F449663

General Info

Members Datasets Scaffolds Average Seq Length
466 282 352 298

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10012380|Ga0157372_1001238012
Length 332
Sequence MIANCLAACIANPPTGFYSLDIAKNKEIAVRIGIDLGGTKTEVIALGDSGEQLFRHRLPTPRDDYQQTIETIATLVEMAEKETGQRGTVGMGIPGSLSPYTGVVKNANSTWLNGQPFDKDLSKRLGREVRLANDANCLAVSEAIDGAAAGAQTVFAVIIGTGCGAGIAFNGHAHSGGNGTAGEWGHNPLPWMDEDELRYREEVPCYCGKQGCIETFISGTGFARDFHRLSGQPLKGNEIIRLVDEQDAVAELALSRYELRLAKSLAHVVNILDPDVIVLGGGMSNVDRLYKTVPQLIKNWVFGGECETPIRKAVHGDSSGVRGAAWLWPLER

Samples

Sample ID Description Type Environment
1 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
2 2506520008 Serratia plymuthica AS12 Isolate Unclassified
3 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
4 2547132181 Kosakonia sacchari SP1 Isolate Stem
5 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
6 2561511199 Enterobacter sp. R4-368 Isolate Nodule
7 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
8 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
9 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
10 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
11 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
12 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
13 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
14 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
15 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
16 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
17 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
18 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
19 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
20 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
21 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
22 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
23 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
24 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
25 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
26 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
27 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
28 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
29 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
30 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
31 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
32 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
33 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
34 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
35 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
36 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
37 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
38 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
39 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
40 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
41 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
42 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
43 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
44 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
45 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
46 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
47 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
48 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
49 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
50 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
51 2636415599 Klebsiella variicola DX120E Isolate Unclassified
52 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
53 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
54 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
55 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
56 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
57 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
58 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
59 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
60 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
61 2751185917 Enterobacter sp. HK169 Isolate Unclassified
62 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
63 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
64 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
65 2775507074 Klebsiella sp. D5A Isolate Unclassified
66 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
67 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
68 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
69 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
70 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
71 2821118458 Enterobacter asburiae 609 Isolate Unclassified
72 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
73 2847085930 Erwinia persicina B64 Isolate Bulb
74 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
75 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
76 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
77 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
78 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
79 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
80 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
81 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
82 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
83 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
84 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
85 2932406140 Serratia sp. 2723 Isolate Rhizosphere
86 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
87 2937539931 Pantoea sp. LS15 Isolate Unclassified
88 2937967321 Serratia sp. YC16 Isolate Unclassified
89 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
90 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
91 2939577877 Serratia sp. 509 Isolate Rhizosphere
92 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
93 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
94 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
95 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
96 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
97 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
98 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
99 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
100 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
101 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
102 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
103 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
104 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
105 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
106 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
107 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
108 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
109 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
110 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
111 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
112 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
113 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
114 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
115 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
116 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
117 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
118 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
119 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
120 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
121 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
122 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
123 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
124 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
125 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
126 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
127 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
128 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
129 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
130 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
131 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
132 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
133 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
134 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
135 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
136 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
137 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
138 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
140 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
142 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
143 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
144 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
145 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
146 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
147 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
148 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
149 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
150 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
151 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
152 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
153 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
154 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
155 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
156 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
157 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
158 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
159 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
160 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
161 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
162 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
163 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
164 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
165 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
189 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
194 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
195 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
201 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
204 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
205 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
206 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
212 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
215 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
216 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
217 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
218 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
219 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
220 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
221 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
222 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
225 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
226 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
227 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
228 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
229 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
230 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
245 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
246 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
247 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
250 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
261 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
262 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
263 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 640753048 Serratia proteamaculans 568 Isolate Endosphere
272 8004592986 Serratia sp. S119 Isolate Unclassified
273 8018221730 Enterobacter sp. CM29 Isolate Unclassified
274 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
275 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
276 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
277 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
278 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
279 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
280 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
281 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
282 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.54
Metatranscriptomes 0
Isolates 24.46

