metagRoot

F449661

General Info

Members	Datasets	Scaffolds	Average Seq Length
466	244	463	251

Family's Representative Sequence

Representative Sequence	3300013105\|Ga0157369_10188169\|Ga0157369_101881692
Length	296
Sequence	MNFPCVGLPVLFVGQREGEAGEAPAEPKVVGKTRLGGSLALPSARSAKKMFDLTGKTALITGSGSGIAQVGAYVVIAELNAEGGQKVASDIRQNGGQAEYLKVDVSDESSCKSAGAHVLSTCGQCDILVNNAGIGHVGTALTTTGADLDRLHAVNVKGVLFMTQAFLPSMLDRRSGSVINLASIGGIVGIRDRLAYCATKFAVVGMTKSMALDHAESQVRFNCICPGRVETPFVQQRLKEYPDPQKAYKDMSATQALGRMGKPDEIAAAALYLASEESAFVTGSALIIDGGWSAGK

Samples

	Sample ID	Description	Type	Environment
1	2842324504	Paraburkholderia fungorum SEMIA 4007	Isolate	Nodule
2	2842348783	Paraburkholderia fungorum SEMIA 4013	Isolate	Nodule
3	2842454564	Paraburkholderia fungorum SEMIA 4056	Isolate	Nodule
4	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
5	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
6	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
7	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
8	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
9	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
10	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
11	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
12	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
13	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
14	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
15	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
16	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
17	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
18	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
19	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
20	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
21	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
22	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
23	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
24	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
25	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
26	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
27	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
28	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
29	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
30	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
31	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
32	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
33	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
34	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
35	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
36	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
37	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
38	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
39	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
40	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
41	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
42	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
43	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
44	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
45	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
46	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
47	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
48	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
49	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
50	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
51	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
52	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
53	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
54	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
55	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
56	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
57	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
58	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
59	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
60	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
61	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
62	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
63	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
64	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
65	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
66	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
67	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
68	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
69	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
70	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
71	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
72	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
73	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
74	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
75	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
76	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
77	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
78	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
79	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
80	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
110	3300028017	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4	Metagenome	Rhizosphere
111	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
113	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
114	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
115	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
116	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
117	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
118	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
119	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
120	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
121	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
122	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
123	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
124	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
125	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
126	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
127	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
128	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
129	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
130	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
131	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
132	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
133	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
134	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
135	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
136	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
137	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
138	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
139	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
140	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
141	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
142	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
143	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
144	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
145	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
146	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
147	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
148	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
149	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
150	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
151	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
152	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
153	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
154	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
155	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
156	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
157	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
158	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
159	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
160	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
161	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
162	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
163	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
164	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
165	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
166	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
167	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
168	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
169	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
170	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
171	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
172	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
173	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
174	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
175	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
176	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
177	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
178	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
179	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
180	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
181	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
182	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
183	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
184	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
185	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
186	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
187	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
188	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
189	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
190	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
191	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
192	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
193	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
194	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
195	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
196	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
197	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
198	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
199	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
200	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
201	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
202	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
203	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
204	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
205	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
206	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
207	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
208	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
209	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
210	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
211	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
212	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
213	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
214	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
215	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
216	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
217	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
218	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
219	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
220	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
221	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
222	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
223	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
224	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
225	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
226	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
227	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
228	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
229	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
230	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
231	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
232	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
233	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
234	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
235	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
236	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
237	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
238	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
239	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
240	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
241	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
242	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
243	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
244	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.36
Metatranscriptomes	0
Isolates	0.64

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	3.22
Nodule	0.64
Rhizoplane	1.72
Rhizosphere	91.63
Stem	0
Stem Tuber	0
Unclassified	2.79

