568_0001884_1795_2775 325
413 3300053141 Ga0500574_019333 Ga0500574_019333_278_1258 325
414 3300053148 Ga0500590_008005 Ga0500590_008005_242_1219 325
415 3300053161 Ga0500634_0008806 Ga0500634_0008806_1214_2194 325
416 3300053162 Ga0500638_074683 Ga0500638_074683_16_996 325
417 3300003187 JGI25151J46595_10014679 JGI25151J46595_100146793 326
418 3300005468 Ga0070707_100482899 Ga0070707_1004828991 326
419 3300006038 Ga0075365_10094734 Ga0075365_100947342 326
420 3300006058 Ga0075432_10081259 Ga0075432_100812592 326
421 3300006946 Ga0079104_1005680 Ga0079104_10056802 326
422 3300025245 Ga0207425_1006511 Ga0207425_10065114 326
423 3300025258 Ga0209129_1016973 Ga0209129_10169731 326
424 3300025294 Ga0209025_1005706 Ga0209025_10057067 326
425 3300027111 Ga0209281_1013317 Ga0209281_10133172 326
426 3300028794 Ga0307515_10175302 Ga0307515_101753022 326
427 3300031548 Ga0307408_100051824 Ga0307408_1000518242 326
428 3300050490 nmdc:mga03n38_6498_c1 nmdc:mga03n38_6498_c1_652_1641 326
429 3300053730 Ga0500645_000596 Ga0500645_000596_3634_4647 326
430 3300001989 JGI24739J22299_10014239 JGI24739J22299_100142392 327
431 3300003578 Ga0006562J51391_1140944 Ga0006562J51391_11409442 327
432 3300003578 Ga0006562J51391_1140946 Ga0006562J51391_11409462 327
433 3300003773 Ga0055537_1000206 Ga0055537_100020618 327
434 3300003784 Ga0055534_1000197 Ga0055534_100019718 327
435 3300003790 Ga0055528_1000352 Ga0055528_100035224 327
436 3300005288 Ga0065714_10065432 Ga0065714_100654323 327
437 3300006048 Ga0075363_100008465 Ga0075363_1000084653 327
438 3300006177 Ga0075362_10015823 Ga0075362_100158232 327
439 3300006948 Ga0099826_10010950 Ga0099826_100109503 327
440 3300009148 Ga0105243_10287074 Ga0105243_102870742 327
441 3300011119 Ga0105246_10125407 Ga0105246_101254072 327
442 3300013100 Ga0157373_10012365 Ga0157373_100123653 327
443 3300015262 Ga0182007_10020136 Ga0182007_100201362 327
444 3300025263 Ga0209565_1000182 Ga0209565_100018247 327
445 3300025273 Ga0209673_1000106 Ga0209673_100010627 327
446 3300025273 Ga0209673_1001604 Ga0209673_10016042 327
447 3300025291 Ga0209675_1000058 Ga0209675_100005827 327
448 3300025292 Ga0209676_1036275 Ga0209676_10362752 327
449 3300025299 Ga0209256_1031441 Ga0209256_10314412 327
450 3300025303 Ga0209051_1000128 Ga0209051_100012899 327
451 3300027666 Ga0209282_1027574 Ga0209282_10275743 327
452 3300027907 Ga0207428_10029142 Ga0207428_100291422 327
453 3300030735 Ga0316178_1176130 Ga0316178_11761301 327
454 3300030742 Ga0316183_1122424 Ga0316183_11224245 327
455 3300030744 Ga0316181_1001445 Ga0316181_10014452 327
456 3300030745 Ga0316182_1339543 Ga0316182_13395432 327
457 3300031548 Ga0307408_100047480 Ga0307408_1000474803 327
458 3300031649 Ga0307514_10003247 Ga0307514_1000324714 327
459 3300031731 Ga0307405_10175097 Ga0307405_101750972 327
460 3300031852 Ga0307410_10211704 Ga0307410_102117042 327
461 3300031901 Ga0307406_10001083 Ga0307406_100010833 327
462 3300032004 Ga0307414_10080409 Ga0307414_100804092 327
463 3300042531 Ga0450918_002781 Ga0450918_002781_378_1373 327
464 3300049759 Ga0501262_000456 Ga0501262_000456_599_1588 327
465 3300050489 nmdc:mga03683_32210_c1 nmdc:mga03683_32210_c1_214_1209 327
466 3300050490 nmdc:mga03n38_2646_c1 nmdc:mga03n38_2646_c1_1696_2691 327

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

79

353

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.95 31 325
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9407 31 325
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9396 32 325
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9242 32 325
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9234 31 325
ID Description Score Start End Superfamily
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.937 32 325 3.40.190.150
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9253 128 249 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9239 128 244 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9131 26 325 3.40.190.150
2f5xC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9107 31 323 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A7H0GIP4-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9743 53 325
AF-A0A536XT46-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9729 57 325
AF-A0A3N5WIT6-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9708 32 325
AF-A0A4Q5X7P7-F1-model_v4 deleted 0.9702 97 325
AF-A0A3A3FMR4-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9675 46 325

Feature Viewer

pLDDT pTM Quality
90.73 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map