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0.21
Endosphere 1.72
Nodule 4.72
Rhizoplane 12.23
Rhizosphere 58.58
Stem 0.21
Stem Tuber 0.21
Unclassified 21.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1001294 3300002737 Bacteria 14138
2 JGI25152J39213_1000504 3300002773 Bacteria 21760
3 rootH2_10067781 3300003320 Bacteria 29392
4 Ga0058692_1024138 3300003856 Bacteria 1224
5 Ga0058692_1027150 3300003856 Bacteria 1118
6 Ga0065704_10002155 3300005289 Bacteria 7390
7 Ga0065704_10072533 3300005289 Bacteria 8351
8 Ga0065704_10077141 3300005289 Bacteria 4839
9 Ga0065712_10067763 3300005290 Bacteria 47611
10 Ga0070658_10002863 3300005327 Bacteria 14329
11 Ga0070658_10007304 3300005327 Bacteria 8923
12 Ga0070670_100045945 3300005331 Bacteria 3755
13 Ga0068869_100106867 3300005334 Bacteria 2124
14 Ga0070660_100218506 3300005339 Bacteria 1549
15 Ga0070661_100261212 3300005344 Bacteria 1339
16 Ga0070675_100004952 3300005354 Bacteria 10161
17 Ga0070675_100033916 3300005354 Bacteria 4140
18 Ga0070713_100000385 3300005436 Bacteria 28235
19 Ga0070707_100023744 3300005468 Bacteria 5800
20 Ga0070698_100130477 3300005471 Bacteria 2469
21 Ga0070679_100057650 3300005530 Bacteria 3871
22 Ga0070665_100001966 3300005548 Bacteria 23115
23 Ga0068857_100001205 3300005577 Bacteria 20159
24 Ga0068857_100261302 3300005577 Bacteria 1589
25 Ga0068859_100328816 3300005617 Unclassified 1623
26 Ga0068863_100070135 3300005841 Bacteria 3314
27 Ga0068858_100032486 3300005842 Bacteria 4846
28 Ga0068860_100063111 3300005843 Bacteria 3520
29 Ga0068862_100162134 3300005844 Unclassified 1997
30 Ga0068862_100256772 3300005844 Bacteria 1594
31 Ga0075364_10107915 3300006051 Bacteria 1856
32 Ga0075431_100000337 3300006847 Bacteria 36950
33 Ga0075433_10014495 3300006852 Bacteria 6442
34 Ga0075433_10017621 3300006852 Bacteria 5923
35 Ga0075434_100019704 3300006871 Bacteria 6530
36 Ga0075429_100017595 3300006880 Bacteria 6180
37 Ga0075429_100095627 3300006880 Bacteria 2591
38 Ga0097620_100328836 3300006931 Unclassified 1623
39 Ga0079104_1000166 3300006946 Bacteria 94027
40 Ga0079104_1000174 3300006946 Bacteria 91722
41 Ga0079104_1000192 3300006946 Bacteria 85695
42 Ga0079104_1000578 3300006946 Bacteria 36991
43 Ga0079104_1001233 3300006946 Bacteria 17982
44 Ga0079104_1004622 3300006946 Bacteria 5799
45 Ga0079104_1004766 3300006946 Bacteria 5661
46 Ga0079104_1029048 3300006946 Bacteria 1397
47 Ga0075435_100053804 3300007076 Bacteria 3247
48 Ga0075435_100083623 3300007076 Unclassified 2624
49 Ga0105251_10000073 3300009011 Bacteria 97270
50 Ga0105251_10000254 3300009011 Bacteria 53726
51 Ga0105251_10000582 3300009011 Bacteria 33639
52 Ga0105251_10000945 3300009011 Bacteria 25937
53 Ga0105251_10001093 3300009011 Bacteria 23581
54 Ga0105251_10002540 3300009011 Bacteria 14199
55 Ga0105251_10002927 3300009011 Bacteria 12806
56 Ga0105244_10000041 3300009036 Bacteria 155525
57 Ga0105244_10000105 3300009036 Bacteria 86528
58 Ga0105244_10000315 3300009036 Bacteria 46626
59 Ga0105244_10000393 3300009036 Bacteria 40595
60 Ga0105244_10001332 3300009036 Bacteria 20137
61 Ga0105244_10008026 3300009036 Bacteria 6640
62 Ga0105244_10008717 3300009036 Bacteria 6311
63 Ga0105244_10014896 3300009036 Bacteria 4477
64 Ga0105250_10000052 3300009092 Bacteria 116382
65 Ga0105250_10000150 3300009092 Bacteria 61428
66 Ga0105250_10001806 3300009092 Bacteria 11210
67 Ga0105250_10001924 3300009092 Bacteria 10773
68 Ga0105240_10233930 3300009093 Bacteria 2134
69 Ga0111539_10007018 3300009094 Bacteria 14451
70 Ga0111539_10007070 3300009094 Bacteria 14390
71 Ga0105247_10000191 3300009101 Bacteria 60259
72 Ga0114129_10198228 3300009147 Bacteria 2721
73 Ga0105243_10008113 3300009148 Bacteria 8059
74 Ga0105241_10000004 3300009174 Bacteria 803007
75 Ga0105248_10116986 3300009177 Bacteria 3006
76 Ga0105237_10020561 3300009545 Bacteria 6802
77 Ga0105237_10130987 3300009545 Bacteria 2502
78 Ga0105238_10243555 3300009551 Bacteria 1776
79 Ga0105249_10063309 3300009553 Bacteria 3398
80 Ga0105239_10095578 3300010375 Bacteria 3283
81 Ga0157373_10014395 3300013100 Bacteria 5798
82 Ga0157371_10001405 3300013102 Bacteria 25086
83 Ga0157371_10181645 3300013102 Bacteria 1504
84 Ga0157370_10002956 3300013104 Bacteria 20228
85 Ga0157370_10644254 3300013104 Bacteria 969
86 Ga0157369_10025595 3300013105 Bacteria 6548
87 Ga0157372_10012380 3300013307 Bacteria 9091
88 Ga0157372_10110465 3300013307 Bacteria 3149
89 Ga0157372_10413971 3300013307 Bacteria 1571
90 Ga0157375_10043734 3300013308 Bacteria 4346
91 Ga0182008_10003637 3300014497 Bacteria 9204
92 Ga0157377_10014009 3300014745 Bacteria 4072
93 Ga0157379_10002070 3300014968 Bacteria 16658
94 Ga0182006_1000020 3300015261 Bacteria 285318
95 Ga0183366_1001 3300015679 Bacteria 2743932
96 Ga0183370_1001 3300015680 Bacteria 2743932
97 Ga0183369_1001 3300015685 Bacteria 2743932
98 Ga0183368_1001 3300015687 Bacteria 2743932
99 Ga0163161_10000004 3300017792 Bacteria 333149
100 Ga0163161_10105637 3300017792 Bacteria 2101
101 Ga0213876_10000025 3300021384 Bacteria 236747
102 Ga0209129_1000015 3300025258 Bacteria 487967
103 Ga0207696_1000003 3300025711 Bacteria 860639
104 Ga0207696_1000007 3300025711 Bacteria 578417
105 Ga0207696_1000033 3300025711 Bacteria 360689
106 Ga0207696_1000420 3300025711 Bacteria 39046
107 Ga0207696_1001427 3300025711 Bacteria 13014
108 Ga0207696_1004377 3300025711 Bacteria 6103
109 Ga0207655_1000001 3300025728 Bacteria 1866413
110 Ga0207655_1000011 3300025728 Bacteria 643321
111 Ga0207655_1000087 3300025728 Bacteria 205876
112 Ga0207655_1000121 3300025728 Bacteria 155535
113 Ga0207655_1000226 3300025728 Bacteria 94688
114 Ga0207655_1000404 3300025728 Bacteria 59563
115 Ga0207655_1003806 3300025728 Bacteria 11012
116 Ga0207655_1005258 3300025728 Bacteria 8877
117 Ga0207655_1008424 3300025728 Bacteria 6544
118 Ga0207655_1012604 3300025728 Bacteria 4927
119 Ga0207713_1000005 3300025735 Bacteria 649958
120 Ga0207713_1000038 3300025735 Bacteria 247609
121 Ga0207713_1000065 3300025735 Bacteria 196128
122 Ga0207713_1000108 3300025735 Bacteria 137268
123 Ga0207713_1000155 3300025735 Bacteria 102677
124 Ga0207713_1001646 3300025735 Bacteria 17385
125 Ga0207713_1003616 3300025735 Bacteria 10414
126 Ga0207713_1006190 3300025735 Bacteria 7338
127 Ga0207710_10000016 3300025900 Bacteria 388568
128 Ga0207688_10161114 3300025901 Unclassified 1330
129 Ga0207680_10012051 3300025903 Bacteria 4393
130 Ga0207654_10000006 3300025911 Bacteria 815027
131 Ga0207654_10237666 3300025911 Bacteria 1216
132 Ga0207671_10018012 3300025914 Bacteria 5431
133 Ga0207657_10028108 3300025919 Bacteria 5138
134 Ga0207652_10038954 3300025921 Bacteria 4032
135 Ga0207646_10022560 3300025922 Bacteria 5797
136 Ga0207694_10172761 3300025924 Bacteria 1750
137 Ga0207659_10020135 3300025926 Bacteria 4404
138 Ga0207659_10024594 3300025926 Bacteria 4038
139 Ga0207700_10000031 3300025928 Bacteria 130086
140 Ga0207709_10004933 3300025935 Bacteria 7637
141 Ga0207691_10382275 3300025940 Bacteria 1202
142 Ga0207711_10016847 3300025941 Bacteria 6068
143 Ga0207667_10066530 3300025949 Bacteria 3756
144 Ga0207667_10178835 3300025949 Bacteria 2179
145 Ga0207712_10016559 3300025961 Bacteria 4777
146 Ga0207658_10055294 3300025986 Bacteria 2941
147 Ga0207658_10079321 3300025986 Bacteria 2511
148 Ga0207703_10015669 3300026035 Bacteria 5912
149 Ga0207641_10023728 3300026088 Bacteria 5054
150 Ga0207674_10000067 3300026116 Bacteria 107803
151 Ga0207674_10084902 3300026116 Bacteria 3163
152 Ga0209281_1000001 3300027111 Bacteria 1933496
153 Ga0209281_1000008 3300027111 Bacteria 867470
154 Ga0209281_1000021 3300027111 Bacteria 541033
155 Ga0209281_1000075 3300027111 Bacteria 267114
156 Ga0209281_1000093 3300027111 Bacteria 240724
157 Ga0209281_1000232 3300027111 Bacteria 117627
158 Ga0209281_1000254 3300027111 Bacteria 105570
159 Ga0209281_1000480 3300027111 Bacteria 55767
160 Ga0209281_1000492 3300027111 Bacteria 53875
161 Ga0209281_1000907 3300027111 Bacteria 24756
162 Ga0209281_1001298 3300027111 Bacteria 15965
163 Ga0209281_1010341 3300027111 Bacteria 2141
164 Ga0209371_1000001 3300027312 Bacteria 2771503
165 Ga0209371_1000026 3300027312 Bacteria 449205
166 Ga0209371_1000104 3300027312 Bacteria 148080
167 Ga0209371_1001037 3300027312 Bacteria 21018
168 Ga0209371_1001081 3300027312 Bacteria 20361
169 Ga0209371_1001301 3300027312 Bacteria 17502
170 Ga0209371_1001890 3300027312 Bacteria 12844
171 Ga0209371_1002344 3300027312 Bacteria 10768
172 Ga0209371_1006582 3300027312 Bacteria 4266
173 Ga0207428_10071014 3300027907 Unclassified 2735
174 Ga0207428_10281272 3300027907 Bacteria 1235
