F449635
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 466 | 260 | 466 | 211 |
Family's Representative Sequence
| Representative Sequence | 3300005841|Ga0068863_100000779|Ga0068863_10000077926 |
| Length | 244 |
| Sequence | VFWEVPSGALLTRGPRGATRCRMPQAKLSYSGAVRVKICGITNLDDAAEAVLLGAWAIGLIHYDRSPRAVEAGEAAAICAAFRRKCEVVGVFVNPELEEVAKAVEGAGLTMVQLNGAEGPQFCAEVARRTGVKVIKAIHVASAAEVHGAEAYRTDFHLFDRRGKGLWGGTGQSFDWGLLREHRSEVPAIVAGGLRPDNVAEAIAVTHPFAVDVASGVEAEPGRKDHAAMGAFFEAAGVTSVPAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 37 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 43 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 50 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 111 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 112 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 113 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 114 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 115 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 116 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 117 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 118 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 119 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 120 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 121 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 122 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 123 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 124 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 125 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 126 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 127 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 128 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 129 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 130 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 133 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 134 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 135 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 136 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 137 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 138 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 140 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 142 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 143 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 144 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 146 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 147 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 148 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 149 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 150 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 151 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 152 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 153 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 154 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 155 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 156 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 157 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 158 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 159 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 160 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 161 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 162 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 163 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 164 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 165 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 217 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 218 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 219 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 220 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 221 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 222 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 225 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 226 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 227 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 228 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 229 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 230 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 231 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 232 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 233 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 234 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 235 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 236 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 248 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 249 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 250 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 258 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 259 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 260 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.36 |
| Metatranscriptomes | 0.64 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.72 |
| Nodule | 0 |
| Rhizoplane | 11.8 |
| Rhizosphere | 83.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1001636 | 3300001977 | Bacteria | 3586 |
| 2 | JGI24740J21852_10000878 | 3300001979 | Bacteria | 13286 |
| 3 | JGI24034J26672_10001534 | 3300002239 | Bacteria | 3068 |
| 4 | JGI24742J22300_10012430 | 3300002244 | Bacteria | 1419 |
| 5 | Ga0070683_100015946 | 3300005329 | Bacteria | 6610 |
| 6 | Ga0070683_100023609 | 3300005329 | Bacteria | 5502 |
| 7 | Ga0070670_100388559 | 3300005331 | Bacteria | 1230 |
| 8 | Ga0070677_10000082 | 3300005333 | Bacteria | 30305 |
| 9 | Ga0070682_100000030 | 3300005337 | Bacteria | 182768 |
| 10 | Ga0070682_100509660 | 3300005337 | Archaea | 934 |
| 11 | Ga0068868_100000033 | 3300005338 | Bacteria | 75402 |
| 12 | Ga0070660_100533468 | 3300005339 | Bacteria | 978 |
| 13 | Ga0070661_100000121 | 3300005344 | Bacteria | 65344 |
| 14 | Ga0070668_100001145 | 3300005347 | Bacteria | 18672 |
| 15 | Ga0070668_100260494 | 3300005347 | Bacteria | 1442 |
| 16 | Ga0070674_100000002 | 3300005356 | Bacteria | 271088 |
| 17 | Ga0070674_100000009 | 3300005356 | Bacteria | 143336 |
| 18 | Ga0070673_100181306 | 3300005364 | Bacteria | 1803 |
| 19 | Ga0070688_100030251 | 3300005365 | Bacteria | 3248 |
| 20 | Ga0070659_100063824 | 3300005366 | Bacteria | 2914 |
| 21 | Ga0070667_100007315 | 3300005367 | Bacteria | 9177 |
| 22 | Ga0070711_100001969 | 3300005439 | Bacteria | 11529 |
| 23 | Ga0070663_100199758 | 3300005455 | Bacteria | 1560 |
| 24 | Ga0070663_100509916 | 3300005455 | Unclassified | 1000 |
| 25 | Ga0070678_100010487 | 3300005456 | Bacteria | 5666 |
| 26 | Ga0070662_100000002 | 3300005457 | Bacteria | 253208 |
| 27 | Ga0070662_100000448 | 3300005457 | Bacteria | 24327 |
| 28 | Ga0070685_10000053 | 3300005466 | Bacteria | 70868 |
| 29 | Ga0070685_10001013 | 3300005466 | Bacteria | 15114 |
| 30 | Ga0070685_10008855 | 3300005466 | Bacteria | 5189 |
| 31 | Ga0070679_100193299 | 3300005530 | Bacteria | 2003 |
| 32 | Ga0070684_100011055 | 3300005535 | Bacteria | 7180 |
| 33 | Ga0070684_100091484 | 3300005535 | Bacteria | 2706 |
| 34 | Ga0070684_100133010 | 3300005535 | Bacteria | 2245 |
| 35 | Ga0070684_100640632 | 3300005535 | Bacteria | 989 |
| 36 | Ga0068853_100016611 | 3300005539 | Bacteria | 6060 |
| 37 | Ga0068853_100080887 | 3300005539 | Bacteria | 2844 |
| 38 | Ga0068853_100227075 | 3300005539 | Bacteria | 1707 |
| 39 | Ga0070672_100000112 | 3300005543 | Bacteria | 41002 |
| 40 | Ga0070686_100000026 | 3300005544 | Bacteria | 126656 |
| 41 | Ga0070686_100178001 | 3300005544 | Bacteria | 1509 |
| 42 | Ga0070665_100062981 | 3300005548 | Bacteria | 3719 |
| 43 | Ga0070665_100574069 | 3300005548 | Bacteria | 1141 |
| 44 | Ga0070664_100011461 | 3300005564 | Bacteria | 7195 |
| 45 | Ga0070664_100015617 | 3300005564 | Bacteria | 6214 |