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	rootH1_10255670	3300003323	Bacteria	3558
2	Ga0070683_100065098	3300005329	Bacteria	3394
3	Ga0070690_100249445	3300005330	Bacteria	1255
4	Ga0070670_100013598	3300005331	Bacteria	6975
5	Ga0070670_100075859	3300005331	Bacteria	2889
6	Ga0070666_10006530	3300005335	Bacteria	7165
7	Ga0070689_100226108	3300005340	Bacteria	1537
8	Ga0070689_100330004	3300005340	Bacteria	1276
9	Ga0070691_10197103	3300005341	Bacteria	1056
10	Ga0070669_100068458	3300005353	Bacteria	2620
11	Ga0070675_100221496	3300005354	Bacteria	1648
12	Ga0070671_100017483	3300005355	Bacteria	5809
13	Ga0070674_100018176	3300005356	Bacteria	4439
14	Ga0070673_100243284	3300005364	Bacteria	1565
15	Ga0070688_100219665	3300005365	Bacteria	1339
16	Ga0070688_100229528	3300005365	Bacteria	1312
17	Ga0070667_100149954	3300005367	Bacteria	2048
18	Ga0070667_100300723	3300005367	Bacteria	1445
19	Ga0070714_100004483	3300005435	Bacteria	10520
20	Ga0070714_100053299	3300005435	Bacteria	3452
21	Ga0070713_100527908	3300005436	Bacteria	1116
22	Ga0070701_10132746	3300005438	Bacteria	1416
23	Ga0070694_100165685	3300005444	Bacteria	1625
24	Ga0070694_100564542	3300005444	Bacteria	913
25	Ga0070663_100145173	3300005455	Bacteria	1815
26	Ga0070663_100367270	3300005455	Bacteria	1169
27	Ga0070662_100070759	3300005457	Bacteria	2570
28	Ga0070681_10141428	3300005458	Unclassified	2336
29	Ga0070685_10006842	3300005466	Bacteria	5822
30	Ga0070698_100196798	3300005471	Bacteria	1952
31	Ga0068853_100000003	3300005539	Bacteria	434636
32	Ga0068853_100013765	3300005539	Bacteria	6609
33	Ga0068853_100764237	3300005539	Bacteria	924
34	Ga0070672_100081935	3300005543	Bacteria	2588
35	Ga0070672_100202579	3300005543	Bacteria	1660
36	Ga0070686_100000784	3300005544	Bacteria	18408
37	Ga0070686_100131737	3300005544	Unclassified	1730
38	Ga0070665_100002241	3300005548	Bacteria	21536
39	Ga0070665_100003080	3300005548	Bacteria	17958
40	Ga0068855_100127159	3300005563	Bacteria	2913
41	Ga0068855_100153153	3300005563	Unclassified	2620
42	Ga0068855_100162877	3300005563	Bacteria	2530
43	Ga0068855_100636133	3300005563	Bacteria	1147
44	Ga0068855_100863946	3300005563	Bacteria	958
45	Ga0070664_100345187	3300005564	Bacteria	1353
46	Ga0068857_100024911	3300005577	Bacteria	5270
47	Ga0068856_100000425	3300005614	Bacteria	46387
48	Ga0068856_100081924	3300005614	Unclassified	3202
49	Ga0068852_100106436	3300005616	Bacteria	2542
50	Ga0068859_100311450	3300005617	Bacteria	1668
51	Ga0068859_100375491	3300005617	Unclassified	1517
52	Ga0068859_100514488	3300005617	Bacteria	1292
53	Ga0068864_100024029	3300005618	Bacteria	5124
54	Ga0068851_10011789	3300005834	Bacteria	4106
55	Ga0068870_10007354	3300005840	Unclassified	4904
56	Ga0068863_100046444	3300005841	Bacteria	4122
57	Ga0068863_100251408	3300005841	Bacteria	1707
58	Ga0068863_100409487	3300005841	Bacteria	1327
59	Ga0068858_100000775	3300005842	Bacteria	33351
60	Ga0068860_100425522	3300005843	Bacteria	1317
61	Ga0068862_100332670	3300005844	Bacteria	1405
62	Ga0075365_10004636	3300006038	Bacteria	7317
63	Ga0075368_10004888	3300006042	Bacteria	4572
64	Ga0075363_100032463	3300006048	Bacteria	2712
65	Ga0075364_10003587	3300006051	Bacteria	8840
66	Ga0070712_100145253	3300006175	Unclassified	1815
67	Ga0075367_10001290	3300006178	Bacteria	10599
68	Ga0075428_100043719	3300006844	Bacteria	4925
69	Ga0075428_100190781	3300006844	Unclassified	2216
70	Ga0075430_100016405	3300006846	Bacteria	6306
71	Ga0075430_100026907	3300006846	Bacteria	4891
72	Ga0075430_100103940	3300006846	Bacteria	2371
73	Ga0075430_100229101	3300006846	Bacteria	1541
74	Ga0075430_100299706	3300006846	Bacteria	1330
75	Ga0075431_100067799	3300006847	Unclassified	3683
76	Ga0075431_100152779	3300006847	Bacteria	2377
77	Ga0075431_100238286	3300006847	Bacteria	1851
78	Ga0075433_10035358	3300006852	Bacteria	4295
79	Ga0075433_10068664	3300006852	Bacteria	3112
80	Ga0075433_10082738	3300006852	Bacteria	2831
81	Ga0075433_10217993	3300006852	Bacteria	1695
82	Ga0075433_10353612	3300006852	Unclassified	1298
83	Ga0075434_100121080	3300006871	Bacteria	2632
84	Ga0075434_100231746	3300006871	Bacteria	1866
85	Ga0075434_100428920	3300006871	Bacteria	1343
86	Ga0097620_100311448	3300006931	Bacteria	1668
87	Ga0097620_100375484	3300006931	Unclassified	1517
88	Ga0097620_100514523	3300006931	Bacteria	1292
89	Ga0075435_100098892	3300007076	Bacteria	2415
90	Ga0105240_10001760	3300009093	Bacteria	36534
91	Ga0105240_10007171	3300009093	Bacteria	16232
92	Ga0105240_10022851	3300009093	Bacteria	8285
93	Ga0105240_10032800	3300009093	Bacteria	6719
94	Ga0105240_10115095	3300009093	Bacteria	3247
95	Ga0105240_10188306	3300009093	Bacteria	2428
96	Ga0105240_10220068	3300009093	Bacteria	2212
97	Ga0105240_10242599	3300009093	Bacteria	2088
98	Ga0105240_10243775	3300009093	Bacteria	2082
99	Ga0105240_10365462	3300009093	Unclassified	1633
100	Ga0105240_10510793	3300009093	Bacteria	1335
101	Ga0105240_10645753	3300009093	Bacteria	1160
102	Ga0111539_10000364	3300009094	Bacteria	55762
103	Ga0111539_10103695	3300009094	Bacteria	3338
104	Ga0111539_10435979	3300009094	Bacteria	1526
105	Ga0111539_10727018	3300009094	Unclassified	1156
106	Ga0105245_10212390	3300009098	Bacteria	1863
107	Ga0105245_10745931	3300009098	Bacteria	1015
108	Ga0114129_10090403	3300009147	Bacteria	4244
109	Ga0105242_10366093	3300009176	Bacteria	1335
110	Ga0105242_10574178	3300009176	Bacteria	1085
111	Ga0105248_10467215	3300009177	Bacteria	1422
112	Ga0105237_10008498	3300009545	Bacteria	11109
113	Ga0105237_10017521	3300009545	Bacteria	7423
114	Ga0105237_10038276	3300009545	Bacteria	4843
115	Ga0105237_10072025	3300009545	Bacteria	3450
116	Ga0105237_10174606	3300009545	Bacteria	2149
117	Ga0105237_10580155	3300009545	Bacteria	1128
118	Ga0105238_10001970	3300009551	Bacteria	20676
119	Ga0105238_10001990	3300009551	Bacteria	20588
120	Ga0105238_10034715	3300009551	Bacteria	5131
121	Ga0105238_10095008	3300009551	Bacteria	2969
122	Ga0105249_10072438	3300009553	Bacteria	3185
123	Ga0105249_10114153	3300009553	Bacteria	2557
124	Ga0105239_10000497	3300010375	Bacteria	56851
125	Ga0105239_10000609	3300010375	Bacteria	50949
126	Ga0105239_10002790	3300010375	Bacteria	21870
127	Ga0105239_10068556	3300010375	Bacteria	3898
128	Ga0105246_10014273	3300011119	Bacteria	4994
129	Ga0157369_10188169	3300013105	Bacteria	2170
130	Ga0157369_10530800	3300013105	Unclassified	1217
131	Ga0157374_10071423	3300013296	Bacteria	3273
132	Ga0157374_10513831	3300013296	Bacteria	1203
133	Ga0157378_10082678	3300013297	Bacteria	2904
134	Ga0157378_10183820	3300013297	Bacteria	1968
135	Ga0163162_10108329	3300013306	Bacteria	2874
136	Ga0157372_10578178	3300013307	Unclassified	1309
137	Ga0157372_10915126	3300013307	Bacteria	1017
138	Ga0163163_10020026	3300014325	Bacteria	6295
139	Ga0163163_10265227	3300014325	Bacteria	1768
140	Ga0163163_10321571	3300014325	Bacteria	1601
141	Ga0157377_10018006	3300014745	Bacteria	3665
142	Ga0213876_10047398	3300021384	Bacteria	2272
143	Ga0213875_10000022	3300021388	Bacteria	215075
144	Ga0213875_10017029	3300021388	Bacteria	3518
145	Ga0213875_10030723	3300021388	Bacteria	2542
146	Ga0209233_1001033	3300025261	Bacteria	11758
147	Ga0207656_10004590	3300025321	Bacteria	4835
148	Ga0207680_10065109	3300025903	Bacteria	2236
149	Ga0207647_10000083	3300025904	Bacteria	71340
150	Ga0207643_10009723	3300025908	Bacteria	5160
151	Ga0207705_10154512	3300025909	Bacteria	1721
152	Ga0207654_10096343	3300025911	Bacteria	1814
153	Ga0207695_10000498	3300025913	Bacteria	83654