175 Ga0268266_10000165 3300028379 Bacteria 122830
176 Ga0268266_10000531 3300028379 Bacteria 53279
177 Ga0268264_10063432 3300028381 Bacteria 3106
178 Ga0268256_1000001 3300030500 Bacteria 2771065
179 Ga0268256_1000003 3300030500 Bacteria 1289401
180 Ga0268256_1000017 3300030500 Bacteria 600718
181 Ga0268256_1000746 3300030500 Bacteria 23822
182 Ga0268256_1000822 3300030500 Bacteria 22192
183 Ga0268256_1001360 3300030500 Bacteria 14876
184 Ga0268256_1002923 3300030500 Bacteria 8160
185 Ga0268256_1006585 3300030500 Bacteria 4288
186 Ga0268256_1033004 3300030500 Bacteria 1227
187 Ga0265316_10137983 3300031344 Bacteria 1834
188 Ga0316579_10067366 3300031691 Bacteria 1692
189 Ga0307410_10147092 3300031852 Bacteria 1750
190 Ga0316574_0133240 3300035398 Bacteria 1599
191 Ga0373937_0347475 3300036401 Bacteria 1405
192 Ga0436365_1279401 3300039437 Bacteria 294819
193 Ga0439438_000020 3300041405 Bacteria 111381
194 Ga0439438_000284 3300041405 Bacteria 22767
195 Ga0439447_000561 3300041407 Bacteria 13808
196 Ga0451853_0338586 3300041512 Bacteria 3993
197 Ga0439432_001067 3300042006 Bacteria 10427
198 Ga0439432_006169 3300042006 Bacteria 4293
199 Ga0439452_000003 3300042010 Bacteria 942815
200 Ga0439452_000038 3300042010 Bacteria 149746
201 Ga0439452_000040 3300042010 Bacteria 143490
202 Ga0439452_000362 3300042010 Bacteria 27827
203 Ga0439452_001669 3300042010 Bacteria 8744
204 Ga0450902_001901 3300042137 Bacteria 2902
205 Ga0439464_0008918 3300042439 Bacteria 2631
206 Ga0451577_0000137 3300042876 Bacteria 163955
207 Ga0466981_0000011 3300044669 Bacteria 132904
208 Ga0453684_0000014 3300044712 Bacteria 993311
209 Ga0453684_0054530 3300044712 Bacteria 5207
210 Ga0451576_0319090 3300045051 Bacteria 1626
211 Ga0495627_000136 3300046453 Bacteria 87662
212 Ga0495591_000265 3300046458 Bacteria 49660
213 Ga0495591_001083 3300046458 Bacteria 18143
214 Ga0495591_008109 3300046458 Bacteria 4343
215 Ga0495638_0007922 3300046460 Bacteria 7578
216 Ga0495650_0000033 3300046471 Bacteria 412188
217 Ga0495650_0000205 3300046471 Bacteria 128197
218 Ga0495607_0022953 3300046501 Bacteria 3911
219 Ga0495606_0000296 3300046507 Bacteria 85795
220 Ga0495616_0212932 3300046513 Bacteria 844
221 Ga0495620_0003155 3300046515 Bacteria 9456
222 Ga0495644_0029716 3300046523 Bacteria 2064
223 Ga0495648_0023845 3300046524 Bacteria 4179
224 Ga0495654_0000020 3300046530 Bacteria 284814
225 Ga0495654_0000386 3300046530 Bacteria 38102
226 Ga0495654_0024272 3300046530 Bacteria 3135
227 Ga0495654_0025861 3300046530 Bacteria 3022
228 Ga0495597_0000053 3300046542 Bacteria 95455
229 Ga0495625_0008056 3300046660 Bacteria 9037
230 Ga0495588_0005827 3300046674 Bacteria 5512
231 Ga0495649_0001250 3300046694 Bacteria 19570
232 Ga0495649_0006867 3300046694 Bacteria 7046
233 Ga0495649_0013724 3300046694 Bacteria 4666
234 Ga0495589_0000006 3300046794 Bacteria 303635
235 Ga0495589_0003680 3300046794 Bacteria 8281
236 Ga0495660_0000011 3300046810 Bacteria 361397
237 Ga0495672_0000004 3300047320 Bacteria 631810
238 Ga0495672_0000027 3300047320 Bacteria 325651
239 Ga0495679_000080 3300047446 Bacteria 90450
240 Ga0495679_001546 3300047446 Bacteria 12991
241 Ga0495679_055275 3300047446 Bacteria 1179
242 Ga0495673_0000023 3300047469 Bacteria 539904
243 Ga0495673_0000513 3300047469 Bacteria 40915
244 Ga0495686_0006144 3300047472 Bacteria 9290
245 Ga0496100_0017856 3300048903 Bacteria 4197
246 Ga0496101_0088432 3300048904 Bacteria 2301
247 Ga0496103_0073716 3300048906 Bacteria 2139
248 Ga0496104_0000459 3300048907 Bacteria 35096
249 Ga0496104_0393773 3300048907 Bacteria 1297
250 Ga0496105_0010642 3300048908 Bacteria 7237
251 Ga0496105_0039231 3300048908 Bacteria 3903
252 Ga0496113_0020048 3300048916 Bacteria 4693
253 Ga0496116_0000031 3300048919 Bacteria 420043
254 Ga0496116_0000170 3300048919 Bacteria 131308
255 Ga0496116_0004763 3300048919 Bacteria 12802
256 Ga0496116_0006792 3300048919 Bacteria 10294
257 Ga0496116_0124745 3300048919 Bacteria 1481
258 Ga0496117_0000517 3300048920 Bacteria 63669
259 Ga0496117_0001239 3300048920 Bacteria 38198
260 Ga0496117_0001926 3300048920 Bacteria 27685
261 Ga0496117_0003323 3300048920 Bacteria 18785
262 Ga0496117_0018075 3300048920 Bacteria 5860
263 Ga0496117_0050640 3300048920 Bacteria 2943
264 Ga0496118_0000428 3300048921 Bacteria 69913
265 Ga0496118_0002879 3300048921 Bacteria 22438
266 Ga0496118_0015886 3300048921 Bacteria 6938
267 Ga0496118_0024858 3300048921 Bacteria 5156
268 Ga0496118_0145974 3300048921 Bacteria 1489
269 Ga0496119_0000062 3300048922 Bacteria 171150
270 Ga0496119_0000078 3300048922 Bacteria 140556
271 Ga0496119_0000280 3300048922 Bacteria 71494
272 Ga0496119_0001515 3300048922 Bacteria 27758
273 Ga0496119_0004726 3300048922 Bacteria 13384
274 Ga0496119_0015003 3300048922 Bacteria 6008
275 Ga0496119_0026063 3300048922 Bacteria 4063
276 Ga0496119_0131213 3300048922 Bacteria 1365
277 Ga0496119_0166196 3300048922 Bacteria 1168
278 Ga0496119_0174204 3300048922 Bacteria 1133
279 Ga0496120_0000009 3300048923 Bacteria 386727
280 Ga0496120_0000228 3300048923 Bacteria 96403
281 Ga0496120_0000255 3300048923 Bacteria 89200
282 Ga0496120_0000265 3300048923 Bacteria 87441
283 Ga0496120_0000460 3300048923 Bacteria 64148
284 Ga0496120_0003079 3300048923 Bacteria 15719
285 Ga0496120_0011577 3300048923 Bacteria 6058
286 Ga0496120_0021820 3300048923 Bacteria 4038
287 Ga0496120_0022517 3300048923 Bacteria 3961
288 Ga0496120_0038629 3300048923 Bacteria 2823
289 Ga0496121_0002308 3300048924 Bacteria 29566
290 Ga0496121_0020898 3300048924 Bacteria 6446
291 Ga0496121_0111423 3300048924 Bacteria 2086
292 Ga0496121_0181639 3300048924 Unclassified 1518
293 Ga0496122_0000145 3300048925 Bacteria 165864
294 Ga0496122_0000947 3300048925 Bacteria 52629
295 Ga0496122_0001097 3300048925 Bacteria 46853
296 Ga0496122_0003898 3300048925 Bacteria 19114
297 Ga0496122_0013052 3300048925 Bacteria 8182
298 Ga0496122_0114689 3300048925 Bacteria 1757
299 Ga0496122_0185362 3300048925 Bacteria 1235
300 Ga0496123_0000171 3300048926 Bacteria 130780
301 Ga0496123_0000281 3300048926 Bacteria 100416
302 Ga0496123_0001333 3300048926 Bacteria 34880
303 Ga0496123_0002196 3300048926 Bacteria 24830
304 Ga0496123_0015399 3300048926 Bacteria 6273
305 Ga0496123_0035640 3300048926 Bacteria 3541
306 Ga0496123_0113000 3300048926 Bacteria 1547
307 Ga0496123_0150522 3300048926 Bacteria 1256
308 Ga0496124_0000122 3300048927 Bacteria 161741
309 Ga0496124_0000217 3300048927 Bacteria 112197
310 Ga0496124_0000465 3300048927 Bacteria 70109
311 Ga0496124_0001237 3300048927 Bacteria 39228
312 Ga0496124_0026357 3300048927 Bacteria 5242
313 Ga0496124_0031879 3300048927 Bacteria 4661
314 Ga0496124_0037293 3300048927 Bacteria 4229
315 Ga0496125_0000413 3300048928 Bacteria 79797
316 Ga0496125_0001559 3300048928 Bacteria 32689
317 Ga0496125_0011587 3300048928 Bacteria 8808
318 Ga0496125_0011939 3300048928 Bacteria 8653
319 Ga0496125_0157668 3300048928 Bacteria 1547
320 Ga0496126_0041517 3300048929 Bacteria 4256
321 Ga0496126_0041603 3300048929 Bacteria 4250
322 Ga0496126_0102729 3300048929 Bacteria 2498
323 Ga0496126_0184789 3300048929 Bacteria 1768
324 Ga0496126_0335787 3300048929 Bacteria 1239
325 Ga0496126_0405062 3300048929 Bacteria 1105
326 Ga0495678_000422 3300049459 Bacteria 42659
327 Ga0495682_0000004 3300049460 Bacteria 378337
328 Ga0501036_0096084 3300049572 Bacteria 2505
329 Ga0501038_0017403 3300049574 Bacteria 6497
330 Ga0501040_0036787 3300049576 Bacteria 3324
331 Ga0501042_0004793 3300049578 Bacteria 8641
332 Ga0501074_0027145 3300049590 Bacteria 4151
333 Ga0501075_0008310 3300049591 Bacteria 7237
334 Ga0501076_0024876 3300049592 Bacteria 4631
335 Ga0501081_0016022 3300049743 Bacteria 4950
336 Ga0501045_0125713 3300049824 Bacteria 1905
337 nmdc:mga00v17_37449_c1 3300050491 Bacteria 2897
338 nmdc:mga0k408_220418_c1 3300050493 Bacteria 1132
339 nmdc:mga09592_112824_c1 3300050508 Bacteria 2332
340 nmdc:mga09592_190299_c1 3300050508 Bacteria 1776
341 nmdc:mga0qj67_21647_c1 3300050509 Bacteria 4932
342 nmdc:mga06r32_107243_c1 3300050510 Bacteria 2745
343 nmdc:mga08y16_112955_c1 3300050511 Unclassified 2828
344 nmdc:mga08y16_16217_c1 3300050511 Bacteria 7833
345 nmdc:mga08y16_52175_c1 3300050511 Bacteria 4279
346 nmdc:mga0n895_21927_c1 3300050512 Bacteria 5982
347 nmdc:mga0rr50_101203_c1 3300050513 Unclassified 2265
348 nmdc:mga0rr50_72863_c1 3300050513 Bacteria 2624
349 nmdc:mga0a205_30583_c1 3300050515 Bacteria 5156
350 nmdc:mga0a205_43292_c1 3300050515 Bacteria 4342
351 Ga0500621_000001 3300053126 Bacteria 1049698
352 Ga0501084_0023541 3300054114 Bacteria 5138