| 46 | Ga0068857_100132941 | 3300005577 | Bacteria | 2245 |
| 47 | Ga0068854_100000333 | 3300005578 | Bacteria | 30901 |
| 48 | Ga0068854_100006276 | 3300005578 | Bacteria | 7556 |
| 49 | Ga0068856_100218348 | 3300005614 | Bacteria | 1922 |
| 50 | Ga0068856_100580882 | 3300005614 | Bacteria | 1142 |
| 51 | Ga0070702_100391366 | 3300005615 | Bacteria | 991 |
| 52 | Ga0068852_100000002 | 3300005616 | Bacteria | 268221 |
| 53 | Ga0068864_100000015 | 3300005618 | Bacteria | 303368 |
| 54 | Ga0068866_10000003 | 3300005718 | Bacteria | 281675 |
| 55 | Ga0068866_10001449 | 3300005718 | Bacteria | 10144 |
| 56 | Ga0068866_10042954 | 3300005718 | Bacteria | 2253 |
| 57 | Ga0068851_10006786 | 3300005834 | Bacteria | 5240 |
| 58 | Ga0068863_100000779 | 3300005841 | Bacteria | 32033 |
| 59 | Ga0068863_100026859 | 3300005841 | Bacteria | 5491 |
| 60 | Ga0068863_100043624 | 3300005841 | Bacteria | 4257 |
| 61 | Ga0068858_100464322 | 3300005842 | Bacteria | 1221 |
| 62 | Ga0068860_100613870 | 3300005843 | Bacteria | 1094 |
| 63 | Ga0068862_100000747 | 3300005844 | Bacteria | 32578 |
| 64 | Ga0081455_10213895 | 3300005937 | Bacteria | 1434 |
| 65 | Ga0081538_10055558 | 3300005981 | Bacteria | 2329 |
| 66 | Ga0081540_1000123 | 3300005983 | Bacteria | 81914 |
| 67 | Ga0081539_10001566 | 3300005985 | Bacteria | 37942 |
| 68 | Ga0070715_10000001 | 3300006163 | Bacteria | 693690 |
| 69 | Ga0097621_100205313 | 3300006237 | Bacteria | 1712 |
| 70 | Ga0068871_100056518 | 3300006358 | Bacteria | 3190 |
| 71 | Ga0075433_10001805 | 3300006852 | Bacteria | 16060 |
| 72 | Ga0105251_10095909 | 3300009011 | Bacteria | 1359 |
| 73 | Ga0105245_10000201 | 3300009098 | Bacteria | 57152 |
| 74 | Ga0105245_10001198 | 3300009098 | Bacteria | 23459 |
| 75 | Ga0105245_10007008 | 3300009098 | Bacteria | 9888 |
| 76 | Ga0105247_10000206 | 3300009101 | Bacteria | 57601 |
| 77 | Ga0105247_10174953 | 3300009101 | Bacteria | 1429 |
| 78 | Ga0105243_10003464 | 3300009148 | Bacteria | 12741 |
| 79 | Ga0105243_10335100 | 3300009148 | Bacteria | 1384 |
| 80 | Ga0105242_10000062 | 3300009176 | Bacteria | 74936 |
| 81 | Ga0105242_10000595 | 3300009176 | Bacteria | 28423 |
| 82 | Ga0105242_10095993 | 3300009176 | Bacteria | 2503 |
| 83 | Ga0105242_10104426 | 3300009176 | Bacteria | 2405 |
| 84 | Ga0105238_10000003 | 3300009551 | Bacteria | 422077 |
| 85 | Ga0105238_10000009 | 3300009551 | Bacteria | 288729 |
| 86 | Ga0105249_10013668 | 3300009553 | Bacteria | 7168 |
| 87 | Ga0105249_10790744 | 3300009553 | Bacteria | 1012 |
| 88 | Ga0105239_10390620 | 3300010375 | Bacteria | 1574 |
| 89 | Ga0157371_10006328 | 3300013102 | Bacteria | 9796 |
| 90 | Ga0157370_10104152 | 3300013104 | Bacteria | 2656 |
| 91 | Ga0157370_10155227 | 3300013104 | Bacteria | 2129 |
| 92 | Ga0157369_10000014 | 3300013105 | Bacteria | 266411 |
| 93 | Ga0157374_10022241 | 3300013296 | Bacteria | 5655 |
| 94 | Ga0157374_10041105 | 3300013296 | Bacteria | 4259 |
| 95 | Ga0157378_10278659 | 3300013297 | Bacteria | 1611 |
| 96 | Ga0157372_10000210 | 3300013307 | Bacteria | 65290 |
| 97 | Ga0157372_10425336 | 3300013307 | Bacteria | 1548 |
| 98 | Ga0157375_10000584 | 3300013308 | Bacteria | 32509 |
| 99 | Ga0157375_10000809 | 3300013308 | Bacteria | 27418 |
| 100 | Ga0157375_10558987 | 3300013308 | Bacteria | 1305 |
| 101 | Ga0163163_10370475 | 3300014325 | Bacteria | 1489 |
| 102 | Ga0163163_10636211 | 3300014325 | Unclassified | 1130 |
| 103 | Ga0163163_10736863 | 3300014325 | Bacteria | 1049 |
| 104 | Ga0157380_10000376 | 3300014326 | Bacteria | 26882 |
| 105 | Ga0157380_10241363 | 3300014326 | Bacteria | 1629 |
| 106 | Ga0157379_10777497 | 3300014968 | Unclassified | 903 |
| 107 | Ga0157376_10351564 | 3300014969 | Bacteria | 1411 |
| 108 | Ga0163161_10000022 | 3300017792 | Bacteria | 207890 |
| 109 | Ga0207656_10001461 | 3300025321 | Bacteria | 7829 |
| 110 | Ga0207653_10091110 | 3300025885 | Bacteria | 1068 |
| 111 | Ga0207682_10000018 | 3300025893 | Bacteria | 66215 |
| 112 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 113 | Ga0207642_10000353 | 3300025899 | Bacteria | 13789 |
| 114 | Ga0207642_10145670 | 3300025899 | Bacteria | 1254 |
| 115 | Ga0207710_10002663 | 3300025900 | Bacteria | 8226 |
| 116 | Ga0207685_10000005 | 3300025905 | Bacteria | 289944 |
| 117 | Ga0207663_10005529 | 3300025916 | Bacteria | 6373 |
| 118 | Ga0207649_10000003 | 3300025920 | Bacteria | 388908 |
| 119 | Ga0207652_10004713 | 3300025921 | Bacteria | 11056 |
| 120 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 121 | Ga0207694_10000077 | 3300025924 | Bacteria | 112188 |
| 122 | Ga0207650_10452809 | 3300025925 | Bacteria | 1068 |
| 123 | Ga0207687_10000020 | 3300025927 | Bacteria | 228407 |
| 124 | Ga0207687_10000484 | 3300025927 | Bacteria | 26903 |
| 125 | Ga0207687_10000851 | 3300025927 | Bacteria | 20636 |
| 126 | Ga0207700_10000003 | 3300025928 | Bacteria | 500797 |
| 127 | Ga0207664_10021209 | 3300025929 | Bacteria | 4826 |
| 128 | Ga0207690_10002915 | 3300025932 | Bacteria | 10309 |
| 129 | Ga0207706_10000001 | 3300025933 | Bacteria | 423014 |
| 130 | Ga0207706_10000259 | 3300025933 | Bacteria | 57912 |
| 131 | Ga0207686_10000231 | 3300025934 | Bacteria | 42432 |
| 132 | Ga0207686_10000426 | 3300025934 | Bacteria | 28776 |
| 133 | Ga0207686_10065470 | 3300025934 | Bacteria | 2318 |
| 134 | Ga0207709_10009509 | 3300025935 | Bacteria | 5348 |
| 135 | Ga0207669_10000001 | 3300025937 | Bacteria | 377747 |
| 136 | Ga0207669_10000003 | 3300025937 | Bacteria | 252239 |
| 137 | Ga0207704_10193499 | 3300025938 | Bacteria | 1481 |
| 138 | Ga0207691_10000002 | 3300025940 | Bacteria | 189785 |
| 139 | Ga0207661_10010612 | 3300025944 | Bacteria | 6638 |
| 140 | Ga0207661_10015092 | 3300025944 | Bacteria | 5676 |
| 141 | Ga0207679_10002319 | 3300025945 | Bacteria | 11707 |
| 142 | Ga0207679_10024717 | 3300025945 | Bacteria | 4122 |
| 143 | Ga0207651_10004579 | 3300025960 | Bacteria | 7000 |
| 144 | Ga0207712_10000019 | 3300025961 | Bacteria | 317060 |
| 145 | Ga0207712_10006981 | 3300025961 | Bacteria | 7121 |
| 146 | Ga0207668_10001356 | 3300025972 | Bacteria | 14490 |
| 147 | Ga0207668_10079580 | 3300025972 | Bacteria | 2371 |
| 148 | Ga0207640_10000110 | 3300025981 | Bacteria | 61907 |
| 149 | Ga0207640_10006888 | 3300025981 | Bacteria | 6250 |
| 150 | Ga0207658_10002445 | 3300025986 | Bacteria | 13591 |
| 151 | Ga0207677_10000343 | 3300026023 | Bacteria | 33031 |
| 152 | Ga0207677_10001134 | 3300026023 | Bacteria | 14537 |
| 153 | Ga0207703_10083001 | 3300026035 | Bacteria | 2676 |
| 154 | Ga0207639_10037676 | 3300026041 | Bacteria | 3592 |
| 155 | Ga0207639_10159956 | 3300026041 | Bacteria | 1897 |
| 156 | Ga0207708_10228676 | 3300026075 | Bacteria | 1493 |
| 157 | Ga0207702_10007849 | 3300026078 | Bacteria | 9052 |
| 158 | Ga0207702_10079020 | 3300026078 | Bacteria | 2850 |
| 159 | Ga0207702_10330965 | 3300026078 | Bacteria | 1453 |
| 160 | Ga0207641_10002588 | 3300026088 | Bacteria | 16628 |
| 161 | Ga0207641_10121250 | 3300026088 | Bacteria | 2334 |
| 162 | Ga0207676_10000018 | 3300026095 | Bacteria | 306375 |
| 163 | Ga0207683_10015536 | 3300026121 | Bacteria | 6482 |
| 164 | Ga0207698_10000004 | 3300026142 | Bacteria | 313614 |
| 165 | Ga0268266_10077960 | 3300028379 | Bacteria | 2882 |
| 166 | Ga0268266_10674039 | 3300028379 | Bacteria | 996 |
| 167 | Ga0268265_10005097 | 3300028380 | Bacteria | 9009 |
| 168 | Ga0268264_10000969 | 3300028381 | Bacteria | 29417 |
| 169 | Ga0268264_10088341 | 3300028381 | Bacteria | 2667 |
| 170 | Ga0268264_10209292 | 3300028381 | Bacteria | 1789 |
| 171 | Ga0265337_1000955 | 3300028556 | Bacteria | 15128 |
| 172 | Ga0265326_10000041 | 3300028558 | Bacteria | 83872 |
| 173 | Ga0265326_10058107 | 3300028558 | Bacteria | 1094 |
| 174 | Ga0265319_1000014 | 3300028563 | Bacteria | 177623 |
| 175 | Ga0265322_10000004 | 3300028654 | Bacteria | 275155 |
| 176 | Ga0265322_10108706 | 3300028654 | Archaea | 789 |