154	Ga0207695_10022759	3300025913	Bacteria	7101
155	Ga0207695_10044224	3300025913	Bacteria	4738
156	Ga0207695_10054970	3300025913	Bacteria	4153
157	Ga0207695_10204302	3300025913	Bacteria	1889
158	Ga0207695_10272789	3300025913	Bacteria	1587
159	Ga0207695_10499899	3300025913	Bacteria	1098
160	Ga0207671_10034920	3300025914	Bacteria	3734
161	Ga0207671_10071677	3300025914	Bacteria	2585
162	Ga0207671_10092136	3300025914	Bacteria	2285
163	Ga0207671_10242294	3300025914	Bacteria	1416
164	Ga0207681_10163933	3300025923	Bacteria	1678
165	Ga0207694_10000382	3300025924	Bacteria	41281
166	Ga0207694_10000679	3300025924	Bacteria	30570
167	Ga0207694_10001796	3300025924	Bacteria	17862
168	Ga0207694_10003280	3300025924	Bacteria	12887
169	Ga0207687_10186237	3300025927	Bacteria	1612
170	Ga0207664_10146771	3300025929	Bacteria	2001
171	Ga0207644_10199279	3300025931	Unclassified	1578
172	Ga0207706_10009484	3300025933	Bacteria	8939
173	Ga0207670_10101679	3300025936	Bacteria	2054
174	Ga0207670_10137483	3300025936	Bacteria	1798
175	Ga0207691_10170303	3300025940	Bacteria	1907
176	Ga0207691_10231910	3300025940	Unclassified	1598
177	Ga0207691_10333142	3300025940	Bacteria	1300
178	Ga0207661_10293700	3300025944	Bacteria	1455
179	Ga0207667_10752514	3300025949	Bacteria	974
180	Ga0207651_10153173	3300025960	Bacteria	1797
181	Ga0207651_10176541	3300025960	Bacteria	1690
182	Ga0207712_10000461	3300025961	Bacteria	34326
183	Ga0207658_10002212	3300025986	Bacteria	14440
184	Ga0207677_10044708	3300026023	Bacteria	2952
185	Ga0207703_10010031	3300026035	Bacteria	7426
186	Ga0207639_10000002	3300026041	Bacteria	903066
187	Ga0207639_10000996	3300026041	Bacteria	19311
188	Ga0207639_10044485	3300026041	Bacteria	3339
189	Ga0207678_10209172	3300026067	Bacteria	1669
190	Ga0207708_10405577	3300026075	Bacteria	1128
191	Ga0207702_10000935	3300026078	Bacteria	30154
192	Ga0207702_10012941	3300026078	Bacteria	6942
193	Ga0207702_10343412	3300026078	Bacteria	1426
194	Ga0207702_10660480	3300026078	Bacteria	1029
195	Ga0207641_10120536	3300026088	Unclassified	2340
196	Ga0207648_10131834	3300026089	Bacteria	2200
197	Ga0207648_10318745	3300026089	Bacteria	1397
198	Ga0207674_10087205	3300026116	Bacteria	3115
199	Ga0207674_10156566	3300026116	Bacteria	2233
200	Ga0207674_10584610	3300026116	Bacteria	1079
201	Ga0207698_10133114	3300026142	Bacteria	2128
202	Ga0207698_10721871	3300026142	Bacteria	993
203	Ga0209813_10030798	3300027866	Bacteria	1579
204	Ga0265356_1006323	3300028017	Unclassified	1387
205	Ga0268266_10000008	3300028379	Bacteria	1161875
206	Ga0268266_10001221	3300028379	Bacteria	31571
207	Ga0265337_1002962	3300028556	Bacteria	7530
208	Ga0265319_1000824	3300028563	Bacteria	19749
209	Ga0265319_1001925	3300028563	Bacteria	11779
210	Ga0265319_1011644	3300028563	Bacteria	3589
211	Ga0265319_1074800	3300028563	Bacteria	1082
212	Ga0265318_10000121	3300028577	Bacteria	72340
213	Ga0265318_10001306	3300028577	Bacteria	14964
214	Ga0265338_10007795	3300028800	Bacteria	13166
215	Ga0265338_10040221	3300028800	Bacteria	4396
216	Ga0265338_10052481	3300028800	Bacteria	3657
217	Ga0265338_10298869	3300028800	Bacteria	1171
218	Ga0265324_10000065	3300029957	Bacteria	89923
219	Ga0265324_10051915	3300029957	Bacteria	1408
220	Ga0265330_10015393	3300031235	Bacteria	3538
221	Ga0265328_10000395	3300031239	Bacteria	20426
222	Ga0265320_10000365	3300031240	Bacteria	36581
223	Ga0265320_10003716	3300031240	Bacteria	10179
224	Ga0265320_10005370	3300031240	Bacteria	8238
225	Ga0265320_10007887	3300031240	Bacteria	6568
226	Ga0265320_10007920	3300031240	Bacteria	6556
227	Ga0265320_10103401	3300031240	Bacteria	1310
228	Ga0265320_10178569	3300031240	Bacteria	952
229	Ga0265329_10000137	3300031242	Bacteria	35158
230	Ga0265340_10002293	3300031247	Bacteria	10940
231	Ga0265339_10000005	3300031249	Bacteria	262324
232	Ga0265339_10006051	3300031249	Bacteria	7991
233	Ga0265339_10015809	3300031249	Bacteria	4515
234	Ga0265331_10005329	3300031250	Bacteria	7778
235	Ga0265327_10000634	3300031251	Bacteria	57259
236	Ga0265327_10000921	3300031251	Bacteria	43096
237	Ga0265327_10135403	3300031251	Bacteria	1156
238	Ga0265316_10004592	3300031344	Bacteria	13703
239	Ga0265316_10006411	3300031344	Bacteria	11242
240	Ga0307408_100002543	3300031548	Bacteria	12745
241	Ga0307408_100020746	3300031548	Bacteria	4439
242	Ga0265313_10000342	3300031595	Bacteria	50604
243	Ga0265313_10039407	3300031595	Bacteria	2343
244	Ga0265313_10130321	3300031595	Bacteria	1090
245	Ga0307508_10000100	3300031616	Bacteria	102032
246	Ga0265342_10000097	3300031712	Bacteria	96401
247	Ga0265342_10008013	3300031712	Bacteria	7649
248	Ga0307405_10022729	3300031731	Bacteria	3551
249	Ga0307416_100252062	3300032002	Bacteria	1719
250	Ga0373939_0210239	3300035114	Bacteria	740
251	Ga0373937_0087766	3300036401	Bacteria	2879
252	Ga0373937_0194622	3300036401	Bacteria	1905
253	Ga0373937_0223194	3300036401	Bacteria	1774
254	Ga0373937_0382575	3300036401	Bacteria	1335
255	Ga0395899_0026175	3300037312	Bacteria	4402
256	Ga0395900_0148308	3300037418	Bacteria	2398
257	Ga0436364_0530951	3300037853	Bacteria	215117
258	Ga0436364_0746224	3300037853	Bacteria	18452
259	Ga0436364_1457976	3300037853	Bacteria	36311
260	Ga0436365_1474640	3300039437	Bacteria	3867
261	Ga0436361_0185253	3300039447	Bacteria	2561
262	Ga0436362_0076657	3300039453	Bacteria	1266
263	Ga0451849_0480331	3300041505	Bacteria	5601
264	Ga0451855_1234120	3300041511	Bacteria	847
265	Ga0451853_0095766	3300041512	Bacteria	39931
266	Ga0439435_0000547	3300042436	Bacteria	6034
267	Ga0451577_0320385	3300042876	Bacteria	1406
268	Ga0466961_0000755	3300044693	Bacteria	20249
269	Ga0451576_0077319	3300045051	Bacteria	3463
270	Ga0451576_0116120	3300045051	Bacteria	2787
271	Ga0451576_0435801	3300045051	Bacteria	1375
272	Ga0451576_0960258	3300045051	Bacteria	896
273	Ga0451576_1376690	3300045051	Bacteria	734
274	Ga0495592_0067317	3300046454	Bacteria	2618
275	Ga0495603_0001052	3300046455	Bacteria	15986
276	Ga0495603_0169715	3300046455	Bacteria	1264
277	Ga0495629_0002465	3300046459	Bacteria	14198
278	Ga0495651_0320208	3300046462	Bacteria	1034
279	Ga0495653_0015389	3300046463	Bacteria	6234
280	Ga0495580_0002504	3300046472	Bacteria	16029
281	Ga0495582_0000967	3300046473	Bacteria	16054
282	Ga0495662_0261265	3300046476	Bacteria	852
283	Ga0495664_0003165	3300046477	Bacteria	8934
284	Ga0495594_0156750	3300046499	Bacteria	1293
285	Ga0495618_0002984	3300046514	Bacteria	10697
286	Ga0495628_0014332	3300046516	Bacteria	6646
287	Ga0495628_0021342	3300046516	Bacteria	5330
288	Ga0495630_0003381	3300046517	Bacteria	11113
289	Ga0495643_0000764	3300046522	Bacteria	36033
290	Ga0495648_0007471	3300046524	Bacteria	8739
291	Ga0495666_0000615	3300046526	Bacteria	16024
292	Ga0495652_0016397	3300046529	Bacteria	6629
293	Ga0495665_0015650	3300046531	Bacteria	4083
294	Ga0495640_0008367	3300046533	Bacteria	8116
295	Ga0495645_0006600	3300046543	Bacteria	8061
296	Ga0495668_0000396	3300046616	Bacteria	57340
297	Ga0495668_0050390	3300046616	Bacteria	2308
298	Ga0495668_0174739	3300046616	Bacteria	1177
299	Ga0495634_0006764	3300046642	Bacteria	8685
300	Ga0495635_0034296	3300046663	Bacteria	3520
301	Ga0495661_0002791	3300046665	Bacteria	13234
302	Ga0495588_0185120	3300046674	Bacteria	1100
303	Ga0495599_0046306	3300046678	Bacteria	2727
304	Ga0495623_0006144	3300046679	Bacteria	7806
305	Ga0495646_0001031	3300046680	Bacteria	16106
306	Ga0495613_0003042	3300046689	Bacteria	12547
307	Ga0495600_0109245	3300046809	Bacteria	1801
308	Ga0495581_0003791	3300047315	Bacteria	8699