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046513 Ga0495616_0212932 Ga0495616_0212932_13_834 260
2 3300042876 Ga0451577_0000137 Ga0451577_0000137_123403_124296 261
3 3300044712 Ga0453684_0000014 Ga0453684_0000014_65584_66477 261
4 3300005354 Ga0070675_100004952 Ga0070675_1000049522 262
5 3300005577 Ga0068857_100261302 Ga0068857_1002613022 262
6 3300025926 Ga0207659_10020135 Ga0207659_100201352 262
7 3300026116 Ga0207674_10084902 Ga0207674_100849022 262
8 3300048927 Ga0496124_0000217 Ga0496124_0000217_88800_89687 262
9 3300025949 Ga0207667_10066530 Ga0207667_100665304 263
10 3300049574 Ga0501038_0017403 Ga0501038_0017403_2230_3123 263
11 iso_pu_bacteria 2974435778 2974437267 263
12 3300005289 Ga0065704_10002155 Ga0065704_100021556 267
13 3300005289 Ga0065704_10072533 Ga0065704_100725331 267
14 3300005577 Ga0068857_100001205 Ga0068857_10000120510 267
15 3300005841 Ga0068863_100070135 Ga0068863_1000701353 267
16 3300005843 Ga0068860_100063111 Ga0068860_1000631114 267
17 3300006946 Ga0079104_1001233 Ga0079104_100123314 267
18 3300006946 Ga0079104_1004622 Ga0079104_10046221 267
19 3300006946 Ga0079104_1004766 Ga0079104_10047663 267
20 3300009011 Ga0105251_10000945 Ga0105251_100009453 267
21 3300009092 Ga0105250_10001924 Ga0105250_1000192411 267
22 3300009094 Ga0111539_10007018 Ga0111539_1000701810 267
23 3300009177 Ga0105248_10116986 Ga0105248_101169863 267
24 3300009553 Ga0105249_10063309 Ga0105249_100633092 267
25 3300015679 Ga0183366_1001 Ga0183366_1001137 267
26 3300015680 Ga0183370_1001 Ga0183370_1001137 267
27 3300015685 Ga0183369_1001 Ga0183369_1001137 267
28 3300015687 Ga0183368_1001 Ga0183368_1001137 267
29 3300017792 Ga0163161_10105637 Ga0163161_101056371 267
30 3300025711 Ga0207696_1001427 Ga0207696_100142714 267
31 3300025728 Ga0207655_1000001 Ga0207655_1000001103 267
32 3300025728 Ga0207655_1000087 Ga0207655_1000087100 267
33 3300025728 Ga0207655_1000404 Ga0207655_100040412 267
34 3300025735 Ga0207713_1000155 Ga0207713_100015517 267
35 3300025735 Ga0207713_1001646 Ga0207713_100164610 267
36 3300025735 Ga0207713_1006190 Ga0207713_10061903 267
37 3300025903 Ga0207680_10012051 Ga0207680_100120514 267
38 3300025914 Ga0207671_10018012 Ga0207671_100180122 267
39 3300025941 Ga0207711_10016847 Ga0207711_100168476 267
40 3300025961 Ga0207712_10016559 Ga0207712_100165594 267
41 3300026088 Ga0207641_10023728 Ga0207641_100237283 267
42 3300026116 Ga0207674_10000067 Ga0207674_100000679 267
43 3300027111 Ga0209281_1000075 Ga0209281_1000075186 267
44 3300027111 Ga0209281_1000232 Ga0209281_100023212 267
45 3300027111 Ga0209281_1000480 Ga0209281_100048014 267
46 3300027111 Ga0209281_1000492 Ga0209281_100049227 267
47 3300027111 Ga0209281_1001298 Ga0209281_10012981 267
48 3300027312 Ga0209371_1001301 Ga0209371_100130111 267
49 3300027312 Ga0209371_1002344 Ga0209371_100234412 267
50 3300027907 Ga0207428_10281272 Ga0207428_102812721 267
51 3300030500 Ga0268256_1001360 Ga0268256_10013602 267
52 3300030500 Ga0268256_1002923 Ga0268256_10029236 267
53 3300030500 Ga0268256_1033004 Ga0268256_10330041 267
54 3300041405 Ga0439438_000284 Ga0439438_000284_9120_10112 267
55 3300042010 Ga0439452_000003 Ga0439452_000003_869906_870814 267
56 3300042137 Ga0450902_001901 Ga0450902_001901_1787_2722 267
57 3300048903 Ga0496100_0017856 Ga0496100_0017856_2724_3716 267
58 3300048920 Ga0496117_0001239 Ga0496117_0001239_28042_29016 267
59 3300048920 Ga0496117_0018075 Ga0496117_0018075_3492_4484 267
60 3300048921 Ga0496118_0015886 Ga0496118_0015886_684_1676 267
61 3300048922 Ga0496119_0166196 Ga0496119_0166196_81_986 267
62 3300048922 Ga0496119_0174204 Ga0496119_0174204_19_924 267
63 3300048923 Ga0496120_0000460 Ga0496120_0000460_1157_2149 267
64 3300048924 Ga0496121_0020898 Ga0496121_0020898_26_1018 267
65 3300048925 Ga0496122_0000145 Ga0496122_0000145_53765_54757 267
66 3300048926 Ga0496123_0000281 Ga0496123_0000281_56697_57689 267
67 3300048926 Ga0496123_0015399 Ga0496123_0015399_3306_4298 267
68 3300048926 Ga0496123_0113000 Ga0496123_0113000_624_1529 267
69 3300048927 Ga0496124_0001237 Ga0496124_0001237_24979_25971 267
70 3300048927 Ga0496124_0026357 Ga0496124_0026357_19_924 267
71 3300048927 Ga0496124_0031879 Ga0496124_0031879_2493_3485 267
72 3300048927 Ga0496124_0037293 Ga0496124_0037293_3306_4211 267
73 3300048928 Ga0496125_0001559 Ga0496125_0001559_21605_22597 267
74 3300048928 Ga0496125_0157668 Ga0496125_0157668_624_1529 267
75 3300048929 Ga0496126_0405062 Ga0496126_0405062_54_959 267
76 3300005289 Ga0065704_10077141 Ga0065704_100771411 268
77 3300009036 Ga0105244_10000041 Ga0105244_1000004198 268
78 3300009036 Ga0105244_10000105 Ga0105244_1000010526 268
79 3300015261 Ga0182006_1000020 Ga0182006_100002085 268
80 3300025711 Ga0207696_1004377 Ga0207696_10043777 268
81 3300025728 Ga0207655_1000121 Ga0207655_100012197 268
82 3300025728 Ga0207655_1000226 Ga0207655_100022626 268
83 3300027111 Ga0209281_1000021 Ga0209281_1000021428 268
84 3300028381 Ga0268264_10063432 Ga0268264_100634322 268
85 3300046458 Ga0495591_000265 Ga0495591_000265_33031_33936 268
86 3300048919 Ga0496116_0006792 Ga0496116_0006792_5806_6798 268
87 3300048924 Ga0496121_0002308 Ga0496121_0002308_6971_7963 268
88 3300048928 Ga0496125_0011939 Ga0496125_0011939_5656_6648 268
89 3300050491 nmdc:mga00v17_37449_c1 nmdc:mga00v17_37449_c1_1394_2386 268
90 3300027312 Ga0209371_1000001 Ga0209371_100000193 269
91 3300030500 Ga0268256_1000001 Ga0268256_10000012548 269
92 3300048907 Ga0496104_0000459 Ga0496104_0000459_12289_13287 269
93 3300048908 Ga0496105_0010642 Ga0496105_0010642_1572_2570 269
94 3300048922 Ga0496119_0026063 Ga0496119_0026063_1309_2307 269
95 3300048923 Ga0496120_0022517 Ga0496120_0022517_712_1710 269
96 3300048923 Ga0496120_0038629 Ga0496120_0038629_1811_2809 269
97 3300048925 Ga0496122_0003898 Ga0496122_0003898_7623_8621 269
98 3300048926 Ga0496123_0035640 Ga0496123_0035640_708_1706 269
99 3300048926 Ga0496123_0150522 Ga0496123_0150522_80_991 269
100 3300048929 Ga0496126_0102729 Ga0496126_0102729_15_1013 269
101 3300005471 Ga0070698_100130477 Ga0070698_1001304773 271
102 3300007076 Ga0075435_100053804 Ga0075435_1000538043 271
103 3300050513 nmdc:mga0rr50_72863_c1 nmdc:mga0rr50_72863_c1_1616_2530 271
104 3300003320 rootH2_10067781 rootH2_1006778125 272
105 3300005334 Ga0068869_100106867 Ga0068869_1001068672 272
106 3300006852 Ga0075433_10014495 Ga0075433_100144953 272
107 3300006871 Ga0075434_100019704 Ga0075434_1000197043 272
108 3300046530 Ga0495654_0024272 Ga0495654_0024272_465_1457 272
109 3300047469 Ga0495673_0000513 Ga0495673_0000513_16214_17206 272
110 3300050493 nmdc:mga0k408_220418_c1 nmdc:mga0k408_220418_c1_121_1059 272
111 3300050511 nmdc:mga08y16_16217_c1 nmdc:mga08y16_16217_c1_6807_7697 272
112 3300050512 nmdc:mga0n895_21927_c1 nmdc:mga0n895_21927_c1_3467_4366 272