| 177 | Ga0265336_10005432 | 3300028666 | Bacteria | 4697 |
| 178 | Ga0265336_10010927 | 3300028666 | Bacteria | 3097 |
| 179 | Ga0265338_10000185 | 3300028800 | Bacteria | 116333 |
| 180 | Ga0265324_10000266 | 3300029957 | Bacteria | 38549 |
| 181 | Ga0265324_10070782 | 3300029957 | Bacteria | 1188 |
| 182 | Ga0265320_10000029 | 3300031240 | Bacteria | 159627 |
| 183 | Ga0265325_10046561 | 3300031241 | Bacteria | 2249 |
| 184 | Ga0265339_10050660 | 3300031249 | Bacteria | 2270 |
| 185 | Ga0265331_10086030 | 3300031250 | Bacteria | 1456 |
| 186 | Ga0265327_10000015 | 3300031251 | Bacteria | 496677 |
| 187 | Ga0316575_10000465 | 3300031665 | Bacteria | 11619 |
| 188 | Ga0316579_10003259 | 3300031691 | Bacteria | 6296 |
| 189 | Ga0265314_10000119 | 3300031711 | Bacteria | 122334 |
| 190 | Ga0265342_10107643 | 3300031712 | Bacteria | 1581 |
| 191 | Ga0316576_10000087 | 3300031727 | Bacteria | 32443 |
| 192 | Ga0316578_10001892 | 3300031728 | Bacteria | 8842 |
| 193 | Ga0316578_10226880 | 3300031728 | Bacteria | 1122 |
| 194 | Ga0316577_10003838 | 3300031733 | Bacteria | 7658 |
| 195 | Ga0307413_10270643 | 3300031824 | Bacteria | 1272 |
| 196 | Ga0307406_10551906 | 3300031901 | Bacteria | 943 |
| 197 | Ga0307412_10042158 | 3300031911 | Bacteria | 2963 |
| 198 | Ga0307409_100130266 | 3300031995 | Bacteria | 2148 |
| 199 | Ga0307416_100821552 | 3300032002 | Bacteria | 1026 |
| 200 | Ga0307416_101149297 | 3300032002 | Unclassified | 882 |
| 201 | Ga0307415_100000870 | 3300032126 | Bacteria | 13803 |
| 202 | Ga0316583_10094405 | 3300032133 | Bacteria | 1043 |
| 203 | Ga0316585_10001029 | 3300032137 | Bacteria | 7216 |
| 204 | Ga0316580_10000107 | 3300032139 | Bacteria | 15287 |
| 205 | Ga0316593_10000394 | 3300032168 | Bacteria | 7810 |
| 206 | Ga0316587_1035698 | 3300033529 | Bacteria | 889 |
| 207 | Ga0316596_1000411 | 3300033541 | Bacteria | 7126 |
| 208 | Ga0373923_0130240 | 3300035111 | Bacteria | 1130 |
| 209 | Ga0316574_0005091 | 3300035398 | Bacteria | 6983 |
| 210 | Ga0373933_0607698 | 3300035724 | Unclassified | 718 |
| 211 | Ga0373937_0027522 | 3300036401 | Bacteria | 5141 |
| 212 | Ga0373937_0290440 | 3300036401 | Bacteria | 1545 |
| 213 | Ga0373937_0373905 | 3300036401 | Bacteria | 1351 |
| 214 | Ga0316582_0004765 | 3300036647 | Bacteria | 6911 |
| 215 | Ga0316584_0019141 | 3300036712 | Bacteria | 4946 |
| 216 | Ga0395899_0009678 | 3300037312 | Bacteria | 7397 |
| 217 | Ga0395899_0068219 | 3300037312 | Bacteria | 2608 |
| 218 | Ga0395900_0112368 | 3300037418 | Bacteria | 2797 |
| 219 | Ga0395898_0003507 | 3300037466 | Bacteria | 17499 |
| 220 | Ga0395905_0099276 | 3300037471 | Bacteria | 2734 |
| 221 | Ga0395905_0115596 | 3300037471 | Bacteria | 2521 |
| 222 | Ga0395901_0013568 | 3300038443 | Bacteria | 8287 |
| 223 | Ga0395901_0024125 | 3300038443 | Bacteria | 6239 |
| 224 | Ga0436360_0961099 | 3300039438 | Bacteria | 876 |
| 225 | Ga0451800_1144989 | 3300041459 | Bacteria | 1050 |
| 226 | Ga0451807_2015988 | 3300041486 | Bacteria | 1473 |
| 227 | Ga0451807_2557324 | 3300041486 | Bacteria | 1069 |
| 228 | Ga0451833_0382037 | 3300041491 | Bacteria | 2273 |
| 229 | Ga0466969_0150181 | 3300044656 | Bacteria | 1074 |
| 230 | Ga0466965_0335144 | 3300044683 | Bacteria | 826 |
| 231 | Ga0466966_0083081 | 3300044684 | Unclassified | 1993 |
| 232 | Ga0466961_0046177 | 3300044693 | Bacteria | 2786 |
| 233 | Ga0466961_0118660 | 3300044693 | Unclassified | 1662 |
| 234 | Ga0466963_0000127 | 3300044694 | Bacteria | 28865 |
| 235 | Ga0466963_0057809 | 3300044694 | Bacteria | 2584 |
| 236 | Ga0466957_0003429 | 3300044842 | Bacteria | 8705 |
| 237 | Ga0466957_0113475 | 3300044842 | Bacteria | 1721 |
| 238 | Ga0466959_0444900 | 3300045049 | Bacteria | 879 |
| 239 | Ga0466958_0021104 | 3300045836 | Bacteria | 3802 |
| 240 | Ga0466958_0068710 | 3300045836 | Bacteria | 2166 |
| 241 | Ga0466958_0078670 | 3300045836 | Unclassified | 2027 |
| 242 | Ga0466967_0000006 | 3300045976 | Bacteria | 144065 |
| 243 | Ga0466967_0110030 | 3300045976 | Bacteria | 2530 |
| 244 | Ga0495592_0005546 | 3300046454 | Bacteria | 9332 |
| 245 | Ga0495592_0125425 | 3300046454 | Bacteria | 1802 |
| 246 | Ga0495603_0000033 | 3300046455 | Bacteria | 57940 |
| 247 | Ga0495603_0001486 | 3300046455 | Bacteria | 13638 |
| 248 | Ga0495603_0088382 | 3300046455 | Bacteria | 1813 |
| 249 | Ga0495629_0003072 | 3300046459 | Bacteria | 12684 |
| 250 | Ga0495629_0041194 | 3300046459 | Bacteria | 3250 |
| 251 | Ga0495629_0095306 | 3300046459 | Bacteria | 2076 |
| 252 | Ga0495629_0143000 | 3300046459 | Bacteria | 1664 |
| 253 | Ga0495629_0409881 | 3300046459 | Bacteria | 920 |
| 254 | Ga0495641_0000014 | 3300046461 | Bacteria | 140908 |
| 255 | Ga0495641_0176552 | 3300046461 | Bacteria | 956 |
| 256 | Ga0495651_0054708 | 3300046462 | Bacteria | 3068 |
| 257 | Ga0495651_0127312 | 3300046462 | Bacteria | 1864 |
| 258 | Ga0495651_0171606 | 3300046462 | Bacteria | 1544 |
| 259 | Ga0495653_0039868 | 3300046463 | Bacteria | 3676 |
| 260 | Ga0495653_0069035 | 3300046463 | Bacteria | 2649 |
| 261 | Ga0495653_0183381 | 3300046463 | Bacteria | 1434 |
| 262 | Ga0495582_0000009 | 3300046473 | Bacteria | 123633 |
| 263 | Ga0495662_0000698 | 3300046476 | Bacteria | 15931 |
| 264 | Ga0495662_0018648 | 3300046476 | Bacteria | 3358 |
| 265 | Ga0495662_0104392 | 3300046476 | Bacteria | 1387 |
| 266 | Ga0495594_0000006 | 3300046499 | Bacteria | 167901 |
| 267 | Ga0495606_0000463 | 3300046507 | Bacteria | 66752 |
| 268 | Ga0495608_0000035 | 3300046511 | Bacteria | 133011 |
| 269 | Ga0495608_0003187 | 3300046511 | Bacteria | 11744 |
| 270 | Ga0495608_0115478 | 3300046511 | Bacteria | 1723 |
| 271 | Ga0495608_0125113 | 3300046511 | Bacteria | 1647 |
| 272 | Ga0495608_0412770 | 3300046511 | Bacteria | 825 |
| 273 | Ga0495618_0000070 | 3300046514 | Bacteria | 72312 |
| 274 | Ga0495618_0129331 | 3300046514 | Bacteria | 1616 |
| 275 | Ga0495620_0002920 | 3300046515 | Bacteria | 9818 |
| 276 | Ga0495628_0001620 | 3300046516 | Bacteria | 20621 |
| 277 | Ga0495628_0059689 | 3300046516 | Bacteria | 2994 |
| 278 | Ga0495628_0327391 | 3300046516 | Bacteria | 1130 |
| 279 | Ga0495630_0000362 | 3300046517 | Bacteria | 35952 |
| 280 | Ga0495630_0069317 | 3300046517 | Bacteria | 2653 |
| 281 | Ga0495630_0131936 | 3300046517 | Bacteria | 1897 |
| 282 | Ga0495630_0255355 | 3300046517 | Bacteria | 1339 |
| 283 | Ga0495643_0000692 | 3300046522 | Bacteria | 38937 |
| 284 | Ga0495652_0000010 | 3300046529 | Bacteria | 261584 |
| 285 | Ga0495652_0103187 | 3300046529 | Bacteria | 2309 |
| 286 | Ga0495652_0376965 | 3300046529 | Bacteria | 1010 |
| 287 | Ga0495640_0098475 | 3300046533 | Bacteria | 1922 |
| 288 | Ga0495640_0100282 | 3300046533 | Bacteria | 1902 |
| 289 | Ga0495586_0439969 | 3300046535 | Unclassified | 751 |
| 290 | Ga0495586_0483345 | 3300046535 | Unclassified | 714 |
| 291 | Ga0495587_0001789 | 3300046536 | Bacteria | 14353 |
| 292 | Ga0495587_0085772 | 3300046536 | Bacteria | 1823 |
| 293 | Ga0495587_0097278 | 3300046536 | Bacteria | 1697 |
| 294 | Ga0495587_0303004 | 3300046536 | Bacteria | 893 |
| 295 | Ga0495621_0004240 | 3300046539 | Bacteria | 4011 |
| 296 | Ga0495645_0010315 | 3300046543 | Bacteria | 6549 |
| 297 | Ga0495645_0337540 | 3300046543 | Bacteria | 974 |
| 298 | Ga0495622_0000132 | 3300046557 | Bacteria | 63863 |
| 299 | Ga0495667_0000258 | 3300046559 | Bacteria | 34340 |
| 300 | Ga0495667_0229977 | 3300046559 | Bacteria | 1182 |
| 301 | Ga0495667_0365247 | 3300046559 | Bacteria | 911 |
| 302 | Ga0495656_0001129 | 3300046615 | Bacteria | 8678 |
| 303 | Ga0495668_0047700 | 3300046616 | Bacteria | 2378 |
| 304 | Ga0495634_0000216 | 3300046642 | Bacteria | 53765 |
| 305 | Ga0495634_0004828 | 3300046642 | Bacteria | 10464 |
| 306 | Ga0495634_0100139 | 3300046642 | Bacteria | 1873 |
| 307 | Ga0495634_0354449 | 3300046642 | Bacteria | 878 |
| 308 | Ga0495635_0000057 | 3300046663 | Bacteria | 67714 |