309	Ga0495604_0007502	3300047317	Bacteria	8631
310	Ga0495674_0018840	3300047319	Bacteria	6419
311	Ga0495676_0003562	3300047321	Bacteria	14117
312	Ga0495680_0007142	3300047322	Bacteria	10288
313	Ga0495680_0187366	3300047322	Bacteria	1490
314	Ga0495679_001550	3300047446	Bacteria	12975
315	Ga0495684_0022187	3300047471	Bacteria	4888
316	Ga0495593_0001919	3300047673	Bacteria	12398
317	Ga0495602_0014738	3300048088	Bacteria	7925
318	Ga0495602_0147507	3300048088	Bacteria	1854
319	Ga0496104_0008238	3300048907	Bacteria	9257
320	Ga0496104_0205934	3300048907	Bacteria	1879
321	Ga0496105_0004259	3300048908	Bacteria	10764
322	Ga0496108_0003935	3300048911	Bacteria	11926
323	Ga0496109_0006691	3300048912	Bacteria	9705
324	Ga0496110_0085591	3300048913	Bacteria	2813
325	Ga0496112_0079792	3300048915	Bacteria	3237
326	Ga0496114_0007582	3300048917	Bacteria	8581
327	Ga0495682_0062647	3300049460	Bacteria	1342
328	Ga0501031_0000246	3300049568	Bacteria	30314
329	Ga0501031_0008577	3300049568	Bacteria	6650
330	Ga0501031_0170289	3300049568	Bacteria	1423
331	Ga0501032_0000883	3300049569	Bacteria	24330
332	Ga0501032_0003415	3300049569	Bacteria	12159
333	Ga0501032_0039012	3300049569	Bacteria	3232
334	Ga0501032_0074708	3300049569	Bacteria	2258
335	Ga0501032_0157914	3300049569	Bacteria	1489
336	Ga0501033_0003498	3300049570	Bacteria	12873
337	Ga0501033_0004326	3300049570	Bacteria	11396
338	Ga0501033_0012366	3300049570	Bacteria	6514
339	Ga0501033_0085958	3300049570	Unclassified	2303
340	Ga0501033_0120184	3300049570	Bacteria	1907
341	Ga0501034_0032150	3300049571	Bacteria	5330
342	Ga0501034_0032907	3300049571	Bacteria	5264
343	Ga0501034_0399346	3300049571	Bacteria	1298
344	Ga0501036_0005997	3300049572	Bacteria	9853
345	Ga0501036_0011717	3300049572	Bacteria	7264
346	Ga0501036_0101454	3300049572	Bacteria	2434
347	Ga0501037_0008196	3300049573	Bacteria	7659
348	Ga0501038_0009954	3300049574	Bacteria	8708
349	Ga0501038_0037555	3300049574	Bacteria	4246
350	Ga0501038_0041875	3300049574	Bacteria	3992
351	Ga0501039_0005644	3300049575	Bacteria	9475
352	Ga0501039_0233048	3300049575	Bacteria	1447
353	Ga0501039_0308337	3300049575	Bacteria	1244
354	Ga0501040_0055107	3300049576	Bacteria	2726
355	Ga0501040_0397877	3300049576	Bacteria	989
356	Ga0501041_0047891	3300049577	Bacteria	2603
357	Ga0501042_0002204	3300049578	Bacteria	11887
358	Ga0501042_0420547	3300049578	Bacteria	968
359	Ga0501043_0027491	3300049579	Bacteria	4465
360	Ga0501043_0070707	3300049579	Bacteria	2741
361	Ga0501043_0075603	3300049579	Bacteria	2645
362	Ga0501046_0000289	3300049580	Bacteria	51068
363	Ga0501046_0007919	3300049580	Bacteria	9302
364	Ga0501046_0011772	3300049580	Bacteria	7469
365	Ga0501046_0053160	3300049580	Bacteria	3190
366	Ga0501047_0002476	3300049581	Bacteria	17626
367	Ga0501047_0020512	3300049581	Bacteria	6345
368	Ga0501047_0047263	3300049581	Bacteria	4158
369	Ga0501047_0550984	3300049581	Bacteria	977
370	Ga0501048_0003433	3300049582	Bacteria	12034
371	Ga0501048_0022613	3300049582	Bacteria	4597
372	Ga0501067_0013234	3300049583	Bacteria	4567
373	Ga0501068_0002208	3300049584	Bacteria	10359
374	Ga0501068_0212885	3300049584	Bacteria	1227
375	Ga0501069_0000397	3300049585	Bacteria	19646
376	Ga0501069_0080497	3300049585	Bacteria	1834
377	Ga0501070_0050631	3300049586	Bacteria	3447
378	Ga0501070_0206344	3300049586	Bacteria	1613
379	Ga0501071_0003316	3300049587	Bacteria	10054
380	Ga0501071_0054222	3300049587	Bacteria	2893
381	Ga0501071_0549747	3300049587	Bacteria	887
382	Ga0501072_0016546	3300049588	Bacteria	5665
383	Ga0501072_0092333	3300049588	Bacteria	2404
384	Ga0501073_0007047	3300049589	Bacteria	8374
385	Ga0501073_0055179	3300049589	Bacteria	2780
386	Ga0501074_0005990	3300049590	Bacteria	8770
387	Ga0501074_0010512	3300049590	Bacteria	6718
388	Ga0501074_0199060	3300049590	Bacteria	1428
389	Ga0501075_0094120	3300049591	Bacteria	2274
390	Ga0501075_0184531	3300049591	Bacteria	1591
391	Ga0501076_0003590	3300049592	Bacteria	10899
392	Ga0501076_0005560	3300049592	Bacteria	9081
393	Ga0501076_0264415	3300049592	Bacteria	1409
394	Ga0501076_0274764	3300049592	Bacteria	1380
395	Ga0501076_0387759	3300049592	Bacteria	1148
396	Ga0501077_0059407	3300049593	Bacteria	2427
397	Ga0501077_0091300	3300049593	Bacteria	1930
398	Ga0501077_0219513	3300049593	Bacteria	1208
399	Ga0501079_0004116	3300049741	Bacteria	10759
400	Ga0501079_0076141	3300049741	Bacteria	2595
401	Ga0501079_0130343	3300049741	Bacteria	1957
402	Ga0501079_0226082	3300049741	Bacteria	1462
403	Ga0501079_0306542	3300049741	Bacteria	1242
404	Ga0501080_0006520	3300049742	Bacteria	10484
405	Ga0501080_0022223	3300049742	Bacteria	5876
406	Ga0501080_0223462	3300049742	Bacteria	1722
407	Ga0501081_0047643	3300049743	Bacteria	2949
408	Ga0501081_0095534	3300049743	Bacteria	2095
409	Ga0501083_0011029	3300049744	Bacteria	6349
410	Ga0501083_0026914	3300049744	Bacteria	3973
411	Ga0501083_0031537	3300049744	Bacteria	3638
412	Ga0501083_0040259	3300049744	Bacteria	3172
413	Ga0501083_0106733	3300049744	Bacteria	1843
414	Ga0501035_0015744	3300049822	Bacteria	6979
415	Ga0501035_0024730	3300049822	Bacteria	5506
416	Ga0501035_0028191	3300049822	Bacteria	5125
417	Ga0501035_0056690	3300049822	Bacteria	3494
418	Ga0501035_0089251	3300049822	Bacteria	2715
419	Ga0501035_0128225	3300049822	Bacteria	2213
420	Ga0501035_0610242	3300049822	Bacteria	888
421	Ga0501044_0001874	3300049823	Bacteria	24369
422	Ga0501044_0003666	3300049823	Bacteria	17285
423	Ga0501044_0007330	3300049823	Bacteria	12121
424	Ga0501044_0022304	3300049823	Bacteria	6747
425	Ga0501044_0037802	3300049823	Bacteria	5044
426	Ga0501044_0074492	3300049823	Bacteria	3448
427	Ga0501045_0011373	3300049824	Bacteria	6249
428	Ga0501045_0013840	3300049824	Bacteria	5705
429	Ga0501045_0139989	3300049824	Bacteria	1799
430	Ga0501045_0163515	3300049824	Bacteria	1657
431	nmdc:mga03n38_3406_c1	3300050490	Bacteria	5100
432	nmdc:mga00v17_32551_c1	3300050491	Bacteria	3083
433	nmdc:mga0yw44_7707_c1	3300050492	Bacteria	5315
434	nmdc:mga06z11_12138_c1	3300050494	Bacteria	3738
435	nmdc:mga04h51_25739_c1	3300050495	Bacteria	1814
436	nmdc:mga05p37_9912_c1	3300050507	Bacteria	11308
437	nmdc:mga09592_298825_c1	3300050508	Bacteria	1396
438	nmdc:mga0qj67_221890_c1	3300050509	Bacteria	1534
439	nmdc:mga0qj67_47157_c1	3300050509	Bacteria	3403
440	nmdc:mga06r32_242689_c1	3300050510	Bacteria	1789
441	nmdc:mga06r32_332749_c1	3300050510	Bacteria	1504
442	nmdc:mga06r32_531860_c1	3300050510	Bacteria	1151
443	nmdc:mga08y16_119999_c1	3300050511	Bacteria	2737
444	nmdc:mga08y16_345564_c1	3300050511	Bacteria	1529
445	nmdc:mga08y16_478275_c1	3300050511	Unclassified	1268
446	nmdc:mga0n895_215280_c1	3300050512	Bacteria	1951
447	nmdc:mga0n895_305347_c1	3300050512	Unclassified	1613
448	nmdc:mga0rr50_31236_c1	3300050513	Bacteria	3781
449	nmdc:mga0a205_11084_c2	3300050515	Bacteria	5474
450	nmdc:mga0a205_212325_c1	3300050515	Unclassified	1823
451	nmdc:mga0a205_216784_c1	3300050515	Bacteria	1801
452	nmdc:mga0a205_339208_c1	3300050515	Bacteria	1371
453	Ga0500595_001527	3300053119	Bacteria	12292
454	Ga0500577_0058131	3300053142	Bacteria	1478
455	Ga0500588_0014737	3300053146	Bacteria	1988
456	Ga0501084_0009411	3300054114	Bacteria	8085
457	Ga0501084_0140360	3300054114	Bacteria	2035
458	Ga0501084_0241280	3300054114	Bacteria	1525
459	Ga0501082_0004238	3300060353	Bacteria	12531
460	Ga0501082_0012570	3300060353	Bacteria	7274
461	Ga0501082_0271158	3300060353	Bacteria	1477
462	Ga0501082_0507756	3300060353	Bacteria	1054
463	Ga0501082_0615353	3300060353	Bacteria	950