113 3300050515 nmdc:mga0a205_43292_c1 nmdc:mga0a205_43292_c1_856_1755 272
114 3300009011 Ga0105251_10001093 Ga0105251_1000109316 273
115 3300025735 Ga0207713_1000038 Ga0207713_1000038150 273
116 3300005327 Ga0070658_10002863 Ga0070658_1000286310 274
117 3300013307 Ga0157372_10413971 Ga0157372_104139712 274
118 3300005844 Ga0068862_100256772 Ga0068862_1002567722 275
119 3300031344 Ga0265316_10137983 Ga0265316_101379832 275
120 3300046530 Ga0495654_0000020 Ga0495654_0000020_51093_51959 275
121 3300046794 Ga0495589_0003680 Ga0495589_0003680_3505_4371 275
122 3300049460 Ga0495682_0000004 Ga0495682_0000004_57406_58272 275
123 3300005468 Ga0070707_100023744 Ga0070707_1000237447 276
124 3300005548 Ga0070665_100001966 Ga0070665_10000196610 276
125 3300006946 Ga0079104_1000166 Ga0079104_100016662 276
126 3300007076 Ga0075435_100083623 Ga0075435_1000836233 276
127 3300025922 Ga0207646_10022560 Ga0207646_100225607 276
128 3300027111 Ga0209281_1000001 Ga0209281_10000011758 276
129 3300028379 Ga0268266_10000531 Ga0268266_1000053126 276
130 3300050513 nmdc:mga0rr50_101203_c1 nmdc:mga0rr50_101203_c1_1012_1905 276
131 iso_pu_bacteria 2855020534 2855021100 276
132 3300005327 Ga0070658_10007304 Ga0070658_1000730411 277
133 3300005339 Ga0070660_100218506 Ga0070660_1002185062 277
134 3300005344 Ga0070661_100261212 Ga0070661_1002612122 277
135 3300005530 Ga0070679_100057650 Ga0070679_1000576502 277
136 3300006847 Ga0075431_100000337 Ga0075431_10000033710 277
137 3300006880 Ga0075429_100017595 Ga0075429_1000175953 277
138 3300009093 Ga0105240_10233930 Ga0105240_102339302 277
139 3300009551 Ga0105238_10243555 Ga0105238_102435552 277
140 3300013104 Ga0157370_10644254 Ga0157370_106442541 277
141 3300025919 Ga0207657_10028108 Ga0207657_100281083 277
142 3300025921 Ga0207652_10038954 Ga0207652_100389542 277
143 3300025924 Ga0207694_10172761 Ga0207694_101727613 277
144 3300050508 nmdc:mga09592_190299_c1 nmdc:mga09592_190299_c1_95_994 277
145 3300050509 nmdc:mga0qj67_21647_c1 nmdc:mga0qj67_21647_c1_3146_4045 277
146 3300050510 nmdc:mga06r32_107243_c1 nmdc:mga06r32_107243_c1_1216_2115 277
147 3300009011 Ga0105251_10002927 Ga0105251_100029279 278
148 3300027312 Ga0209371_1006582 Ga0209371_10065822 279
149 3300030500 Ga0268256_1006585 Ga0268256_10065852 279
150 3300047472 Ga0495686_0006144 Ga0495686_0006144_5189_6109 279
151 3300025986 Ga0207658_10079321 Ga0207658_100793212 280
152 3300036401 Ga0373937_0347475 Ga0373937_0347475_477_1391 280
153 iso_pu_bacteria 2713897090 2715498742 280
154 3300009545 Ga0105237_10020561 Ga0105237_100205613 281
155 3300010375 Ga0105239_10095578 Ga0105239_100955782 281
156 3300025911 Ga0207654_10237666 Ga0207654_102376661 281
157 3300025940 Ga0207691_10382275 Ga0207691_103822751 281
158 3300048922 Ga0496119_0000280 Ga0496119_0000280_11073_12023 281
159 3300048923 Ga0496120_0000255 Ga0496120_0000255_19108_20058 281
160 3300009036 Ga0105244_10001332 Ga0105244_100013326 282
161 3300009036 Ga0105244_10008026 Ga0105244_100080267 282
162 3300009092 Ga0105250_10001806 Ga0105250_1000180614 282
163 3300025711 Ga0207696_1000420 Ga0207696_100042028 282
164 3300025728 Ga0207655_1008424 Ga0207655_10084247 282
165 3300025728 Ga0207655_1012604 Ga0207655_10126044 282
166 3300025949 Ga0207667_10178835 Ga0207667_101788351 282
167 3300046515 Ga0495620_0003155 Ga0495620_0003155_8402_9289 282
168 3300046674 Ga0495588_0005827 Ga0495588_0005827_25_936 282
169 3300046694 Ga0495649_0001250 Ga0495649_0001250_9352_10239 282
170 3300047446 Ga0495679_001546 Ga0495679_001546_4132_5019 282
171 3300049572 Ga0501036_0096084 Ga0501036_0096084_1139_2047 282
172 3300049576 Ga0501040_0036787 Ga0501040_0036787_191_1096 282
173 3300049578 Ga0501042_0004793 Ga0501042_0004793_523_1428 282
174 3300049590 Ga0501074_0027145 Ga0501074_0027145_1334_2239 282
175 3300049591 Ga0501075_0008310 Ga0501075_0008310_4675_5580 282
176 3300049592 Ga0501076_0024876 Ga0501076_0024876_1439_2344 282
177 3300049743 Ga0501081_0016022 Ga0501081_0016022_401_1306 282
178 3300049824 Ga0501045_0125713 Ga0501045_0125713_797_1702 282
179 3300054114 Ga0501084_0023541 Ga0501084_0023541_458_1363 282
180 3300009545 Ga0105237_10130987 Ga0105237_101309873 283
181 3300031852 Ga0307410_10147092 Ga0307410_101470922 283
182 3300048924 Ga0496121_0181639 Ga0496121_0181639_347_1240 283
183 iso_pu_bacteria 2884086401 2884090148 283
184 3300005436 Ga0070713_100000385 Ga0070713_1000003855 284
185 3300005842 Ga0068858_100032486 Ga0068858_1000324863 284
186 3300014968 Ga0157379_10002070 Ga0157379_100020707 284
187 3300025928 Ga0207700_10000031 Ga0207700_1000003158 284
188 3300025986 Ga0207658_10055294 Ga0207658_100552943 284
189 3300026035 Ga0207703_10015669 Ga0207703_100156694 284
190 3300035398 Ga0316574_0133240 Ga0316574_0133240_28_960 284
191 iso_pu_bacteria 2554235234 2555259502 284
192 iso_pu_bacteria 2602042066 2603700236 284
193 iso_pu_bacteria 2602042067 2603704226 284
194 iso_pu_bacteria 2609459761 2609912554 284
195 iso_pu_bacteria 2667528172 2671102135 284
196 iso_pu_bacteria 2681812866 2681995987 284
197 iso_pu_bacteria 2681812869 2682009006 284
198 iso_pu_bacteria 2711768156 2712470614 284
199 iso_pu_bacteria 2751185917 2753854835 284
200 iso_pu_bacteria 2765235842 2765587700 284
201 iso_pu_bacteria 2821118458 2821118615 284
202 iso_pu_bacteria 2823373977 2823377184 284
203 iso_pu_bacteria 2847085930 2847088814 284
204 iso_pu_bacteria 2908669403 2908671344 284
205 iso_pu_bacteria 2919108558 2919109942 284
206 iso_pu_bacteria 2923634449 2923638250 284
207 iso_pu_bacteria 2927833300 2927835313 284
208 iso_pu_bacteria 2937539931 2937542809 284
209 iso_pu_bacteria 2939568625 2939570801 284
210 iso_pu_bacteria 2939607340 2939610858 284
211 iso_pu_bacteria 2939642701 2939644907 284
212 iso_pu_bacteria 2945874760 2945879416 284
213 iso_pu_bacteria 2971820967 2971825284 284
214 iso_pu_bacteria 2974310843 2974313369 284
215 iso_pu_bacteria 8018221730 8018224037 284
216 iso_pu_bacteria 8018405270 8018406590 284
217 iso_pu_bacteria 8055087960 8055090153 284
218 iso_pu_bacteria 8055092621 8055096407 284
219 iso_pu_bacteria 8055097453 8055101419 284
220 iso_pu_bacteria 8055693939 8055697127 284
221 iso_pu_bacteria 8057304971 8057306347 284
222 3300005331 Ga0070670_100045945 Ga0070670_1000459451 285
223 3300006852 Ga0075433_10017621 Ga0075433_100176216 285
224 3300009094 Ga0111539_10007070 Ga0111539_100070704 285
225 3300013308 Ga0157375_10043734 Ga0157375_100437343 285
226 3300031691 Ga0316579_10067366 Ga0316579_100673662 285
227 3300045051 Ga0451576_0319090 Ga0451576_0319090_43_969 285
228 3300050511 nmdc:mga08y16_52175_c1 nmdc:mga08y16_52175_c1_1617_2555 285
229 3300050515 nmdc:mga0a205_30583_c1 nmdc:mga0a205_30583_c1_3011_3949 285