| 309 | Ga0495588_0000229 | 3300046674 | Bacteria | 50351 |
| 310 | Ga0495657_0000026 | 3300046675 | Bacteria | 133011 |
| 311 | Ga0495657_0007638 | 3300046675 | Bacteria | 8330 |
| 312 | Ga0495657_0055122 | 3300046675 | Bacteria | 2653 |
| 313 | Ga0495599_0020843 | 3300046678 | Bacteria | 4085 |
| 314 | Ga0495599_0065495 | 3300046678 | Bacteria | 2270 |
| 315 | Ga0495599_0131563 | 3300046678 | Bacteria | 1554 |
| 316 | Ga0495646_0247519 | 3300046680 | Archaea | 956 |
| 317 | Ga0495647_0000023 | 3300046681 | Bacteria | 67025 |
| 318 | Ga0495647_0009332 | 3300046681 | Bacteria | 3321 |
| 319 | Ga0495647_0031055 | 3300046681 | Bacteria | 1985 |
| 320 | Ga0495658_0000002 | 3300046683 | Bacteria | 309651 |
| 321 | Ga0495658_0106634 | 3300046683 | Bacteria | 1680 |
| 322 | Ga0495669_0000282 | 3300046684 | Bacteria | 29109 |
| 323 | Ga0495613_0000032 | 3300046689 | Bacteria | 139806 |
| 324 | Ga0495613_0002007 | 3300046689 | Bacteria | 15449 |
| 325 | Ga0495613_0052954 | 3300046689 | Bacteria | 2988 |
| 326 | Ga0495613_0132337 | 3300046689 | Bacteria | 1786 |
| 327 | Ga0495624_0000071 | 3300046690 | Bacteria | 65995 |
| 328 | Ga0495624_0001926 | 3300046690 | Bacteria | 15801 |
| 329 | Ga0495649_0003071 | 3300046694 | Bacteria | 11425 |
| 330 | Ga0495600_0006556 | 3300046809 | Bacteria | 7086 |
| 331 | Ga0495600_0021861 | 3300046809 | Bacteria | 4102 |
| 332 | Ga0495600_0378377 | 3300046809 | Bacteria | 883 |
| 333 | Ga0495604_0000100 | 3300047317 | Bacteria | 72995 |
| 334 | Ga0495604_0000305 | 3300047317 | Bacteria | 44020 |
| 335 | Ga0495674_0000010 | 3300047319 | Bacteria | 285794 |
| 336 | Ga0495672_0135762 | 3300047320 | Bacteria | 1290 |
| 337 | Ga0495676_0009565 | 3300047321 | Bacteria | 8822 |
| 338 | Ga0495676_0112630 | 3300047321 | Bacteria | 1993 |
| 339 | Ga0495676_0132599 | 3300047321 | Bacteria | 1796 |
| 340 | Ga0495680_0000312 | 3300047322 | Bacteria | 54495 |
| 341 | Ga0495680_0003440 | 3300047322 | Bacteria | 15615 |
| 342 | Ga0495680_0034290 | 3300047322 | Bacteria | 4101 |
| 343 | Ga0495680_0112420 | 3300047322 | Bacteria | 2017 |
| 344 | Ga0495675_0000015 | 3300047444 | Bacteria | 133004 |
| 345 | Ga0495675_0061786 | 3300047444 | Bacteria | 2373 |
| 346 | Ga0495684_0050501 | 3300047471 | Bacteria | 3175 |
| 347 | Ga0495684_0066579 | 3300047471 | Bacteria | 2739 |
| 348 | Ga0495686_0458170 | 3300047472 | Bacteria | 676 |
| 349 | Ga0495593_0274093 | 3300047673 | Bacteria | 844 |
| 350 | Ga0495602_0000227 | 3300048088 | Bacteria | 52680 |
| 351 | Ga0495602_0001969 | 3300048088 | Bacteria | 20606 |
| 352 | Ga0495602_0015468 | 3300048088 | Bacteria | 7699 |
| 353 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 354 | Ga0496100_0000010 | 3300048903 | Bacteria | 205204 |
| 355 | Ga0496101_0000004 | 3300048904 | Bacteria | 331599 |
| 356 | Ga0496101_0000025 | 3300048904 | Bacteria | 205204 |
| 357 | Ga0496102_0002490 | 3300048905 | Bacteria | 15727 |
| 358 | Ga0496102_0297212 | 3300048905 | Bacteria | 1522 |
| 359 | Ga0496102_0367512 | 3300048905 | Bacteria | 1354 |
| 360 | Ga0496103_0000057 | 3300048906 | Bacteria | 142223 |
| 361 | Ga0496103_0300063 | 3300048906 | Bacteria | 1033 |
| 362 | Ga0496104_0000015 | 3300048907 | Bacteria | 374530 |
| 363 | Ga0496104_0000024 | 3300048907 | Bacteria | 229913 |
| 364 | Ga0496104_0000213 | 3300048907 | Bacteria | 51219 |
| 365 | Ga0496104_0094409 | 3300048907 | Bacteria | 2862 |
| 366 | Ga0496105_0000004 | 3300048908 | Bacteria | 475798 |
| 367 | Ga0496105_0000013 | 3300048908 | Bacteria | 229894 |
| 368 | Ga0496105_0000059 | 3300048908 | Bacteria | 86884 |
| 369 | Ga0496106_0000012 | 3300048909 | Bacteria | 205158 |
| 370 | Ga0496106_0000091 | 3300048909 | Bacteria | 71361 |
| 371 | Ga0496106_0000356 | 3300048909 | Bacteria | 32385 |
| 372 | Ga0496106_0164476 | 3300048909 | Bacteria | 1756 |
| 373 | Ga0496107_0000002 | 3300048910 | Bacteria | 320871 |
| 374 | Ga0496107_0000010 | 3300048910 | Bacteria | 205188 |
| 375 | Ga0496108_0000005 | 3300048911 | Bacteria | 535059 |
| 376 | Ga0496108_0000006 | 3300048911 | Bacteria | 469473 |
| 377 | Ga0496108_0000232 | 3300048911 | Bacteria | 49846 |
| 378 | Ga0496108_0013086 | 3300048911 | Bacteria | 6762 |
| 379 | Ga0496108_0192077 | 3300048911 | Bacteria | 1770 |
| 380 | Ga0496109_0000002 | 3300048912 | Bacteria | 443393 |
| 381 | Ga0496109_0000004 | 3300048912 | Bacteria | 404818 |
| 382 | Ga0496109_0000044 | 3300048912 | Bacteria | 133779 |
| 383 | Ga0496109_0111941 | 3300048912 | Bacteria | 2538 |
| 384 | Ga0496109_0126031 | 3300048912 | Bacteria | 2388 |
| 385 | Ga0496109_0145771 | 3300048912 | Bacteria | 2215 |
| 386 | Ga0496109_0430622 | 3300048912 | Bacteria | 1246 |
| 387 | Ga0496110_0028377 | 3300048913 | Bacteria | 4807 |
| 388 | Ga0496110_0064915 | 3300048913 | Bacteria | 3227 |
| 389 | Ga0496110_0115091 | 3300048913 | Bacteria | 2420 |
| 390 | Ga0496110_0195035 | 3300048913 | Bacteria | 1839 |
| 391 | Ga0496110_0281734 | 3300048913 | Bacteria | 1514 |
| 392 | Ga0496112_0000006 | 3300048915 | Bacteria | 365227 |
| 393 | Ga0496112_0018954 | 3300048915 | Bacteria | 6486 |
| 394 | Ga0496112_0866937 | 3300048915 | Bacteria | 826 |
| 395 | Ga0496113_0000434 | 3300048916 | Bacteria | 20290 |
| 396 | Ga0496113_0007952 | 3300048916 | Bacteria | 6867 |
| 397 | Ga0496113_0027941 | 3300048916 | Bacteria | 4051 |
| 398 | Ga0496113_0227155 | 3300048916 | Bacteria | 1488 |
| 399 | Ga0496114_0000056 | 3300048917 | Bacteria | 95692 |
| 400 | Ga0496114_0022975 | 3300048917 | Bacteria | 5084 |
| 401 | Ga0496115_0000016 | 3300048918 | Bacteria | 187067 |
| 402 | Ga0496115_0000031 | 3300048918 | Bacteria | 138258 |
| 403 | Ga0496115_0012760 | 3300048918 | Bacteria | 6334 |
| 404 | Ga0496115_0206100 | 3300048918 | Bacteria | 1624 |
| 405 | Ga0496116_0000257 | 3300048919 | Bacteria | 93214 |
| 406 | Ga0496117_0002686 | 3300048920 | Bacteria | 21983 |
| 407 | Ga0496118_0002280 | 3300048921 | Bacteria | 26182 |
| 408 | Ga0496118_0066682 | 3300048921 | Bacteria | 2626 |
| 409 | Ga0496118_0137101 | 3300048921 | Bacteria | 1559 |
| 410 | Ga0496119_0012123 | 3300048922 | Bacteria | 7038 |
| 411 | Ga0496120_0007583 | 3300048923 | Bacteria | 8047 |
| 412 | Ga0496120_0119749 | 3300048923 | Bacteria | 1363 |
| 413 | Ga0496121_0191752 | 3300048924 | Bacteria | 1464 |
| 414 | Ga0496125_0123426 | 3300048928 | Bacteria | 1841 |
| 415 | Ga0496125_0279716 | 3300048928 | Bacteria | 1034 |
| 416 | Ga0501036_0368884 | 3300049572 | Bacteria | 1198 |
| 417 | Ga0501042_0116397 | 3300049578 | Bacteria | 1924 |
| 418 | Ga0501068_0121508 | 3300049584 | Bacteria | 1629 |
| 419 | Ga0501070_0143322 | 3300049586 | Bacteria | 1972 |
| 420 | Ga0501070_0398666 | 3300049586 | Unclassified | 1113 |
| 421 | Ga0501072_0147756 | 3300049588 | Bacteria | 1874 |
| 422 | Ga0501075_0004268 | 3300049591 | Bacteria | 9657 |
| 423 | Ga0501075_0457578 | 3300049591 | Bacteria | 973 |
| 424 | Ga0501076_0178682 | 3300049592 | Bacteria | 1730 |
| 425 | Ga0501079_0080601 | 3300049741 | Bacteria | 2517 |
| 426 | Ga0501080_0147815 | 3300049742 | Bacteria | 2173 |
| 427 | Ga0501081_0264576 | 3300049743 | Bacteria | 1257 |
| 428 | Ga0501083_0070821 | 3300049744 | Bacteria | 2318 |
| 429 | nmdc:mga03n38_149936_c1 | 3300050490 | Bacteria | 1172 |
| 430 | nmdc:mga0yw44_206055_c1 | 3300050492 | Bacteria | 1300 |
| 431 | nmdc:mga06z11_377514_c1 | 3300050494 | Bacteria | 851 |
| 432 | nmdc:mga06z11_98485_c1 | 3300050494 | Bacteria | 1600 |
| 433 | nmdc:mga05p37_1004224_c1 | 3300050507 | Archaea | 886 |
| 434 | nmdc:mga0a205_386_c1 | 3300050515 | Bacteria | 33461 |
| 435 | nmdc:mga0a205_94_c1 | 3300050515 | Bacteria | 50261 |
| 436 | Ga0495601_0000057 | 3300053077 | Bacteria | 61510 |
| 437 | Ga0495601_0004750 | 3300053077 | Bacteria | 7876 |
| 438 | Ga0495601_0018786 | 3300053077 | Bacteria | 4209 |
| 439 | Ga0495601_0037609 | 3300053077 | Bacteria | 3026 |
| 440 | Ga0495601_0083057 | 3300053077 | Bacteria | 2057 |