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300013306	Ga0163162_10108329	Ga0163162_101083292	200
2	3300045051	Ga0451576_1376690	Ga0451576_1376690_52_657	201
3	3300035114	Ga0373939_0210239	Ga0373939_0210239_100_729	209
4	3300049581	Ga0501047_0550984	Ga0501047_0550984_66_731	217
5	3300006846	Ga0075430_100299706	Ga0075430_1002997062	221
6	3300006038	Ga0075365_10004636	Ga0075365_100046365	224
7	3300006042	Ga0075368_10004888	Ga0075368_100048881	224
8	3300006048	Ga0075363_100032463	Ga0075363_1000324633	224
9	3300006051	Ga0075364_10003587	Ga0075364_1000358710	224
10	3300006178	Ga0075367_10001290	Ga0075367_100012903	224
11	3300026116	Ga0207674_10584610	Ga0207674_105846102	224
12	3300027866	Ga0209813_10030798	Ga0209813_100307983	224
13	3300050490	nmdc:mga03n38_3406_c1	nmdc:mga03n38_3406_c1_2710_3462	224
14	3300050491	nmdc:mga00v17_32551_c1	nmdc:mga00v17_32551_c1_2182_2934	224
15	3300050492	nmdc:mga0yw44_7707_c1	nmdc:mga0yw44_7707_c1_863_1615	224
16	3300050494	nmdc:mga06z11_12138_c1	nmdc:mga06z11_12138_c1_2308_3060	224
17	3300050495	nmdc:mga04h51_25739_c1	nmdc:mga04h51_25739_c1_56_808	224
18	3300046616	Ga0495668_0050390	Ga0495668_0050390_1243_2097	225
19	3300005355	Ga0070671_100017483	Ga0070671_1000174832	226
20	3300006852	Ga0075433_10035358	Ga0075433_100353583	226
21	3300006852	Ga0075433_10082738	Ga0075433_100827383	226
22	3300006871	Ga0075434_100121080	Ga0075434_1001210803	226
23	3300007076	Ga0075435_100098892	Ga0075435_1000988922	226
24	3300025931	Ga0207644_10199279	Ga0207644_101992792	226
25	3300050513	nmdc:mga0rr50_31236_c1	nmdc:mga0rr50_31236_c1_2588_3340	226
26	3300005330	Ga0070690_100249445	Ga0070690_1002494451	227
27	3300046462	Ga0495651_0320208	Ga0495651_0320208_219_1019	227
28	3300049580	Ga0501046_0000289	Ga0501046_0000289_37005_37760	228
29	3300021388	Ga0213875_10030723	Ga0213875_100307233	230
30	3300037853	Ga0436364_0746224	Ga0436364_0746224_17311_18030	230
31	3300049822	Ga0501035_0015744	Ga0501035_0015744_6095_6850	230
32	3300005444	Ga0070694_100165685	Ga0070694_1001656852	231
33	3300005329	Ga0070683_100065098	Ga0070683_1000650981	232
34	3300025944	Ga0207661_10293700	Ga0207661_102937002	232
35	3300049569	Ga0501032_0000883	Ga0501032_0000883_15901_16656	232
36	3300049580	Ga0501046_0007919	Ga0501046_0007919_873_1628	232
37	3300049581	Ga0501047_0047263	Ga0501047_0047263_3365_4120	232
38	3300049823	Ga0501044_0001874	Ga0501044_0001874_7687_8442	232
39	3300028563	Ga0265319_1001925	Ga0265319_10019254	233
40	3300031240	Ga0265320_10000365	Ga0265320_1000036534	233
41	3300048911	Ga0496108_0003935	Ga0496108_0003935_3658_4410	234
42	3300049576	Ga0501040_0055107	Ga0501040_0055107_841_1608	234
43	3300049577	Ga0501041_0047891	Ga0501041_0047891_172_939	234
44	3300049591	Ga0501075_0184531	Ga0501075_0184531_142_909	234
45	3300049592	Ga0501076_0387759	Ga0501076_0387759_360_1127	234
46	3300049743	Ga0501081_0095534	Ga0501081_0095534_1246_2013	234
47	3300049824	Ga0501045_0011373	Ga0501045_0011373_2370_3137	234
48	3300048907	Ga0496104_0008238	Ga0496104_0008238_5193_5996	235
49	3300048908	Ga0496105_0004259	Ga0496105_0004259_1131_1934	235
50	3300048912	Ga0496109_0006691	Ga0496109_0006691_2916_3719	235
51	3300048913	Ga0496110_0085591	Ga0496110_0085591_73_876	235
52	3300048915	Ga0496112_0079792	Ga0496112_0079792_1710_2513	235
53	3300006844	Ga0075428_100190781	Ga0075428_1001907812	236
54	3300006846	Ga0075430_100103940	Ga0075430_1001039403	236
55	3300028577	Ga0265318_10000121	Ga0265318_1000012146	236
56	3300031235	Ga0265330_10015393	Ga0265330_100153933	236
57	3300031239	Ga0265328_10000395	Ga0265328_1000039517	236
58	3300031240	Ga0265320_10007920	Ga0265320_100079206	236
59	3300031242	Ga0265329_10000137	Ga0265329_1000013715	236
60	3300031249	Ga0265339_10006051	Ga0265339_100060518	236
61	3300031250	Ga0265331_10005329	Ga0265331_100053293	236
62	3300031251	Ga0265327_10000921	Ga0265327_1000092114	236
63	3300031344	Ga0265316_10004592	Ga0265316_100045927	236
64	3300031712	Ga0265342_10008013	Ga0265342_100080136	236
65	3300046499	Ga0495594_0156750	Ga0495594_0156750_10_735	237
66	3300028556	Ga0265337_1002962	Ga0265337_10029623	238
67	3300031240	Ga0265320_10003716	Ga0265320_100037164	238
68	3300031548	Ga0307408_100020746	Ga0307408_1000207464	238
69	3300005354	Ga0070675_100221496	Ga0070675_1002214963	239
70	3300005365	Ga0070688_100219665	Ga0070688_1002196651	239
71	3300005844	Ga0068862_100332670	Ga0068862_1003326702	239
72	3300014325	Ga0163163_10020026	Ga0163163_100200264	239
73	3300049575	Ga0501039_0233048	Ga0501039_0233048_548_1315	239
74	3300049576	Ga0501040_0397877	Ga0501040_0397877_32_799	239
75	3300049588	Ga0501072_0016546	Ga0501072_0016546_4197_4964	239
76	3300049592	Ga0501076_0003590	Ga0501076_0003590_3841_4608	239
77	3300049743	Ga0501081_0047643	Ga0501081_0047643_1755_2522	239
78	3300049824	Ga0501045_0163515	Ga0501045_0163515_481_1248	239
79	3300050515	nmdc:mga0a205_339208_c1	nmdc:mga0a205_339208_c1_540_1328	239
80	3300005331	Ga0070670_100013598	Ga0070670_1000135987	240
81	3300005539	Ga0068853_100764237	Ga0068853_1007642371	240
82	3300006844	Ga0075428_100043719	Ga0075428_1000437194	240
83	3300006852	Ga0075433_10217993	Ga0075433_102179932	240
84	3300006871	Ga0075434_100231746	Ga0075434_1002317462	240
85	3300009093	Ga0105240_10007171	Ga0105240_1000717114	240
86	3300009545	Ga0105237_10017521	Ga0105237_100175213	240
87	3300009551	Ga0105238_10034715	Ga0105238_100347153	240
88	3300010375	Ga0105239_10000609	Ga0105239_1000060936	240
89	3300011119	Ga0105246_10014273	Ga0105246_100142733	240
90	3300025908	Ga0207643_10009723	Ga0207643_100097232	240
91	3300025913	Ga0207695_10044224	Ga0207695_100442243	240
92	3300025914	Ga0207671_10092136	Ga0207671_100921363	240
93	3300025923	Ga0207681_10163933	Ga0207681_101639332	240
94	3300025940	Ga0207691_10231910	Ga0207691_102319103	240
95	3300026023	Ga0207677_10044708	Ga0207677_100447082	240
96	3300005563	Ga0068855_100153153	Ga0068855_1001531532	242
97	3300009093	Ga0105240_10365462	Ga0105240_103654622	242
98	3300013105	Ga0157369_10530800	Ga0157369_105308002	242
99	3300013307	Ga0157372_10578178	Ga0157372_105781782	242
100	3300013307	Ga0157372_10915126	Ga0157372_109151261	242
101	3300026142	Ga0207698_10721871	Ga0207698_107218712	242
102	3300049744	Ga0501083_0040259	Ga0501083_0040259_2312_3085	242
103	iso_pu_bacteria	2842324504	2842325831	242
104	iso_pu_bacteria	2842348783	2842350110	242
105	iso_pu_bacteria	2842454564	2842454694	242
106	3300013105	Ga0157369_10188169	Ga0157369_101881692	243
107	3300031251	Ga0265327_10135403	Ga0265327_101354032	243
108	3300039453	Ga0436362_0076657	Ga0436362_0076657_390_1139	243
109	3300049571	Ga0501034_0399346	Ga0501034_0399346_284_1060	244
110	3300005367	Ga0070667_100149954	Ga0070667_1001499543	245
111	3300005548	Ga0070665_100002241	Ga0070665_1000022416	245
112	3300009093	Ga0105240_10115095	Ga0105240_101150952	245
113	3300009093	Ga0105240_10188306	Ga0105240_101883062	245
114	3300009094	Ga0111539_10435979	Ga0111539_104359792	245
115	3300009177	Ga0105248_10467215	Ga0105248_104672152	245
116	3300009545	Ga0105237_10174606	Ga0105237_101746061	245
117	3300010375	Ga0105239_10068556	Ga0105239_100685563	245
118	3300025924	Ga0207694_10000679	Ga0207694_100006792	245
119	3300028379	Ga0268266_10001221	Ga0268266_1000122120	245
120	3300037312	Ga0395899_0026175	Ga0395899_0026175_340_1092	245
121	3300037418	Ga0395900_0148308	Ga0395900_0148308_438_1190	245
122	3300050511	nmdc:mga08y16_345564_c1	nmdc:mga08y16_345564_c1_320_1078	245
123	3300053119	Ga0500595_001527	Ga0500595_001527_7935_8687	245
124	3300053146	Ga0500588_0014737	Ga0500588_0014737_783_1538	245
125	3300005340	Ga0070689_100226108	Ga0070689_1002261082	246
126	3300005340	Ga0070689_100330004	Ga0070689_1003300041	246
127	3300005341	Ga0070691_10197103	Ga0070691_101971032	246
128	3300005435	Ga0070714_100004483	Ga0070714_1000044832	246
129	3300005563	Ga0068855_100127159	Ga0068855_1001271592	246
130	3300005563	Ga0068855_100162877	Ga0068855_1001628772	246
131	3300005614	Ga0068856_100000425	Ga0068856_10000042522	246
132	3300005614	Ga0068856_100081924	Ga0068856_1000819243	246
133	3300005617	Ga0068859_100311450	Ga0068859_1003114502	246
134	3300005617	Ga0068859_100375491	Ga0068859_1003754911	246
135	3300006175	Ga0070712_100145253	Ga0070712_1001452532	246
136	3300006871	Ga0075434_100428920	Ga0075434_1004289201	246
137	3300006931	Ga0097620_100311448	Ga0097620_1003114482	246
138	3300006931	Ga0097620_100375484	Ga0097620_1003754842	246
139	3300009093	Ga0105240_10022851	Ga0105240_100228515	246
140	3300009093	Ga0105240_10032800	Ga0105240_100328004	246
141	3300009093	Ga0105240_10645753	Ga0105240_106457532	246
142	3300009098	Ga0105245_10745931	Ga0105245_107459311	246
143	3300009176	Ga0105242_10366093	Ga0105242_103660932	246
144	3300009551	Ga0105238_10001970	Ga0105238_100019709	246
145	3300021388	Ga0213875_10017029	Ga0213875_100170294	246
146	3300025913	Ga0207695_10022759	Ga0207695_100227595	246
147	3300025913	Ga0207695_10499899	Ga0207695_104998992	246
148	3300025924	Ga0207694_10003280	Ga0207694_100032804	246
149	3300025936	Ga0207670_10137483	Ga0207670_101374832	246
150	3300026078	Ga0207702_10000935	Ga0207702_1000093516	246
151	3300026078	Ga0207702_10012941	Ga0207702_100129413	246
152	3300026078	Ga0207702_10660480	Ga0207702_106604801	246
153	3300028017	Ga0265356_1006323	Ga0265356_10063232	246
154	3300028800	Ga0265338_10007795	Ga0265338_100077958	246
155	3300028800	Ga0265338_10040221	Ga0265338_100402214	246
156	3300028800	Ga0265338_10298869	Ga0265338_102988692	246
157	3300029957	Ga0265324_10051915	Ga0265324_100519152	246
158	3300031247	Ga0265340_10002293	Ga0265340_100022933	246
159	3300031249	Ga0265339_10015809	Ga0265339_100158092	246