230 iso_pu_bacteria 2506520007 2506577003 285
231 iso_pu_bacteria 2506520008 2506582141 285
232 iso_pu_bacteria 2508501071 2508850975 285
233 iso_pu_bacteria 2547132181 2547697560 285
234 iso_pu_bacteria 2561511199 2562466206 285
235 iso_pu_bacteria 2600255256 2601531657 285
236 iso_pu_bacteria 2600255257 2601537029 285
237 iso_pu_bacteria 2600255310 2601755375 285
238 iso_pu_bacteria 2600255311 2601760742 285
239 iso_pu_bacteria 2602042046 2603639214 285
240 iso_pu_bacteria 2654587920 2656279374 285
241 iso_pu_bacteria 2687453601 2689443405 285
242 iso_pu_bacteria 2791355010 2792313626 285
243 iso_pu_bacteria 2791355275 2793406626 285
244 iso_pu_bacteria 2806310673 2807179769 285
245 iso_pu_bacteria 2811995292 2813730258 285
246 iso_pu_bacteria 2814123068 2814697848 285
247 iso_pu_bacteria 2869551831 2869552815 285
248 iso_pu_bacteria 2932406140 2932407475 285
249 iso_pu_bacteria 2939573065 2939574970 285
250 iso_pu_bacteria 2939577877 2939579385 285
251 iso_pu_bacteria 2939617950 2939622498 285
252 iso_pu_bacteria 640753048 640936555 285
253 iso_pu_bacteria 8019504834 8019508702 285
254 3300005290 Ga0065712_10067763 Ga0065712_1006776329 286
255 3300005354 Ga0070675_100033916 Ga0070675_1000339163 286
256 3300005617 Ga0068859_100328816 Ga0068859_1003288161 286
257 3300005844 Ga0068862_100162134 Ga0068862_1001621342 286
258 3300006880 Ga0075429_100095627 Ga0075429_1000956273 286
259 3300006931 Ga0097620_100328836 Ga0097620_1003288362 286
260 3300009147 Ga0114129_10198228 Ga0114129_101982281 286
261 3300014745 Ga0157377_10014009 Ga0157377_100140092 286
262 3300025901 Ga0207688_10161114 Ga0207688_101611141 286
263 3300025926 Ga0207659_10024594 Ga0207659_100245942 286
264 3300027907 Ga0207428_10071014 Ga0207428_100710143 286
265 3300044712 Ga0453684_0054530 Ga0453684_0054530_1522_2481 286
266 3300048916 Ga0496113_0020048 Ga0496113_0020048_2499_3416 286
267 3300050508 nmdc:mga09592_112824_c1 nmdc:mga09592_112824_c1_691_1608 286
268 3300050511 nmdc:mga08y16_112955_c1 nmdc:mga08y16_112955_c1_990_1907 286
269 iso_pu_bacteria 2599185169 2599412083 286
270 iso_pu_bacteria 2600255254 2601525261 286
271 iso_pu_bacteria 2600255255 2601530448 286
272 iso_pu_bacteria 2600255280 2601616948 286
273 iso_pu_bacteria 2600255281 2601621705 286
274 iso_pu_bacteria 2600255287 2601644883 286
275 iso_pu_bacteria 2600255288 2601650571 286
276 iso_pu_bacteria 2600255289 2601655029 286
277 iso_pu_bacteria 2600255290 2601660304 286
278 iso_pu_bacteria 2600255291 2601665147 286
279 iso_pu_bacteria 2600255298 2601697762 286
280 iso_pu_bacteria 2600255299 2601703150 286
281 iso_pu_bacteria 2600255300 2601708151 286
282 iso_pu_bacteria 2600255301 2601713244 286
283 iso_pu_bacteria 2600255302 2601718588 286
284 iso_pu_bacteria 2600255303 2601723311 286
285 iso_pu_bacteria 2600255304 2601728179 286
286 iso_pu_bacteria 2600255305 2601733536 286
287 iso_pu_bacteria 2600255306 2601738163 286
288 iso_pu_bacteria 2600255307 2601742286 286
289 iso_pu_bacteria 2600255309 2601753500 286
290 iso_pu_bacteria 2600255392 2602020113 286
291 iso_pu_bacteria 2636415599 2637226831 286
292 iso_pu_bacteria 2671180115 2671585279 286
293 iso_pu_bacteria 2675903046 2676407017 286
294 iso_pu_bacteria 2772190666 2772437532 286
295 iso_pu_bacteria 2775506706 2775541900 286
296 iso_pu_bacteria 2852103415 2852103465 286
297 iso_pu_bacteria 2888366609 2888367551 286
298 iso_pu_bacteria 2891670763 2891672998 286
299 iso_pu_bacteria 2904513164 2904515098 286
300 iso_pu_bacteria 2937967321 2937972065 286
301 iso_pu_bacteria 2969079654 2969083815 286
302 iso_pu_bacteria 2984559226 2984560919 286
303 iso_pu_bacteria 2984595703 2984598993 286
304 iso_pu_bacteria 8004592986 8004594234 286
305 iso_pu_bacteria 8054844752 8054848792 286
306 iso_pu_bacteria 8054849141 8054849356 286
307 3300006051 Ga0075364_10107915 Ga0075364_101079151 288
308 3300006946 Ga0079104_1000578 Ga0079104_100057820 288
309 3300009011 Ga0105251_10000254 Ga0105251_1000025429 288
310 3300009036 Ga0105244_10000393 Ga0105244_100003933 288
311 3300009036 Ga0105244_10008717 Ga0105244_100087172 288
312 3300009036 Ga0105244_10014896 Ga0105244_100148962 288
313 3300009092 Ga0105250_10000150 Ga0105250_1000015035 288
314 3300009148 Ga0105243_10008113 Ga0105243_1000811311 288
315 3300013104 Ga0157370_10002956 Ga0157370_1000295612 288
316 3300021384 Ga0213876_10000025 Ga0213876_10000025120 288
317 3300025711 Ga0207696_1000007 Ga0207696_1000007434 288
318 3300025728 Ga0207655_1005258 Ga0207655_10052583 288
319 3300025735 Ga0207713_1000005 Ga0207713_1000005572 288
320 3300025935 Ga0207709_10004933 Ga0207709_1000493311 288
321 3300027111 Ga0209281_1000907 Ga0209281_10009079 288
322 3300028379 Ga0268266_10000165 Ga0268266_1000016599 288
323 3300039437 Ga0436365_1279401 Ga0436365_1279401_175458_176414 288
324 3300041512 Ga0451853_0338586 Ga0451853_0338586_630_1622 288
325 3300042010 Ga0439452_000040 Ga0439452_000040_18780_19772 288
326 3300042010 Ga0439452_000362 Ga0439452_000362_26659_27651 288
327 3300042439 Ga0439464_0008918 Ga0439464_0008918_802_1794 288
328 3300044669 Ga0466981_0000011 Ga0466981_0000011_181_1173 288
329 3300046458 Ga0495591_001083 Ga0495591_001083_5451_6356 288
330 3300046458 Ga0495591_008109 Ga0495591_008109_2999_3904 288
331 3300046460 Ga0495638_0007922 Ga0495638_0007922_312_1217 288
332 3300046471 Ga0495650_0000033 Ga0495650_0000033_354941_355846 288
333 3300046471 Ga0495650_0000205 Ga0495650_0000205_84264_85256 288
334 3300046501 Ga0495607_0022953 Ga0495607_0022953_897_1802 288
335 3300046507 Ga0495606_0000296 Ga0495606_0000296_25962_26867 288
336 3300046523 Ga0495644_0029716 Ga0495644_0029716_749_1654 288
337 3300046524 Ga0495648_0023845 Ga0495648_0023845_588_1493 288
338 3300046694 Ga0495649_0006867 Ga0495649_0006867_5941_6846 288
339 3300046694 Ga0495649_0013724 Ga0495649_0013724_1482_2387 288
340 3300046810 Ga0495660_0000011 Ga0495660_0000011_20287_21192 288
341 3300047320 Ga0495672_0000004 Ga0495672_0000004_515554_516459 288
342 3300047446 Ga0495679_055275 Ga0495679_055275_88_993 288
343 3300047469 Ga0495673_0000023 Ga0495673_0000023_468652_469557 288
344 3300048907 Ga0496104_0393773 Ga0496104_0393773_60_965 288
345 3300048908 Ga0496105_0039231 Ga0496105_0039231_144_1049 288
346 3300048919 Ga0496116_0000170 Ga0496116_0000170_85074_85979 288
347 3300048919 Ga0496116_0004763 Ga0496116_0004763_5521_6513 288
348 3300048920 Ga0496117_0000517 Ga0496117_0000517_55322_56314 288
349 3300048921 Ga0496118_0000428 Ga0496118_0000428_61845_62837 288
350 3300048921 Ga0496118_0024858 Ga0496118_0024858_806_1711 288
351 3300048921 Ga0496118_0145974 Ga0496118_0145974_364_1269 288
352 3300048922 Ga0496119_0000078 Ga0496119_0000078_52712_53617 288
353 3300048922 Ga0496119_0001515 Ga0496119_0001515_596_1501 288