| 441 | Ga0495601_0090403 | 3300053077 | Bacteria | 1969 |
| 442 | Ga0495612_0000031 | 3300053078 | Bacteria | 80955 |
| 443 | Ga0495612_0001793 | 3300053078 | Bacteria | 8799 |
| 444 | Ga0495612_0006253 | 3300053078 | Bacteria | 4906 |
| 445 | Ga0495612_0158883 | 3300053078 | Bacteria | 986 |
| 446 | Ga0495655_0000005 | 3300053083 | Bacteria | 257472 |
| 447 | Ga0495595_0000017 | 3300053084 | Bacteria | 133011 |
| 448 | Ga0495595_0000130 | 3300053084 | Bacteria | 31250 |
| 449 | Ga0495595_0157975 | 3300053084 | Bacteria | 1118 |
| 450 | Ga0495595_0191021 | 3300053084 | Bacteria | 1018 |
| 451 | Ga0495619_0000010 | 3300053085 | Bacteria | 302390 |
| 452 | Ga0495619_0000082 | 3300053085 | Bacteria | 71788 |
| 453 | Ga0495619_0000146 | 3300053085 | Bacteria | 52136 |
| 454 | Ga0495619_0001050 | 3300053085 | Bacteria | 18097 |
| 455 | Ga0495619_0002897 | 3300053085 | Bacteria | 11142 |
| 456 | Ga0495619_0003619 | 3300053085 | Bacteria | 9953 |
| 457 | Ga0495619_0008902 | 3300053085 | Bacteria | 6340 |
| 458 | Ga0495619_0086345 | 3300053085 | Bacteria | 2120 |
| 459 | Ga0495619_0089148 | 3300053085 | Bacteria | 2087 |
| 460 | Ga0495619_0274377 | 3300053085 | Bacteria | 1168 |
| 461 | Ga0495619_0281361 | 3300053085 | Bacteria | 1153 |
| 462 | Ga0500566_0000943 | 3300053094 | Bacteria | 16679 |
| 463 | Ga0500614_011688 | 3300053123 | Bacteria | 1905 |
| 464 | Ga0500628_000001 | 3300053129 | Bacteria | 564074 |
| 465 | Ga0500628_001405 | 3300053129 | Bacteria | 4125 |
| 466 | Ga0501084_0945833 | 3300054114 | Bacteria | 724 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025885 | Ga0207653_10091110 | Ga0207653_100911102 | 173 |
| 2 | 3300009551 | Ga0105238_10000003 | Ga0105238_1000000352 | 179 |
| 3 | 3300025924 | Ga0207694_10000077 | Ga0207694_1000007752 | 179 |
| 4 | 3300005466 | Ga0070685_10008855 | Ga0070685_100088554 | 182 |
| 5 | 3300005466 | Ga0070685_10001013 | Ga0070685_1000101314 | 184 |
| 6 | 3300005577 | Ga0068857_100132941 | Ga0068857_1001329412 | 198 |
| 7 | 3300047321 | Ga0495676_0009565 | Ga0495676_0009565_5947_6564 | 198 |
| 8 | 3300048903 | Ga0496100_0000001 | Ga0496100_0000001_214478_215095 | 198 |
| 9 | 3300048904 | Ga0496101_0000004 | Ga0496101_0000004_15830_16447 | 198 |
| 10 | 3300048909 | Ga0496106_0000091 | Ga0496106_0000091_8143_8760 | 198 |
| 11 | 3300048910 | Ga0496107_0000002 | Ga0496107_0000002_33393_34010 | 198 |
| 12 | 3300048915 | Ga0496112_0866937 | Ga0496112_0866937_84_701 | 198 |
| 13 | 3300050492 | nmdc:mga0yw44_206055_c1 | nmdc:mga0yw44_206055_c1_38_676 | 198 |
| 14 | 3300014325 | Ga0163163_10636211 | Ga0163163_106362112 | 199 |
| 15 | 3300044684 | Ga0466966_0083081 | Ga0466966_0083081_65_679 | 199 |
| 16 | 3300044693 | Ga0466961_0118660 | Ga0466961_0118660_60_674 | 199 |
| 17 | 3300045049 | Ga0466959_0444900 | Ga0466959_0444900_235_849 | 199 |
| 18 | 3300045836 | Ga0466958_0021104 | Ga0466958_0021104_204_818 | 199 |
| 19 | 3300045836 | Ga0466958_0078670 | Ga0466958_0078670_1154_1768 | 199 |
| 20 | 3300048907 | Ga0496104_0094409 | Ga0496104_0094409_446_1045 | 199 |
| 21 | 3300048918 | Ga0496115_0206100 | Ga0496115_0206100_717_1340 | 199 |
| 22 | 3300050507 | nmdc:mga05p37_1004224_c1 | nmdc:mga05p37_1004224_c1_62_661 | 199 |
| 23 | 3300005339 | Ga0070660_100533468 | Ga0070660_1005334681 | 200 |
| 24 | 3300044694 | Ga0466963_0000127 | Ga0466963_0000127_23975_24577 | 200 |
| 25 | 3300045976 | Ga0466967_0000006 | Ga0466967_0000006_78839_79441 | 200 |
| 26 | 3300048911 | Ga0496108_0000006 | Ga0496108_0000006_54556_55158 | 200 |
| 27 | 3300048912 | Ga0496109_0000004 | Ga0496109_0000004_227299_227901 | 200 |
| 28 | 3300048928 | Ga0496125_0279716 | Ga0496125_0279716_279_881 | 200 |
| 29 | 3300050494 | nmdc:mga06z11_377514_c1 | nmdc:mga06z11_377514_c1_166_837 | 200 |
| 30 | 3300005615 | Ga0070702_100391366 | Ga0070702_1003913661 | 201 |
| 31 | 3300005718 | Ga0068866_10000003 | Ga0068866_10000003116 | 201 |
| 32 | 3300025899 | Ga0207642_10000002 | Ga0207642_10000002368 | 201 |
| 33 | 3300025905 | Ga0207685_10000005 | Ga0207685_1000000578 | 201 |
| 34 | 3300025932 | Ga0207690_10002915 | Ga0207690_100029159 | 201 |
| 35 | 3300025937 | Ga0207669_10000001 | Ga0207669_10000001174 | 201 |
| 36 | 3300028381 | Ga0268264_10000969 | Ga0268264_1000096924 | 201 |
| 37 | 3300044842 | Ga0466957_0113475 | Ga0466957_0113475_71_676 | 201 |
| 38 | 3300046454 | Ga0495592_0005546 | Ga0495592_0005546_4436_5041 | 201 |
| 39 | 3300046455 | Ga0495603_0088382 | Ga0495603_0088382_129_734 | 201 |
| 40 | 3300046462 | Ga0495651_0171606 | Ga0495651_0171606_596_1201 | 201 |
| 41 | 3300046463 | Ga0495653_0039868 | Ga0495653_0039868_1426_2031 | 201 |
| 42 | 3300046476 | Ga0495662_0000698 | Ga0495662_0000698_4231_4836 | 201 |
| 43 | 3300046511 | Ga0495608_0003187 | Ga0495608_0003187_6956_7561 | 201 |
| 44 | 3300046514 | Ga0495618_0129331 | Ga0495618_0129331_735_1340 | 201 |
| 45 | 3300046516 | Ga0495628_0059689 | Ga0495628_0059689_1079_1684 | 201 |
| 46 | 3300046529 | Ga0495652_0103187 | Ga0495652_0103187_1041_1646 | 201 |
| 47 | 3300046535 | Ga0495586_0439969 | Ga0495586_0439969_81_686 | 201 |
| 48 | 3300046536 | Ga0495587_0097278 | Ga0495587_0097278_211_816 | 201 |
| 49 | 3300046678 | Ga0495599_0065495 | Ga0495599_0065495_1060_1665 | 201 |
| 50 | 3300046681 | Ga0495647_0009332 | Ga0495647_0009332_2018_2623 | 201 |
| 51 | 3300047322 | Ga0495680_0000312 | Ga0495680_0000312_52643_53248 | 201 |
| 52 | 3300049592 | Ga0501076_0178682 | Ga0501076_0178682_690_1295 | 201 |
| 53 | 3300053077 | Ga0495601_0037609 | Ga0495601_0037609_424_1029 | 201 |
| 54 | 3300053084 | Ga0495595_0000130 | Ga0495595_0000130_15431_16036 | 201 |
| 55 | 3300031911 | Ga0307412_10042158 | Ga0307412_100421583 | 202 |
| 56 | 3300005364 | Ga0070673_100181306 | Ga0070673_1001813062 | 203 |
| 57 | 3300005539 | Ga0068853_100016611 | Ga0068853_1000166114 | 203 |
| 58 | 3300025960 | Ga0207651_10004579 | Ga0207651_100045792 | 203 |
| 59 | 3300026041 | Ga0207639_10037676 | Ga0207639_100376763 | 203 |
| 60 | 3300044656 | Ga0466969_0150181 | Ga0466969_0150181_28_663 | 204 |
| 61 | 3300044693 | Ga0466961_0046177 | Ga0466961_0046177_219_854 | 204 |
| 62 | 3300046683 | Ga0495658_0106634 | Ga0495658_0106634_888_1520 | 204 |
| 63 | 3300053129 | Ga0500628_001405 | Ga0500628_001405_209_847 | 204 |
| 64 | 3300005457 | Ga0070662_100000448 | Ga0070662_10000044818 | 205 |
| 65 | 3300005544 | Ga0070686_100000026 | Ga0070686_10000002696 | 205 |
| 66 | 3300025933 | Ga0207706_10000259 | Ga0207706_1000025911 | 205 |
| 67 | 3300046522 | Ga0495643_0000692 | Ga0495643_0000692_17775_18452 | 205 |
| 68 | 3300005937 | Ga0081455_10213895 | Ga0081455_102138952 | 206 |
| 69 | 3300005981 | Ga0081538_10055558 | Ga0081538_100555583 | 206 |
| 70 | 3300005985 | Ga0081539_10001566 | Ga0081539_100015661 | 206 |
| 71 | 3300009148 | Ga0105243_10335100 | Ga0105243_103351002 | 206 |
| 72 | 3300031665 | Ga0316575_10000465 | Ga0316575_100004657 | 206 |
| 73 | 3300031691 | Ga0316579_10003259 | Ga0316579_100032591 | 206 |
| 74 | 3300031727 | Ga0316576_10000087 | Ga0316576_1000008728 | 206 |
| 75 | 3300031728 | Ga0316578_10001892 | Ga0316578_100018926 | 206 |
| 76 | 3300031728 | Ga0316578_10226880 | Ga0316578_102268801 | 206 |
| 77 | 3300031733 | Ga0316577_10003838 | Ga0316577_100038383 | 206 |
| 78 | 3300031901 | Ga0307406_10551906 | Ga0307406_105519062 | 206 |
| 79 | 3300032002 | Ga0307416_100821552 | Ga0307416_1008215522 | 206 |
| 80 | 3300032137 | Ga0316585_10001029 | Ga0316585_100010294 | 206 |
| 81 | 3300032139 | Ga0316580_10000107 | Ga0316580_100001079 | 206 |
| 82 | 3300032168 | Ga0316593_10000394 | Ga0316593_100003948 | 206 |
| 83 | 3300033529 | Ga0316587_1035698 | Ga0316587_10356981 | 206 |
| 84 | 3300033541 | Ga0316596_1000411 | Ga0316596_10004118 | 206 |
| 85 | 3300035398 | Ga0316574_0005091 | Ga0316574_0005091_2169_2807 | 206 |
| 86 | 3300036647 | Ga0316582_0004765 | Ga0316582_0004765_3054_3692 | 206 |