160	3300031251	Ga0265327_10000634	Ga0265327_1000063418	246
161	3300031548	Ga0307408_100002543	Ga0307408_1000025438	246
162	3300031731	Ga0307405_10022729	Ga0307405_100227293	246
163	3300036401	Ga0373937_0382575	Ga0373937_0382575_218_958	246
164	3300037853	Ga0436364_1457976	Ga0436364_1457976_1977_2729	246
165	3300044693	Ga0466961_0000755	Ga0466961_0000755_17586_18338	246
166	3300045051	Ga0451576_0116120	Ga0451576_0116120_1520_2260	246
167	3300045051	Ga0451576_0435801	Ga0451576_0435801_451_1191	246
168	3300046455	Ga0495603_0169715	Ga0495603_0169715_134_886	246
169	3300046516	Ga0495628_0021342	Ga0495628_0021342_609_1361	246
170	3300049460	Ga0495682_0062647	Ga0495682_0062647_430_1188	246
171	3300049568	Ga0501031_0000246	Ga0501031_0000246_25624_26364	246
172	3300049568	Ga0501031_0170289	Ga0501031_0170289_375_1115	246
173	3300049569	Ga0501032_0003415	Ga0501032_0003415_2651_3391	246
174	3300049569	Ga0501032_0157914	Ga0501032_0157914_306_1046	246
175	3300049570	Ga0501033_0085958	Ga0501033_0085958_752_1549	246
176	3300049570	Ga0501033_0120184	Ga0501033_0120184_885_1625	246
177	3300049579	Ga0501043_0027491	Ga0501043_0027491_3448_4188	246
178	3300049581	Ga0501047_0020512	Ga0501047_0020512_3218_3958	246
179	3300049822	Ga0501035_0024730	Ga0501035_0024730_2355_3095	246
180	3300049822	Ga0501035_0089251	Ga0501035_0089251_1842_2582	246
181	3300049822	Ga0501035_0128225	Ga0501035_0128225_46_858	246
182	3300049822	Ga0501035_0610242	Ga0501035_0610242_51_791	246
183	3300049823	Ga0501044_0003666	Ga0501044_0003666_9152_9892	246
184	3300049823	Ga0501044_0007330	Ga0501044_0007330_7400_8140	246
185	3300049823	Ga0501044_0022304	Ga0501044_0022304_4541_5281	246
186	3300006846	Ga0075430_100229101	Ga0075430_1002291011	247
187	3300006847	Ga0075431_100067799	Ga0075431_1000677994	247
188	3300014325	Ga0163163_10265227	Ga0163163_102652272	247
189	3300026089	Ga0207648_10318745	Ga0207648_103187452	247
190	3300032002	Ga0307416_100252062	Ga0307416_1002520622	247
191	3300046454	Ga0495592_0067317	Ga0495592_0067317_762_1565	247
192	3300046455	Ga0495603_0001052	Ga0495603_0001052_5779_6582	247
193	3300046459	Ga0495629_0002465	Ga0495629_0002465_9400_10203	247
194	3300046463	Ga0495653_0015389	Ga0495653_0015389_1501_2304	247
195	3300046472	Ga0495580_0002504	Ga0495580_0002504_5779_6582	247
196	3300046473	Ga0495582_0000967	Ga0495582_0000967_5730_6533	247
197	3300046476	Ga0495662_0261265	Ga0495662_0261265_17_820	247
198	3300046477	Ga0495664_0003165	Ga0495664_0003165_2418_3221	247
199	3300046514	Ga0495618_0002984	Ga0495618_0002984_259_1062	247
200	3300046516	Ga0495628_0014332	Ga0495628_0014332_5779_6582	247
201	3300046517	Ga0495630_0003381	Ga0495630_0003381_8006_8809	247
202	3300046524	Ga0495648_0007471	Ga0495648_0007471_2226_3029	247
203	3300046526	Ga0495666_0000615	Ga0495666_0000615_9447_10250	247
204	3300046529	Ga0495652_0016397	Ga0495652_0016397_1228_2031	247
205	3300046531	Ga0495665_0015650	Ga0495665_0015650_1525_2328	247
206	3300046533	Ga0495640_0008367	Ga0495640_0008367_2065_2868	247
207	3300046543	Ga0495645_0006600	Ga0495645_0006600_5762_6565	247
208	3300046616	Ga0495668_0000396	Ga0495668_0000396_34634_35389	247
209	3300046642	Ga0495634_0006764	Ga0495634_0006764_5658_6461	247
210	3300046663	Ga0495635_0034296	Ga0495635_0034296_2138_2941	247
211	3300046665	Ga0495661_0002791	Ga0495661_0002791_5690_6493	247
212	3300046674	Ga0495588_0185120	Ga0495588_0185120_274_1077	247
213	3300046678	Ga0495599_0046306	Ga0495599_0046306_48_851	247
214	3300046679	Ga0495623_0006144	Ga0495623_0006144_2418_3221	247
215	3300046680	Ga0495646_0001031	Ga0495646_0001031_5771_6574	247
216	3300046689	Ga0495613_0003042	Ga0495613_0003042_6742_7545	247
217	3300046809	Ga0495600_0109245	Ga0495600_0109245_964_1767	247
218	3300047315	Ga0495581_0003791	Ga0495581_0003791_5772_6575	247
219	3300047317	Ga0495604_0007502	Ga0495604_0007502_2222_3025	247
220	3300047319	Ga0495674_0018840	Ga0495674_0018840_4244_5047	247
221	3300047321	Ga0495676_0003562	Ga0495676_0003562_7581_8384	247
222	3300047322	Ga0495680_0007142	Ga0495680_0007142_38_841	247
223	3300047446	Ga0495679_001550	Ga0495679_001550_5779_6582	247
224	3300047471	Ga0495684_0022187	Ga0495684_0022187_3313_4116	247
225	3300047673	Ga0495593_0001919	Ga0495593_0001919_8220_9023	247
226	3300048088	Ga0495602_0014738	Ga0495602_0014738_5750_6553	247
227	3300050509	nmdc:mga0qj67_221890_c1	nmdc:mga0qj67_221890_c1_538_1281	247
228	3300050510	nmdc:mga06r32_531860_c1	nmdc:mga06r32_531860_c1_56_799	247
229	3300005435	Ga0070714_100053299	Ga0070714_1000532994	248
230	3300005544	Ga0070686_100000784	Ga0070686_1000007849	248
231	3300025929	Ga0207664_10146771	Ga0207664_101467712	248
232	3300042436	Ga0439435_0000547	Ga0439435_0000547_1408_2166	248
233	3300006846	Ga0075430_100026907	Ga0075430_1000269074	249
234	3300006852	Ga0075433_10068664	Ga0075433_100686643	249
235	3300025936	Ga0207670_10101679	Ga0207670_101016792	249
236	3300049575	Ga0501039_0308337	Ga0501039_0308337_442_1221	249
237	3300049578	Ga0501042_0420547	Ga0501042_0420547_72_851	249
238	3300049582	Ga0501048_0022613	Ga0501048_0022613_1637_2416	249
239	3300049587	Ga0501071_0054222	Ga0501071_0054222_729_1508	249
240	3300049588	Ga0501072_0092333	Ga0501072_0092333_523_1302	249
241	3300049590	Ga0501074_0199060	Ga0501074_0199060_522_1301	249
242	3300049591	Ga0501075_0094120	Ga0501075_0094120_729_1508	249
243	3300049592	Ga0501076_0005560	Ga0501076_0005560_7109_7888	249
244	3300049592	Ga0501076_0264415	Ga0501076_0264415_375_1127	249
245	3300049593	Ga0501077_0059407	Ga0501077_0059407_864_1616	249
246	3300049593	Ga0501077_0219513	Ga0501077_0219513_24_797	249
247	3300049741	Ga0501079_0130343	Ga0501079_0130343_1087_1839	249
248	3300049741	Ga0501079_0226082	Ga0501079_0226082_164_943	249
249	3300049824	Ga0501045_0139989	Ga0501045_0139989_129_908	249
250	3300050509	nmdc:mga0qj67_47157_c1	nmdc:mga0qj67_47157_c1_834_1586	249
251	3300050515	nmdc:mga0a205_11084_c2	nmdc:mga0a205_11084_c2_4161_4913	249
252	3300054114	Ga0501084_0140360	Ga0501084_0140360_1269_2021	249
253	3300060353	Ga0501082_0271158	Ga0501082_0271158_96_848	249
254	3300005353	Ga0070669_100068458	Ga0070669_1000684582	250
255	3300005356	Ga0070674_100018176	Ga0070674_1000181763	250
256	3300005364	Ga0070673_100243284	Ga0070673_1002432842	250
257	3300005438	Ga0070701_10132746	Ga0070701_101327461	250
258	3300005444	Ga0070694_100564542	Ga0070694_1005645421	250
259	3300005543	Ga0070672_100081935	Ga0070672_1000819352	250
260	3300005543	Ga0070672_100202579	Ga0070672_1002025792	250
261	3300005544	Ga0070686_100131737	Ga0070686_1001317372	250
262	3300005564	Ga0070664_100345187	Ga0070664_1003451872	250
263	3300005577	Ga0068857_100024911	Ga0068857_1000249113	250
264	3300005618	Ga0068864_100024029	Ga0068864_1000240293	250
265	3300005840	Ga0068870_10007354	Ga0068870_100073542	250
266	3300005841	Ga0068863_100046444	Ga0068863_1000464444	250
267	3300005843	Ga0068860_100425522	Ga0068860_1004255223	250
268	3300006847	Ga0075431_100152779	Ga0075431_1001527792	250
269	3300006852	Ga0075433_10353612	Ga0075433_103536121	250
270	3300009094	Ga0111539_10000364	Ga0111539_1000036433	250
271	3300009094	Ga0111539_10103695	Ga0111539_101036952	250
272	3300009094	Ga0111539_10727018	Ga0111539_107270181	250
273	3300009147	Ga0114129_10090403	Ga0114129_100904032	250
274	3300013297	Ga0157378_10082678	Ga0157378_100826783	250
275	3300013297	Ga0157378_10183820	Ga0157378_101838202	250
276	3300014745	Ga0157377_10018006	Ga0157377_100180062	250
277	3300025940	Ga0207691_10333142	Ga0207691_103331422	250
278	3300025960	Ga0207651_10176541	Ga0207651_101765412	250
279	3300026088	Ga0207641_10120536	Ga0207641_101205361	250
280	3300026116	Ga0207674_10087205	Ga0207674_100872053	250
281	3300042876	Ga0451577_0320385	Ga0451577_0320385_220_987	250
282	3300046522	Ga0495643_0000764	Ga0495643_0000764_26142_26906	250
283	3300050507	nmdc:mga05p37_9912_c1	nmdc:mga05p37_9912_c1_3198_3950	250
284	3300050510	nmdc:mga06r32_242689_c1	nmdc:mga06r32_242689_c1_417_1181	250
285	3300050511	nmdc:mga08y16_119999_c1	nmdc:mga08y16_119999_c1_1006_1782	250
286	3300050511	nmdc:mga08y16_478275_c1	nmdc:mga08y16_478275_c1_118_870	250
287	3300050512	nmdc:mga0n895_215280_c1	nmdc:mga0n895_215280_c1_435_1187	250
288	3300050512	nmdc:mga0n895_305347_c1	nmdc:mga0n895_305347_c1_502_1254	250
289	3300050515	nmdc:mga0a205_212325_c1	nmdc:mga0a205_212325_c1_886_1638	250
290	3300050515	nmdc:mga0a205_216784_c1	nmdc:mga0a205_216784_c1_553_1305	250
291	3300060353	Ga0501082_0507756	Ga0501082_0507756_123_887	250
292	3300003323	rootH1_10255670	rootH1_102556703	251
293	3300005331	Ga0070670_100075859	Ga0070670_1000758593	251
294	3300005335	Ga0070666_10006530	Ga0070666_100065305	251
295	3300005365	Ga0070688_100229528	Ga0070688_1002295282	251
296	3300005367	Ga0070667_100300723	Ga0070667_1003007232	251
297	3300005436	Ga0070713_100527908	Ga0070713_1005279081	251
298	3300005455	Ga0070663_100145173	Ga0070663_1001451732	251
299	3300005455	Ga0070663_100367270	Ga0070663_1003672702	251
300	3300005457	Ga0070662_100070759	Ga0070662_1000707593	251
301	3300005458	Ga0070681_10141428	Ga0070681_101414282	251
302	3300005466	Ga0070685_10006842	Ga0070685_100068425	251
303	3300005471	Ga0070698_100196798	Ga0070698_1001967981	251
304	3300005539	Ga0068853_100000003	Ga0068853_10000000345	251
305	3300005539	Ga0068853_100013765	Ga0068853_1000137655	251
306	3300005548	Ga0070665_100003080	Ga0070665_1000030803	251
307	3300005563	Ga0068855_100636133	Ga0068855_1006361331	251
308	3300005563	Ga0068855_100863946	Ga0068855_1008639462	251
309	3300005616	Ga0068852_100106436	Ga0068852_1001064363	251
310	3300005617	Ga0068859_100514488	Ga0068859_1005144882	251
311	3300005834	Ga0068851_10011789	Ga0068851_100117894	251