354 3300048922 Ga0496119_0004726 Ga0496119_0004726_4927_5919 288
355 3300048922 Ga0496119_0015003 Ga0496119_0015003_4957_5862 288
356 3300048923 Ga0496120_0000009 Ga0496120_0000009_86552_87457 288
357 3300048923 Ga0496120_0000265 Ga0496120_0000265_68151_69056 288
358 3300048923 Ga0496120_0003079 Ga0496120_0003079_10000_10992 288
359 3300048923 Ga0496120_0011577 Ga0496120_0011577_358_1263 288
360 3300048924 Ga0496121_0111423 Ga0496121_0111423_1081_2073 288
361 3300048925 Ga0496122_0000947 Ga0496122_0000947_31226_32182 288
362 3300048925 Ga0496122_0001097 Ga0496122_0001097_22811_23803 288
363 3300048925 Ga0496122_0185362 Ga0496122_0185362_96_1001 288
364 3300048926 Ga0496123_0000171 Ga0496123_0000171_106767_107723 288
365 3300048926 Ga0496123_0001333 Ga0496123_0001333_10125_11117 288
366 3300048926 Ga0496123_0002196 Ga0496123_0002196_17217_18146 288
367 3300048929 Ga0496126_0041603 Ga0496126_0041603_1067_1972 288
368 3300049459 Ga0495678_000422 Ga0495678_000422_17296_18201 288
369 3300053126 Ga0500621_000001 Ga0500621_000001_115365_116270 288
370 iso_pu_bacteria 2602042047 2603643653 288
371 iso_pu_bacteria 2602042109 2603866390 288
372 3300002773 JGI25152J39213_1000504 JGI25152J39213_10005041 289
373 3300003856 Ga0058692_1024138 Ga0058692_10241381 289
374 3300003856 Ga0058692_1027150 Ga0058692_10271501 289
375 3300006946 Ga0079104_1029048 Ga0079104_10290481 289
376 3300009011 Ga0105251_10000073 Ga0105251_1000007388 289
377 3300009011 Ga0105251_10000582 Ga0105251_1000058238 289
378 3300009011 Ga0105251_10002540 Ga0105251_100025407 289
379 3300009036 Ga0105244_10000315 Ga0105244_100003159 289
380 3300009092 Ga0105250_10000052 Ga0105250_1000005267 289
381 3300009101 Ga0105247_10000191 Ga0105247_1000019139 289
382 3300009174 Ga0105241_10000004 Ga0105241_10000004138 289
383 3300013100 Ga0157373_10014395 Ga0157373_100143953 289
384 3300013102 Ga0157371_10001405 Ga0157371_1000140516 289
385 3300013102 Ga0157371_10181645 Ga0157371_101816451 289
386 3300013105 Ga0157369_10025595 Ga0157369_100255959 289
387 3300013307 Ga0157372_10110465 Ga0157372_101104654 289
388 3300014497 Ga0182008_10003637 Ga0182008_100036376 289
389 3300017792 Ga0163161_10000004 Ga0163161_10000004255 289
390 3300025258 Ga0209129_1000015 Ga0209129_100001579 289
391 3300025711 Ga0207696_1000003 Ga0207696_1000003208 289
392 3300025711 Ga0207696_1000033 Ga0207696_1000033214 289
393 3300025728 Ga0207655_1000011 Ga0207655_100001155 289
394 3300025735 Ga0207713_1000065 Ga0207713_1000065153 289
395 3300025735 Ga0207713_1000108 Ga0207713_100010844 289
396 3300025735 Ga0207713_1003616 Ga0207713_10036167 289
397 3300025900 Ga0207710_10000016 Ga0207710_10000016156 289
398 3300025911 Ga0207654_10000006 Ga0207654_10000006154 289
399 3300027111 Ga0209281_1000008 Ga0209281_1000008717 289
400 3300027111 Ga0209281_1010341 Ga0209281_10103414 289
401 3300027312 Ga0209371_1000026 Ga0209371_1000026120 289
402 3300027312 Ga0209371_1000104 Ga0209371_100010457 289
403 3300027312 Ga0209371_1001037 Ga0209371_10010377 289
404 3300030500 Ga0268256_1000003 Ga0268256_1000003120 289
405 3300030500 Ga0268256_1000017 Ga0268256_1000017207 289
406 3300041405 Ga0439438_000020 Ga0439438_000020_46733_47707 289
407 3300041407 Ga0439447_000561 Ga0439447_000561_7262_8236 289
408 3300042006 Ga0439432_001067 Ga0439432_001067_5911_6885 289
409 3300042006 Ga0439432_006169 Ga0439432_006169_1536_2459 289
410 3300042010 Ga0439452_000038 Ga0439452_000038_148573_149505 289
411 3300046453 Ga0495627_000136 Ga0495627_000136_82679_83602 289
412 3300046530 Ga0495654_0000386 Ga0495654_0000386_10133_11056 289
413 3300046794 Ga0495589_0000006 Ga0495589_0000006_162268_163191 289
414 3300048906 Ga0496103_0073716 Ga0496103_0073716_1049_1957 289
415 3300048919 Ga0496116_0000031 Ga0496116_0000031_148398_149306 289
416 3300048919 Ga0496116_0124745 Ga0496116_0124745_261_1193 289
417 3300048920 Ga0496117_0001926 Ga0496117_0001926_9816_10724 289
418 3300048920 Ga0496117_0003323 Ga0496117_0003323_12842_13774 289
419 3300048920 Ga0496117_0050640 Ga0496117_0050640_702_1634 289
420 3300048921 Ga0496118_0002879 Ga0496118_0002879_16495_17427 289
421 3300048922 Ga0496119_0000062 Ga0496119_0000062_26456_27388 289
422 3300048922 Ga0496119_0131213 Ga0496119_0131213_399_1307 289
423 3300048923 Ga0496120_0021820 Ga0496120_0021820_2201_3109 289
424 3300048925 Ga0496122_0013052 Ga0496122_0013052_6102_7034 289
425 3300048925 Ga0496122_0114689 Ga0496122_0114689_747_1709 289
426 3300048927 Ga0496124_0000465 Ga0496124_0000465_61697_62629 289
427 3300048928 Ga0496125_0000413 Ga0496125_0000413_48928_49890 289
428 3300048928 Ga0496125_0011587 Ga0496125_0011587_507_1439 289
429 3300048929 Ga0496126_0041517 Ga0496126_0041517_1927_2889 289
430 3300048929 Ga0496126_0184789 Ga0496126_0184789_615_1547 289
431 iso_pu_bacteria 2935625433 2935629630 289
432 iso_pu_bacteria 3000376612 3000380228 289
433 3300002737 JGI25162J39368_1001294 JGI25162J39368_10012945 290
434 3300006946 Ga0079104_1000174 Ga0079104_100017411 290
435 3300006946 Ga0079104_1000192 Ga0079104_100019273 290
436 3300013307 Ga0157372_10012380 Ga0157372_1001238012 290
437 3300025728 Ga0207655_1003806 Ga0207655_10038066 290
438 3300027111 Ga0209281_1000093 Ga0209281_1000093109 290
439 3300027111 Ga0209281_1000254 Ga0209281_100025471 290
440 3300027312 Ga0209371_1001081 Ga0209371_100108117 290
441 3300027312 Ga0209371_1001890 Ga0209371_10018906 290
442 3300030500 Ga0268256_1000746 Ga0268256_10007467 290
443 3300030500 Ga0268256_1000822 Ga0268256_100082215 290
444 3300042010 Ga0439452_001669 Ga0439452_001669_7743_8654 290
445 3300046530 Ga0495654_0025861 Ga0495654_0025861_1409_2320 290
446 3300046542 Ga0495597_0000053 Ga0495597_0000053_43046_43957 290
447 3300046660 Ga0495625_0008056 Ga0495625_0008056_7984_8895 290
448 3300047320 Ga0495672_0000027 Ga0495672_0000027_258064_258975 290
449 3300047446 Ga0495679_000080 Ga0495679_000080_67006_67917 290
450 3300048904 Ga0496101_0088432 Ga0496101_0088432_183_1181 290
451 3300048923 Ga0496120_0000228 Ga0496120_0000228_75675_76652 290
452 3300048927 Ga0496124_0000122 Ga0496124_0000122_53776_54753 290
453 3300048929 Ga0496126_0335787 Ga0496126_0335787_162_1073 290
454 iso_pu_bacteria 2602042052 2603661943 290
455 iso_pu_bacteria 2602042053 2603666841 290
456 iso_pu_bacteria 2602042103 2603840649 290
457 iso_pu_bacteria 2602042104 2603845689 290
458 iso_pu_bacteria 2602042105 2603850762 290
459 iso_pu_bacteria 2602042106 2603855866 290
460 iso_pu_bacteria 2602042110 2603873447 290
461 iso_pu_bacteria 2602042111 2603877503 290
462 iso_pu_bacteria 2603880178 2606050591 290
463 iso_pu_bacteria 2603880184 2606071273 290
464 iso_pu_bacteria 2603880202 2606148275 290
465 iso_pu_bacteria 2603880211 2606178516 290
466 iso_pu_bacteria 2775507074 2777022555 290