| 87 | 3300036712 | Ga0316584_0019141 | Ga0316584_0019141_4177_4815 | 206 |
| 88 | 3300039438 | Ga0436360_0961099 | Ga0436360_0961099_142_780 | 206 |
| 89 | 3300044683 | Ga0466965_0335144 | Ga0466965_0335144_37_696 | 206 |
| 90 | 3300050490 | nmdc:mga03n38_149936_c1 | nmdc:mga03n38_149936_c1_495_1133 | 206 |
| 91 | 3300050494 | nmdc:mga06z11_98485_c1 | nmdc:mga06z11_98485_c1_214_852 | 206 |
| 92 | 3300005543 | Ga0070672_100000112 | Ga0070672_1000001122 | 208 |
| 93 | 3300005841 | Ga0068863_100043624 | Ga0068863_1000436246 | 208 |
| 94 | 3300005842 | Ga0068858_100464322 | Ga0068858_1004643221 | 208 |
| 95 | 3300009011 | Ga0105251_10095909 | Ga0105251_100959092 | 208 |
| 96 | 3300009101 | Ga0105247_10174953 | Ga0105247_101749532 | 208 |
| 97 | 3300025940 | Ga0207691_10000002 | Ga0207691_10000002162 | 208 |
| 98 | 3300026088 | Ga0207641_10121250 | Ga0207641_101212502 | 208 |
| 99 | 3300032002 | Ga0307416_101149297 | Ga0307416_1011492971 | 208 |
| 100 | 3300037312 | Ga0395899_0009678 | Ga0395899_0009678_1705_2394 | 208 |
| 101 | 3300037312 | Ga0395899_0068219 | Ga0395899_0068219_678_1304 | 208 |
| 102 | 3300037418 | Ga0395900_0112368 | Ga0395900_0112368_586_1212 | 208 |
| 103 | 3300037466 | Ga0395898_0003507 | Ga0395898_0003507_1928_2554 | 208 |
| 104 | 3300037471 | Ga0395905_0099276 | Ga0395905_0099276_926_1615 | 208 |
| 105 | 3300037471 | Ga0395905_0115596 | Ga0395905_0115596_191_817 | 208 |
| 106 | 3300038443 | Ga0395901_0013568 | Ga0395901_0013568_7182_7808 | 208 |
| 107 | 3300038443 | Ga0395901_0024125 | Ga0395901_0024125_556_1245 | 208 |
| 108 | 3300041491 | Ga0451833_0382037 | Ga0451833_0382037_600_1247 | 208 |
| 109 | 3300046499 | Ga0495594_0000006 | Ga0495594_0000006_81104_81751 | 208 |
| 110 | 3300046557 | Ga0495622_0000132 | Ga0495622_0000132_53810_54457 | 208 |
| 111 | 3300048906 | Ga0496103_0300063 | Ga0496103_0300063_271_900 | 208 |
| 112 | 3300048918 | Ga0496115_0000016 | Ga0496115_0000016_171273_171926 | 208 |
| 113 | 3300005344 | Ga0070661_100000121 | Ga0070661_10000012131 | 209 |
| 114 | 3300005530 | Ga0070679_100193299 | Ga0070679_1001932992 | 209 |
| 115 | 3300013308 | Ga0157375_10000584 | Ga0157375_1000058421 | 209 |
| 116 | 3300025921 | Ga0207652_10004713 | Ga0207652_1000471313 | 209 |
| 117 | 3300032126 | Ga0307415_100000870 | Ga0307415_1000008706 | 209 |
| 118 | 3300046516 | Ga0495628_0327391 | Ga0495628_0327391_258_887 | 209 |
| 119 | 3300046517 | Ga0495630_0000362 | Ga0495630_0000362_28713_29342 | 209 |
| 120 | 3300046675 | Ga0495657_0055122 | Ga0495657_0055122_1709_2338 | 209 |
| 121 | 3300047317 | Ga0495604_0000100 | Ga0495604_0000100_4459_5112 | 209 |
| 122 | 3300047471 | Ga0495684_0066579 | Ga0495684_0066579_1008_1637 | 209 |
| 123 | 3300048924 | Ga0496121_0191752 | Ga0496121_0191752_273_902 | 209 |
| 124 | 3300049744 | Ga0501083_0070821 | Ga0501083_0070821_1080_1709 | 209 |
| 125 | 3300053077 | Ga0495601_0004750 | Ga0495601_0004750_5300_5929 | 209 |
| 126 | 3300053078 | Ga0495612_0158883 | Ga0495612_0158883_43_672 | 209 |
| 127 | 3300053085 | Ga0495619_0274377 | Ga0495619_0274377_247_876 | 209 |
| 128 | 3300005337 | Ga0070682_100509660 | Ga0070682_1005096601 | 210 |
| 129 | 3300005356 | Ga0070674_100000002 | Ga0070674_100000002158 | 210 |
| 130 | 3300005365 | Ga0070688_100030251 | Ga0070688_1000302511 | 210 |
| 131 | 3300005455 | Ga0070663_100509916 | Ga0070663_1005099161 | 210 |
| 132 | 3300005535 | Ga0070684_100091484 | Ga0070684_1000914842 | 210 |
| 133 | 3300005539 | Ga0068853_100080887 | Ga0068853_1000808873 | 210 |
| 134 | 3300005578 | Ga0068854_100000333 | Ga0068854_10000033315 | 210 |
| 135 | 3300005616 | Ga0068852_100000002 | Ga0068852_10000000231 | 210 |
| 136 | 3300005718 | Ga0068866_10001449 | Ga0068866_1000144910 | 210 |
| 137 | 3300005834 | Ga0068851_10006786 | Ga0068851_100067862 | 210 |
| 138 | 3300005983 | Ga0081540_1000123 | Ga0081540_100012353 | 210 |
| 139 | 3300009098 | Ga0105245_10007008 | Ga0105245_100070083 | 210 |
| 140 | 3300009176 | Ga0105242_10104426 | Ga0105242_101044262 | 210 |
| 141 | 3300013102 | Ga0157371_10006328 | Ga0157371_100063282 | 210 |
| 142 | 3300013104 | Ga0157370_10104152 | Ga0157370_101041523 | 210 |
| 143 | 3300013105 | Ga0157369_10000014 | Ga0157369_10000014120 | 210 |
| 144 | 3300013307 | Ga0157372_10000210 | Ga0157372_1000021021 | 210 |
| 145 | 3300014326 | Ga0157380_10241363 | Ga0157380_102413632 | 210 |
| 146 | 3300014969 | Ga0157376_10351564 | Ga0157376_103515642 | 210 |
| 147 | 3300025321 | Ga0207656_10001461 | Ga0207656_100014616 | 210 |
| 148 | 3300025899 | Ga0207642_10000353 | Ga0207642_100003534 | 210 |
| 149 | 3300025927 | Ga0207687_10000851 | Ga0207687_100008513 | 210 |
| 150 | 3300025934 | Ga0207686_10065470 | Ga0207686_100654702 | 210 |
| 151 | 3300025937 | Ga0207669_10000003 | Ga0207669_10000003136 | 210 |
| 152 | 3300025981 | Ga0207640_10000110 | Ga0207640_1000011014 | 210 |
| 153 | 3300026041 | Ga0207639_10159956 | Ga0207639_101599562 | 210 |
| 154 | 3300026078 | Ga0207702_10007849 | Ga0207702_100078492 | 210 |
| 155 | 3300026142 | Ga0207698_10000004 | Ga0207698_10000004254 | 210 |
| 156 | 3300044694 | Ga0466963_0057809 | Ga0466963_0057809_1273_1905 | 210 |
| 157 | 3300044842 | Ga0466957_0003429 | Ga0466957_0003429_4242_4874 | 210 |
| 158 | 3300046463 | Ga0495653_0183381 | Ga0495653_0183381_408_1040 | 210 |
| 159 | 3300046476 | Ga0495662_0018648 | Ga0495662_0018648_1061_1693 | 210 |
| 160 | 3300046511 | Ga0495608_0000035 | Ga0495608_0000035_123_755 | 210 |
| 161 | 3300046674 | Ga0495588_0000229 | Ga0495588_0000229_18950_19582 | 210 |
| 162 | 3300046675 | Ga0495657_0000026 | Ga0495657_0000026_132257_132889 | 210 |
| 163 | 3300046684 | Ga0495669_0000282 | Ga0495669_0000282_10270_10902 | 210 |
| 164 | 3300047444 | Ga0495675_0000015 | Ga0495675_0000015_132250_132882 | 210 |
| 165 | 3300048911 | Ga0496108_0000005 | Ga0496108_0000005_114877_115509 | 210 |
| 166 | 3300048912 | Ga0496109_0000002 | Ga0496109_0000002_419583_420215 | 210 |
| 167 | 3300048912 | Ga0496109_0126031 | Ga0496109_0126031_1517_2149 | 210 |
| 168 | 3300048912 | Ga0496109_0430622 | Ga0496109_0430622_474_1106 | 210 |
| 169 | 3300048913 | Ga0496110_0115091 | Ga0496110_0115091_427_1059 | 210 |
| 170 | 3300048915 | Ga0496112_0018954 | Ga0496112_0018954_1003_1635 | 210 |
| 171 | 3300048916 | Ga0496113_0000434 | Ga0496113_0000434_1272_1904 | 210 |
| 172 | 3300053084 | Ga0495595_0000017 | Ga0495595_0000017_132257_132889 | 210 |
| 173 | 3300053085 | Ga0495619_0000082 | Ga0495619_0000082_543_1175 | 210 |
| 174 | 3300053085 | Ga0495619_0001050 | Ga0495619_0001050_17343_17975 | 210 |
| 175 | 3300001977 | JGI24746J21847_1001636 | JGI24746J21847_10016362 | 211 |
| 176 | 3300001979 | JGI24740J21852_10000878 | JGI24740J21852_100008784 | 211 |
| 177 | 3300002239 | JGI24034J26672_10001534 | JGI24034J26672_100015342 | 211 |
| 178 | 3300002244 | JGI24742J22300_10012430 | JGI24742J22300_100124302 | 211 |
| 179 | 3300005329 | Ga0070683_100015946 | Ga0070683_1000159463 | 211 |
| 180 | 3300005329 | Ga0070683_100023609 | Ga0070683_1000236096 | 211 |
| 181 | 3300005331 | Ga0070670_100388559 | Ga0070670_1003885592 | 211 |
| 182 | 3300005333 | Ga0070677_10000082 | Ga0070677_1000008225 | 211 |
| 183 | 3300005337 | Ga0070682_100000030 | Ga0070682_10000003013 | 211 |
| 184 | 3300005338 | Ga0068868_100000033 | Ga0068868_10000003352 | 211 |
| 185 | 3300005347 | Ga0070668_100001145 | Ga0070668_1000011456 | 211 |
| 186 | 3300005347 | Ga0070668_100260494 | Ga0070668_1002604942 | 211 |
| 187 | 3300005356 | Ga0070674_100000009 | Ga0070674_10000000926 | 211 |
| 188 | 3300005366 | Ga0070659_100063824 | Ga0070659_1000638242 | 211 |
| 189 | 3300005367 | Ga0070667_100007315 | Ga0070667_1000073155 | 211 |
| 190 | 3300005439 | Ga0070711_100001969 | Ga0070711_1000019696 | 211 |
| 191 | 3300005455 | Ga0070663_100199758 | Ga0070663_1001997582 | 211 |
| 192 | 3300005456 | Ga0070678_100010487 | Ga0070678_1000104873 | 211 |
| 193 | 3300005457 | Ga0070662_100000002 | Ga0070662_10000000261 | 211 |