312	3300005841	Ga0068863_100251408	Ga0068863_1002514082	251
313	3300005841	Ga0068863_100409487	Ga0068863_1004094872	251
314	3300005842	Ga0068858_100000775	Ga0068858_1000007758	251
315	3300006846	Ga0075430_100016405	Ga0075430_1000164055	251
316	3300006847	Ga0075431_100238286	Ga0075431_1002382862	251
317	3300006931	Ga0097620_100514523	Ga0097620_1005145232	251
318	3300009093	Ga0105240_10001760	Ga0105240_100017601	251
319	3300009093	Ga0105240_10220068	Ga0105240_102200683	251
320	3300009093	Ga0105240_10242599	Ga0105240_102425992	251
321	3300009093	Ga0105240_10243775	Ga0105240_102437752	251
322	3300009093	Ga0105240_10510793	Ga0105240_105107932	251
323	3300009098	Ga0105245_10212390	Ga0105245_102123902	251
324	3300009176	Ga0105242_10574178	Ga0105242_105741782	251
325	3300009545	Ga0105237_10008498	Ga0105237_1000849812	251
326	3300009545	Ga0105237_10038276	Ga0105237_100382765	251
327	3300009545	Ga0105237_10072025	Ga0105237_100720252	251
328	3300009545	Ga0105237_10580155	Ga0105237_105801552	251
329	3300009551	Ga0105238_10001990	Ga0105238_1000199011	251
330	3300009551	Ga0105238_10095008	Ga0105238_100950083	251
331	3300009553	Ga0105249_10072438	Ga0105249_100724383	251
332	3300009553	Ga0105249_10114153	Ga0105249_101141533	251
333	3300010375	Ga0105239_10000497	Ga0105239_1000049717	251
334	3300010375	Ga0105239_10002790	Ga0105239_1000279014	251
335	3300013296	Ga0157374_10071423	Ga0157374_100714235	251
336	3300013296	Ga0157374_10513831	Ga0157374_105138311	251
337	3300014325	Ga0163163_10321571	Ga0163163_103215712	251
338	3300021384	Ga0213876_10047398	Ga0213876_100473983	251
339	3300021388	Ga0213875_10000022	Ga0213875_1000002293	251
340	3300025261	Ga0209233_1001033	Ga0209233_10010336	251
341	3300025321	Ga0207656_10004590	Ga0207656_100045902	251
342	3300025903	Ga0207680_10065109	Ga0207680_100651092	251
343	3300025904	Ga0207647_10000083	Ga0207647_1000008315	251
344	3300025909	Ga0207705_10154512	Ga0207705_101545121	251
345	3300025911	Ga0207654_10096343	Ga0207654_100963432	251
346	3300025913	Ga0207695_10000498	Ga0207695_1000049829	251
347	3300025913	Ga0207695_10054970	Ga0207695_100549704	251
348	3300025913	Ga0207695_10204302	Ga0207695_102043022	251
349	3300025913	Ga0207695_10272789	Ga0207695_102727892	251
350	3300025914	Ga0207671_10034920	Ga0207671_100349204	251
351	3300025914	Ga0207671_10071677	Ga0207671_100716773	251
352	3300025914	Ga0207671_10242294	Ga0207671_102422942	251
353	3300025924	Ga0207694_10000382	Ga0207694_1000038226	251
354	3300025924	Ga0207694_10001796	Ga0207694_1000179610	251
355	3300025927	Ga0207687_10186237	Ga0207687_101862372	251
356	3300025933	Ga0207706_10009484	Ga0207706_100094846	251
357	3300025940	Ga0207691_10170303	Ga0207691_101703032	251
358	3300025949	Ga0207667_10752514	Ga0207667_107525142	251
359	3300025960	Ga0207651_10153173	Ga0207651_101531732	251
360	3300025961	Ga0207712_10000461	Ga0207712_100004617	251
361	3300025986	Ga0207658_10002212	Ga0207658_100022124	251
362	3300026035	Ga0207703_10010031	Ga0207703_100100314	251
363	3300026041	Ga0207639_10000002	Ga0207639_10000002413	251
364	3300026041	Ga0207639_10000996	Ga0207639_100009968	251
365	3300026041	Ga0207639_10044485	Ga0207639_100444852	251
366	3300026067	Ga0207678_10209172	Ga0207678_102091722	251
367	3300026075	Ga0207708_10405577	Ga0207708_104055771	251
368	3300026078	Ga0207702_10343412	Ga0207702_103434122	251
369	3300026089	Ga0207648_10131834	Ga0207648_101318342	251
370	3300026116	Ga0207674_10156566	Ga0207674_101565662	251
371	3300026142	Ga0207698_10133114	Ga0207698_101331142	251
372	3300028379	Ga0268266_10000008	Ga0268266_10000008734	251
373	3300028563	Ga0265319_1000824	Ga0265319_10008249	251
374	3300028563	Ga0265319_1011644	Ga0265319_10116443	251
375	3300028563	Ga0265319_1074800	Ga0265319_10748001	251
376	3300028577	Ga0265318_10001306	Ga0265318_1000130610	251
377	3300028800	Ga0265338_10052481	Ga0265338_100524813	251
378	3300029957	Ga0265324_10000065	Ga0265324_1000006572	251
379	3300031240	Ga0265320_10005370	Ga0265320_100053706	251
380	3300031240	Ga0265320_10007887	Ga0265320_100078873	251
381	3300031240	Ga0265320_10103401	Ga0265320_101034011	251
382	3300031240	Ga0265320_10178569	Ga0265320_101785692	251
383	3300031249	Ga0265339_10000005	Ga0265339_10000005193	251
384	3300031344	Ga0265316_10006411	Ga0265316_100064115	251
385	3300031595	Ga0265313_10000342	Ga0265313_1000034215	251
386	3300031595	Ga0265313_10039407	Ga0265313_100394072	251
387	3300031595	Ga0265313_10130321	Ga0265313_101303212	251
388	3300031616	Ga0307508_10000100	Ga0307508_1000010058	251
389	3300031712	Ga0265342_10000097	Ga0265342_1000009771	251
390	3300036401	Ga0373937_0087766	Ga0373937_0087766_732_1496	251
391	3300036401	Ga0373937_0194622	Ga0373937_0194622_799_1566	251
392	3300036401	Ga0373937_0223194	Ga0373937_0223194_233_997	251
393	3300037853	Ga0436364_0530951	Ga0436364_0530951_85222_85992	251
394	3300039437	Ga0436365_1474640	Ga0436365_1474640_1390_2151	251
395	3300039447	Ga0436361_0185253	Ga0436361_0185253_88_855	251
396	3300041505	Ga0451849_0480331	Ga0451849_0480331_1820_2581	251
397	3300041511	Ga0451855_1234120	Ga0451855_1234120_24_785	251
398	3300041512	Ga0451853_0095766	Ga0451853_0095766_10120_10881	251
399	3300045051	Ga0451576_0077319	Ga0451576_0077319_872_1636	251
400	3300045051	Ga0451576_0960258	Ga0451576_0960258_109_885	251
401	3300046616	Ga0495668_0174739	Ga0495668_0174739_330_1097	251
402	3300047322	Ga0495680_0187366	Ga0495680_0187366_72_839	251
403	3300048088	Ga0495602_0147507	Ga0495602_0147507_474_1241	251
404	3300048907	Ga0496104_0205934	Ga0496104_0205934_589_1362	251
405	3300048917	Ga0496114_0007582	Ga0496114_0007582_579_1343	251
406	3300049568	Ga0501031_0008577	Ga0501031_0008577_5376_6146	251
407	3300049569	Ga0501032_0039012	Ga0501032_0039012_1744_2514	251
408	3300049569	Ga0501032_0074708	Ga0501032_0074708_1074_1844	251
409	3300049570	Ga0501033_0003498	Ga0501033_0003498_9597_10367	251
410	3300049570	Ga0501033_0004326	Ga0501033_0004326_276_1046	251
411	3300049570	Ga0501033_0012366	Ga0501033_0012366_5384_6154	251
412	3300049571	Ga0501034_0032150	Ga0501034_0032150_4223_4993	251
413	3300049571	Ga0501034_0032907	Ga0501034_0032907_1911_2681	251
414	3300049572	Ga0501036_0005997	Ga0501036_0005997_3538_4308	251
415	3300049572	Ga0501036_0011717	Ga0501036_0011717_1198_1968	251
416	3300049572	Ga0501036_0101454	Ga0501036_0101454_680_1450	251
417	3300049573	Ga0501037_0008196	Ga0501037_0008196_4074_4844	251
418	3300049574	Ga0501038_0009954	Ga0501038_0009954_1200_1970	251
419	3300049574	Ga0501038_0037555	Ga0501038_0037555_1276_2046	251
420	3300049574	Ga0501038_0041875	Ga0501038_0041875_2550_3320	251
421	3300049575	Ga0501039_0005644	Ga0501039_0005644_1329_2099	251
422	3300049578	Ga0501042_0002204	Ga0501042_0002204_9103_9873	251
423	3300049579	Ga0501043_0070707	Ga0501043_0070707_316_1086	251
424	3300049579	Ga0501043_0075603	Ga0501043_0075603_543_1313	251
425	3300049580	Ga0501046_0011772	Ga0501046_0011772_1946_2716	251
426	3300049580	Ga0501046_0053160	Ga0501046_0053160_1059_1829	251
427	3300049581	Ga0501047_0002476	Ga0501047_0002476_12103_12873	251
428	3300049582	Ga0501048_0003433	Ga0501048_0003433_1004_1774	251
429	3300049583	Ga0501067_0013234	Ga0501067_0013234_595_1365	251
430	3300049584	Ga0501068_0002208	Ga0501068_0002208_8281_9051	251
431	3300049584	Ga0501068_0212885	Ga0501068_0212885_201_962	251
432	3300049585	Ga0501069_0000397	Ga0501069_0000397_13419_14189	251
433	3300049585	Ga0501069_0080497	Ga0501069_0080497_38_808	251
434	3300049586	Ga0501070_0050631	Ga0501070_0050631_2135_2905	251
435	3300049586	Ga0501070_0206344	Ga0501070_0206344_11_781	251
436	3300049587	Ga0501071_0003316	Ga0501071_0003316_2525_3295	251
437	3300049587	Ga0501071_0549747	Ga0501071_0549747_84_854	251
438	3300049589	Ga0501073_0007047	Ga0501073_0007047_5297_6067	251
439	3300049589	Ga0501073_0055179	Ga0501073_0055179_1086_1856	251
440	3300049590	Ga0501074_0005990	Ga0501074_0005990_2773_3543	251
441	3300049590	Ga0501074_0010512	Ga0501074_0010512_4195_4965	251
442	3300049592	Ga0501076_0274764	Ga0501076_0274764_369_1139	251
443	3300049593	Ga0501077_0091300	Ga0501077_0091300_653_1423	251
444	3300049741	Ga0501079_0004116	Ga0501079_0004116_1473_2243	251
445	3300049741	Ga0501079_0076141	Ga0501079_0076141_592_1362	251
446	3300049741	Ga0501079_0306542	Ga0501079_0306542_424_1194	251
447	3300049742	Ga0501080_0006520	Ga0501080_0006520_7293_8063	251
448	3300049742	Ga0501080_0022223	Ga0501080_0022223_1074_1844	251
449	3300049742	Ga0501080_0223462	Ga0501080_0223462_361_1131	251
450	3300049744	Ga0501083_0011029	Ga0501083_0011029_3859_4629	251
451	3300049744	Ga0501083_0026914	Ga0501083_0026914_125_898	251
452	3300049744	Ga0501083_0031537	Ga0501083_0031537_2797_3567	251
453	3300049744	Ga0501083_0106733	Ga0501083_0106733_206_976	251
454	3300049822	Ga0501035_0028191	Ga0501035_0028191_1074_1844	251
455	3300049822	Ga0501035_0056690	Ga0501035_0056690_1234_2004	251
456	3300049823	Ga0501044_0037802	Ga0501044_0037802_592_1362	251
457	3300049823	Ga0501044_0074492	Ga0501044_0074492_2136_2906	251
458	3300049824	Ga0501045_0013840	Ga0501045_0013840_1199_1969	251
459	3300050508	nmdc:mga09592_298825_c1	nmdc:mga09592_298825_c1_176_943	251
460	3300050510	nmdc:mga06r32_332749_c1	nmdc:mga06r32_332749_c1_28_795	251
461	3300053142	Ga0500577_0058131	Ga0500577_0058131_432_1199	251
462	3300054114	Ga0501084_0009411	Ga0501084_0009411_2299_3069	251
463	3300054114	Ga0501084_0241280	Ga0501084_0241280_687_1457	251
464	3300060353	Ga0501082_0004238	Ga0501082_0004238_7088_7858	251
465	3300060353	Ga0501082_0012570	Ga0501082_0012570_2310_3080	251
466	3300060353	Ga0501082_0615353	Ga0501082_0615353_90_860	251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