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00480

ROK

ROK family

31

331

0.99

PF02685

Glucokinase

Glucokinase

32

275

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oqb-assembly1.cif.gz_B crystal structure of the n-terminal domain of coactivator-associated methyltransferase 1 (carm1) 0.9116 3 29
7p9l-assembly1.cif.gz_BBB n-acetylglucosamine kinase from plesiomonas shigelloides compexed with alpha-n-acetylglucosamine-6-phosphate 0.8781 2 285
3vgk-assembly2.cif.gz_B crystal structure of a rok family glucokinase from streptomyces griseus 0.8646 1 282
3vov-assembly1.cif.gz_B crystal structure of rok hexokinase from thermus thermophilus 0.8625 2 285
6ea8-assembly5.cif.gz_I-4 structure of vacv poxin in pre-reactive state with nonhydrolyzable 2'3' cgamp 0.8602 5 29
ID Description Score Start End Superfamily
af_P23917_1_103_1.10.520.10 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1; 1.001 1 103 1.10.520.10
af_P23917_1_103_1.10.520.10 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1; 0.9914 1 103 1.10.520.10
af_P23917_121_283_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9857 128 270 3.30.420.40
af_P23917_104_294_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9813 104 280 3.30.420.40
af_K7VRG2_61_286_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9516 3 30 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A3D5M815-F1-model_v4 deleted 1.006 1 101
AF-A0A2N4Z0S0-F1-model_v4 Fructokinase (EC 2.7.1.4) 1.001 1 92 GO:0008865
AF-A0A381QKT4-F1-model_v4 ROK family protein 0.9973 1 103
AF-A0A081RUE6-F1-model_v4 Transcriptional regulator/sugar kinase 0.997 2 106 GO:0004396
AF-A0A509CR97-F1-model_v4 deleted 0.9958 1 104

Feature Viewer

pLDDT pTM Quality
91.24 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map