| 194 | 3300005466 | Ga0070685_10000053 | Ga0070685_1000005315 | 211 |
| 195 | 3300005535 | Ga0070684_100011055 | Ga0070684_1000110555 | 211 |
| 196 | 3300005535 | Ga0070684_100133010 | Ga0070684_1001330102 | 211 |
| 197 | 3300005535 | Ga0070684_100640632 | Ga0070684_1006406321 | 211 |
| 198 | 3300005539 | Ga0068853_100227075 | Ga0068853_1002270752 | 211 |
| 199 | 3300005544 | Ga0070686_100178001 | Ga0070686_1001780012 | 211 |
| 200 | 3300005548 | Ga0070665_100062981 | Ga0070665_1000629813 | 211 |
| 201 | 3300005548 | Ga0070665_100574069 | Ga0070665_1005740692 | 211 |
| 202 | 3300005564 | Ga0070664_100011461 | Ga0070664_1000114613 | 211 |
| 203 | 3300005564 | Ga0070664_100015617 | Ga0070664_1000156176 | 211 |
| 204 | 3300005578 | Ga0068854_100006276 | Ga0068854_1000062765 | 211 |
| 205 | 3300005614 | Ga0068856_100218348 | Ga0068856_1002183482 | 211 |
| 206 | 3300005614 | Ga0068856_100580882 | Ga0068856_1005808821 | 211 |
| 207 | 3300005618 | Ga0068864_100000015 | Ga0068864_10000001531 | 211 |
| 208 | 3300005718 | Ga0068866_10042954 | Ga0068866_100429542 | 211 |
| 209 | 3300005841 | Ga0068863_100000779 | Ga0068863_10000077926 | 211 |
| 210 | 3300005841 | Ga0068863_100026859 | Ga0068863_1000268598 | 211 |
| 211 | 3300005843 | Ga0068860_100613870 | Ga0068860_1006138701 | 211 |
| 212 | 3300005844 | Ga0068862_100000747 | Ga0068862_10000074729 | 211 |
| 213 | 3300006163 | Ga0070715_10000001 | Ga0070715_10000001653 | 211 |
| 214 | 3300006237 | Ga0097621_100205313 | Ga0097621_1002053132 | 211 |
| 215 | 3300006358 | Ga0068871_100056518 | Ga0068871_1000565183 | 211 |
| 216 | 3300006852 | Ga0075433_10001805 | Ga0075433_1000180514 | 211 |
| 217 | 3300009098 | Ga0105245_10000201 | Ga0105245_1000020129 | 211 |
| 218 | 3300009098 | Ga0105245_10001198 | Ga0105245_100011988 | 211 |
| 219 | 3300009101 | Ga0105247_10000206 | Ga0105247_1000020634 | 211 |
| 220 | 3300009148 | Ga0105243_10003464 | Ga0105243_100034643 | 211 |
| 221 | 3300009176 | Ga0105242_10000062 | Ga0105242_1000006260 | 211 |
| 222 | 3300009176 | Ga0105242_10000595 | Ga0105242_100005959 | 211 |
| 223 | 3300009176 | Ga0105242_10095993 | Ga0105242_100959932 | 211 |
| 224 | 3300009551 | Ga0105238_10000009 | Ga0105238_10000009142 | 211 |
| 225 | 3300009553 | Ga0105249_10013668 | Ga0105249_100136686 | 211 |
| 226 | 3300009553 | Ga0105249_10790744 | Ga0105249_107907442 | 211 |
| 227 | 3300010375 | Ga0105239_10390620 | Ga0105239_103906202 | 211 |
| 228 | 3300013104 | Ga0157370_10155227 | Ga0157370_101552272 | 211 |
| 229 | 3300013296 | Ga0157374_10022241 | Ga0157374_100222416 | 211 |
| 230 | 3300013296 | Ga0157374_10041105 | Ga0157374_100411052 | 211 |
| 231 | 3300013297 | Ga0157378_10278659 | Ga0157378_102786592 | 211 |
| 232 | 3300013307 | Ga0157372_10425336 | Ga0157372_104253362 | 211 |
| 233 | 3300013308 | Ga0157375_10000809 | Ga0157375_1000080920 | 211 |
| 234 | 3300013308 | Ga0157375_10558987 | Ga0157375_105589872 | 211 |
| 235 | 3300014325 | Ga0163163_10370475 | Ga0163163_103704752 | 211 |
| 236 | 3300014325 | Ga0163163_10736863 | Ga0163163_107368631 | 211 |
| 237 | 3300014326 | Ga0157380_10000376 | Ga0157380_100003762 | 211 |
| 238 | 3300014968 | Ga0157379_10777497 | Ga0157379_107774971 | 211 |
| 239 | 3300017792 | Ga0163161_10000022 | Ga0163161_10000022155 | 211 |
| 240 | 3300025893 | Ga0207682_10000018 | Ga0207682_1000001821 | 211 |
| 241 | 3300025899 | Ga0207642_10145670 | Ga0207642_101456702 | 211 |
| 242 | 3300025900 | Ga0207710_10002663 | Ga0207710_100026639 | 211 |
| 243 | 3300025916 | Ga0207663_10005529 | Ga0207663_100055295 | 211 |
| 244 | 3300025920 | Ga0207649_10000003 | Ga0207649_10000003288 | 211 |
| 245 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004153 | 211 |
| 246 | 3300025925 | Ga0207650_10452809 | Ga0207650_104528092 | 211 |
| 247 | 3300025927 | Ga0207687_10000020 | Ga0207687_10000020168 | 211 |
| 248 | 3300025927 | Ga0207687_10000484 | Ga0207687_100004846 | 211 |
| 249 | 3300025928 | Ga0207700_10000003 | Ga0207700_10000003484 | 211 |
| 250 | 3300025929 | Ga0207664_10021209 | Ga0207664_100212092 | 211 |
| 251 | 3300025933 | Ga0207706_10000001 | Ga0207706_10000001241 | 211 |
| 252 | 3300025934 | Ga0207686_10000231 | Ga0207686_1000023128 | 211 |
| 253 | 3300025934 | Ga0207686_10000426 | Ga0207686_1000042618 | 211 |
| 254 | 3300025935 | Ga0207709_10009509 | Ga0207709_100095093 | 211 |
| 255 | 3300025938 | Ga0207704_10193499 | Ga0207704_101934992 | 211 |
| 256 | 3300025944 | Ga0207661_10010612 | Ga0207661_100106126 | 211 |
| 257 | 3300025944 | Ga0207661_10015092 | Ga0207661_100150922 | 211 |
| 258 | 3300025945 | Ga0207679_10002319 | Ga0207679_1000231912 | 211 |
| 259 | 3300025945 | Ga0207679_10024717 | Ga0207679_100247174 | 211 |
| 260 | 3300025961 | Ga0207712_10000019 | Ga0207712_10000019138 | 211 |
| 261 | 3300025961 | Ga0207712_10006981 | Ga0207712_100069816 | 211 |
| 262 | 3300025972 | Ga0207668_10001356 | Ga0207668_100013566 | 211 |
| 263 | 3300025972 | Ga0207668_10079580 | Ga0207668_100795802 | 211 |
| 264 | 3300025981 | Ga0207640_10006888 | Ga0207640_100068883 | 211 |
| 265 | 3300025986 | Ga0207658_10002445 | Ga0207658_100024456 | 211 |
| 266 | 3300026023 | Ga0207677_10000343 | Ga0207677_1000034321 | 211 |
| 267 | 3300026023 | Ga0207677_10001134 | Ga0207677_1000113412 | 211 |
| 268 | 3300026035 | Ga0207703_10083001 | Ga0207703_100830012 | 211 |
| 269 | 3300026075 | Ga0207708_10228676 | Ga0207708_102286762 | 211 |
| 270 | 3300026078 | Ga0207702_10079020 | Ga0207702_100790202 | 211 |
| 271 | 3300026078 | Ga0207702_10330965 | Ga0207702_103309652 | 211 |
| 272 | 3300026088 | Ga0207641_10002588 | Ga0207641_1000258816 | 211 |
| 273 | 3300026095 | Ga0207676_10000018 | Ga0207676_10000018269 | 211 |
| 274 | 3300026121 | Ga0207683_10015536 | Ga0207683_100155365 | 211 |
| 275 | 3300028379 | Ga0268266_10077960 | Ga0268266_100779603 | 211 |
| 276 | 3300028379 | Ga0268266_10674039 | Ga0268266_106740392 | 211 |
| 277 | 3300028380 | Ga0268265_10005097 | Ga0268265_1000509710 | 211 |
| 278 | 3300028381 | Ga0268264_10088341 | Ga0268264_100883412 | 211 |
| 279 | 3300028381 | Ga0268264_10209292 | Ga0268264_102092922 | 211 |
| 280 | 3300028556 | Ga0265337_1000955 | Ga0265337_10009558 | 211 |
| 281 | 3300028558 | Ga0265326_10000041 | Ga0265326_1000004174 | 211 |
| 282 | 3300028558 | Ga0265326_10058107 | Ga0265326_100581072 | 211 |
| 283 | 3300028563 | Ga0265319_1000014 | Ga0265319_100001418 | 211 |
| 284 | 3300028654 | Ga0265322_10000004 | Ga0265322_1000000474 | 211 |
| 285 | 3300028654 | Ga0265322_10108706 | Ga0265322_101087062 | 211 |
| 286 | 3300028666 | Ga0265336_10005432 | Ga0265336_100054322 | 211 |
| 287 | 3300028666 | Ga0265336_10010927 | Ga0265336_100109272 | 211 |
| 288 | 3300028800 | Ga0265338_10000185 | Ga0265338_1000018516 | 211 |
| 289 | 3300029957 | Ga0265324_10000266 | Ga0265324_100002669 | 211 |
| 290 | 3300029957 | Ga0265324_10070782 | Ga0265324_100707822 | 211 |
| 291 | 3300031240 | Ga0265320_10000029 | Ga0265320_1000002973 | 211 |
| 292 | 3300031241 | Ga0265325_10046561 | Ga0265325_100465612 | 211 |
| 293 | 3300031249 | Ga0265339_10050660 | Ga0265339_100506602 | 211 |
| 294 | 3300031250 | Ga0265331_10086030 | Ga0265331_100860301 | 211 |
| 295 | 3300031251 | Ga0265327_10000015 | Ga0265327_1000001536 | 211 |
| 296 | 3300031711 | Ga0265314_10000119 | Ga0265314_100001195 | 211 |
| 297 | 3300031712 | Ga0265342_10107643 | Ga0265342_101076432 | 211 |
| 298 | 3300031824 | Ga0307413_10270643 | Ga0307413_102706431 | 211 |
| 299 | 3300031995 | Ga0307409_100130266 | Ga0307409_1001302663 | 211 |
| 300 | 3300032133 | Ga0316583_10094405 | Ga0316583_100944052 | 211 |
| 301 | 3300035111 | Ga0373923_0130240 | Ga0373923_0130240_357_992 | 211 |
| 302 | 3300035724 | Ga0373933_0607698 | Ga0373933_0607698_55_690 | 211 |
| 303 | 3300036401 | Ga0373937_0027522 | Ga0373937_0027522_2551_3186 | 211 |
| 304 | 3300036401 | Ga0373937_0290440 | Ga0373937_0290440_54_689 | 211 |