56

242

0.97 PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

62

293

0.92 PF08659

KR

KR domain

29

216

0.86 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5t2u-assembly1.cif.gz_B	short chain dehydrogenase/reductase family protein	0.9636	3	248
4nbv-assembly1.cif.gz_A	crystal structure of fabg from cupriavidus taiwanensis	0.9626	3	246
7djs-assembly1.cif.gz_D	crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad	0.9604	4	249
6zzo-assembly2.cif.gz_C	crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with nad+ and acetoacetate	0.9601	3	247
7djs-assembly1.cif.gz_B	crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad	0.9591	7	249

ID	Description	Score	Start	End	Superfamily
5t2uB00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9636	3	248	3.40.50.720
2rhcB00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9585	7	247	3.40.50.720
3ai1A00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.958	2	247	3.40.50.720
5jc8D00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9579	4	249	3.40.50.720
af_C6T421_12_106_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9578	2	76	3.40.50.720

ID	Description	Score	Start	End	GO Terms
AF-A0A3E1E2M9-F1-model_v4	Short-chain alcohol dehydrogenase family	0.9978	1	251	GO:0016491
AF-A0A3E1E2M9-F1-model_v4	Short-chain alcohol dehydrogenase family	0.9938	1	251	GO:0016491
AF-A0A6I1KB45-F1-model_v4	Short-chain dehydrogenase	0.9932	1	251	GO:0016491
AF-A0A6P1ARY3-F1-model_v4	deleted	0.9906	3	247
AF-A0A6I1KB45-F1-model_v4	Short-chain dehydrogenase	0.9892	1	251	GO:0016491

Feature Viewer

pLDDT	pTM	Quality
97.21	0.94	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F449661

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00106

adh_short

short chain dehydrogenase

56

242

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

62

293

0.92

PF08659

KR

KR domain

29

216

0.86

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map