| 305 | 3300036401 | Ga0373937_0373905 | Ga0373937_0373905_683_1318 | 211 |
| 306 | 3300041459 | Ga0451800_1144989 | Ga0451800_1144989_141_776 | 211 |
| 307 | 3300041486 | Ga0451807_2015988 | Ga0451807_2015988_452_1087 | 211 |
| 308 | 3300041486 | Ga0451807_2557324 | Ga0451807_2557324_382_1017 | 211 |
| 309 | 3300045836 | Ga0466958_0068710 | Ga0466958_0068710_1432_2067 | 211 |
| 310 | 3300045976 | Ga0466967_0110030 | Ga0466967_0110030_177_812 | 211 |
| 311 | 3300046454 | Ga0495592_0125425 | Ga0495592_0125425_669_1304 | 211 |
| 312 | 3300046455 | Ga0495603_0000033 | Ga0495603_0000033_45379_46014 | 211 |
| 313 | 3300046455 | Ga0495603_0001486 | Ga0495603_0001486_6684_7319 | 211 |
| 314 | 3300046459 | Ga0495629_0003072 | Ga0495629_0003072_10848_11483 | 211 |
| 315 | 3300046459 | Ga0495629_0041194 | Ga0495629_0041194_1218_1853 | 211 |
| 316 | 3300046459 | Ga0495629_0095306 | Ga0495629_0095306_57_692 | 211 |
| 317 | 3300046459 | Ga0495629_0143000 | Ga0495629_0143000_698_1333 | 211 |
| 318 | 3300046459 | Ga0495629_0409881 | Ga0495629_0409881_51_686 | 211 |
| 319 | 3300046461 | Ga0495641_0000014 | Ga0495641_0000014_8986_9621 | 211 |
| 320 | 3300046461 | Ga0495641_0176552 | Ga0495641_0176552_45_680 | 211 |
| 321 | 3300046462 | Ga0495651_0054708 | Ga0495651_0054708_1226_1861 | 211 |
| 322 | 3300046462 | Ga0495651_0127312 | Ga0495651_0127312_337_972 | 211 |
| 323 | 3300046463 | Ga0495653_0069035 | Ga0495653_0069035_679_1314 | 211 |
| 324 | 3300046473 | Ga0495582_0000009 | Ga0495582_0000009_32157_32792 | 211 |
| 325 | 3300046476 | Ga0495662_0104392 | Ga0495662_0104392_680_1315 | 211 |
| 326 | 3300046507 | Ga0495606_0000463 | Ga0495606_0000463_10981_11616 | 211 |
| 327 | 3300046511 | Ga0495608_0115478 | Ga0495608_0115478_1056_1691 | 211 |
| 328 | 3300046511 | Ga0495608_0125113 | Ga0495608_0125113_672_1307 | 211 |
| 329 | 3300046511 | Ga0495608_0412770 | Ga0495608_0412770_50_685 | 211 |
| 330 | 3300046514 | Ga0495618_0000070 | Ga0495618_0000070_13509_14144 | 211 |
| 331 | 3300046515 | Ga0495620_0002920 | Ga0495620_0002920_8020_8655 | 211 |
| 332 | 3300046516 | Ga0495628_0001620 | Ga0495628_0001620_1195_1830 | 211 |
| 333 | 3300046517 | Ga0495630_0069317 | Ga0495630_0069317_1872_2507 | 211 |
| 334 | 3300046517 | Ga0495630_0131936 | Ga0495630_0131936_1187_1822 | 211 |
| 335 | 3300046517 | Ga0495630_0255355 | Ga0495630_0255355_351_986 | 211 |
| 336 | 3300046529 | Ga0495652_0000010 | Ga0495652_0000010_53700_54335 | 211 |
| 337 | 3300046529 | Ga0495652_0376965 | Ga0495652_0376965_285_920 | 211 |
| 338 | 3300046533 | Ga0495640_0098475 | Ga0495640_0098475_360_995 | 211 |
| 339 | 3300046533 | Ga0495640_0100282 | Ga0495640_0100282_977_1612 | 211 |
| 340 | 3300046535 | Ga0495586_0483345 | Ga0495586_0483345_22_657 | 211 |
| 341 | 3300046536 | Ga0495587_0001789 | Ga0495587_0001789_2009_2644 | 211 |
| 342 | 3300046536 | Ga0495587_0085772 | Ga0495587_0085772_507_1142 | 211 |
| 343 | 3300046536 | Ga0495587_0303004 | Ga0495587_0303004_88_723 | 211 |
| 344 | 3300046539 | Ga0495621_0004240 | Ga0495621_0004240_2793_3428 | 211 |
| 345 | 3300046543 | Ga0495645_0010315 | Ga0495645_0010315_1701_2336 | 211 |
| 346 | 3300046543 | Ga0495645_0337540 | Ga0495645_0337540_261_896 | 211 |
| 347 | 3300046559 | Ga0495667_0000258 | Ga0495667_0000258_4368_5003 | 211 |
| 348 | 3300046559 | Ga0495667_0229977 | Ga0495667_0229977_50_685 | 211 |
| 349 | 3300046559 | Ga0495667_0365247 | Ga0495667_0365247_151_786 | 211 |
| 350 | 3300046615 | Ga0495656_0001129 | Ga0495656_0001129_4398_5033 | 211 |
| 351 | 3300046616 | Ga0495668_0047700 | Ga0495668_0047700_1179_1814 | 211 |
| 352 | 3300046642 | Ga0495634_0000216 | Ga0495634_0000216_32206_32841 | 211 |
| 353 | 3300046642 | Ga0495634_0004828 | Ga0495634_0004828_7729_8364 | 211 |
| 354 | 3300046642 | Ga0495634_0100139 | Ga0495634_0100139_1208_1843 | 211 |
| 355 | 3300046642 | Ga0495634_0354449 | Ga0495634_0354449_165_800 | 211 |
| 356 | 3300046663 | Ga0495635_0000057 | Ga0495635_0000057_65832_66467 | 211 |
| 357 | 3300046675 | Ga0495657_0007638 | Ga0495657_0007638_6449_7084 | 211 |
| 358 | 3300046678 | Ga0495599_0020843 | Ga0495599_0020843_1507_2142 | 211 |
| 359 | 3300046678 | Ga0495599_0131563 | Ga0495599_0131563_650_1285 | 211 |
| 360 | 3300046680 | Ga0495646_0247519 | Ga0495646_0247519_76_711 | 211 |
| 361 | 3300046681 | Ga0495647_0000023 | Ga0495647_0000023_46330_46965 | 211 |
| 362 | 3300046681 | Ga0495647_0031055 | Ga0495647_0031055_922_1557 | 211 |
| 363 | 3300046683 | Ga0495658_0000002 | Ga0495658_0000002_32152_32787 | 211 |
| 364 | 3300046689 | Ga0495613_0000032 | Ga0495613_0000032_137643_138278 | 211 |
| 365 | 3300046689 | Ga0495613_0002007 | Ga0495613_0002007_13620_14255 | 211 |
| 366 | 3300046689 | Ga0495613_0052954 | Ga0495613_0052954_1231_1866 | 211 |
| 367 | 3300046689 | Ga0495613_0132337 | Ga0495613_0132337_681_1316 | 211 |
| 368 | 3300046690 | Ga0495624_0000071 | Ga0495624_0000071_11971_12606 | 211 |
| 369 | 3300046690 | Ga0495624_0001926 | Ga0495624_0001926_13925_14560 | 211 |
| 370 | 3300046694 | Ga0495649_0003071 | Ga0495649_0003071_1922_2557 | 211 |
| 371 | 3300046809 | Ga0495600_0006556 | Ga0495600_0006556_2251_2886 | 211 |
| 372 | 3300046809 | Ga0495600_0021861 | Ga0495600_0021861_2942_3577 | 211 |
| 373 | 3300046809 | Ga0495600_0378377 | Ga0495600_0378377_60_695 | 211 |
| 374 | 3300047317 | Ga0495604_0000305 | Ga0495604_0000305_26100_26735 | 211 |
| 375 | 3300047319 | Ga0495674_0000010 | Ga0495674_0000010_156026_156664 | 211 |
| 376 | 3300047320 | Ga0495672_0135762 | Ga0495672_0135762_16_651 | 211 |
| 377 | 3300047321 | Ga0495676_0112630 | Ga0495676_0112630_138_773 | 211 |
| 378 | 3300047321 | Ga0495676_0132599 | Ga0495676_0132599_360_995 | 211 |
| 379 | 3300047322 | Ga0495680_0003440 | Ga0495680_0003440_13857_14492 | 211 |
| 380 | 3300047322 | Ga0495680_0034290 | Ga0495680_0034290_1095_1730 | 211 |
| 381 | 3300047322 | Ga0495680_0112420 | Ga0495680_0112420_145_780 | 211 |
| 382 | 3300047444 | Ga0495675_0061786 | Ga0495675_0061786_484_1122 | 211 |
| 383 | 3300047471 | Ga0495684_0050501 | Ga0495684_0050501_87_722 | 211 |
| 384 | 3300047472 | Ga0495686_0458170 | Ga0495686_0458170_31_666 | 211 |
| 385 | 3300047673 | Ga0495593_0274093 | Ga0495593_0274093_144_779 | 211 |
| 386 | 3300048088 | Ga0495602_0000227 | Ga0495602_0000227_33394_34029 | 211 |
| 387 | 3300048088 | Ga0495602_0001969 | Ga0495602_0001969_1173_1808 | 211 |
| 388 | 3300048088 | Ga0495602_0015468 | Ga0495602_0015468_372_1007 | 211 |
| 389 | 3300048903 | Ga0496100_0000010 | Ga0496100_0000010_2490_3125 | 211 |
| 390 | 3300048904 | Ga0496101_0000025 | Ga0496101_0000025_2490_3125 | 211 |
| 391 | 3300048905 | Ga0496102_0002490 | Ga0496102_0002490_1190_1825 | 211 |
| 392 | 3300048905 | Ga0496102_0297212 | Ga0496102_0297212_185_832 | 211 |
| 393 | 3300048905 | Ga0496102_0367512 | Ga0496102_0367512_114_749 | 211 |
| 394 | 3300048906 | Ga0496103_0000057 | Ga0496103_0000057_91941_92576 | 211 |
| 395 | 3300048907 | Ga0496104_0000015 | Ga0496104_0000015_29959_30594 | 211 |
| 396 | 3300048907 | Ga0496104_0000024 | Ga0496104_0000024_174885_175520 | 211 |
| 397 | 3300048907 | Ga0496104_0000213 | Ga0496104_0000213_50299_50934 | 211 |
| 398 | 3300048908 | Ga0496105_0000004 | Ga0496105_0000004_445205_445840 | 211 |
| 399 | 3300048908 | Ga0496105_0000013 | Ga0496105_0000013_54394_55029 | 211 |
| 400 | 3300048908 | Ga0496105_0000059 | Ga0496105_0000059_64516_65151 | 211 |
| 401 | 3300048909 | Ga0496106_0000012 | Ga0496106_0000012_202052_202687 | 211 |
| 402 | 3300048909 | Ga0496106_0000356 | Ga0496106_0000356_20935_21570 | 211 |
| 403 | 3300048909 | Ga0496106_0164476 | Ga0496106_0164476_830_1465 | 211 |
| 404 | 3300048910 | Ga0496107_0000010 | Ga0496107_0000010_202064_202699 | 211 |
| 405 | 3300048911 | Ga0496108_0000232 | Ga0496108_0000232_44935_45570 | 211 |
| 406 | 3300048911 | Ga0496108_0013086 | Ga0496108_0013086_49_684 | 211 |
| 407 | 3300048911 | Ga0496108_0192077 | Ga0496108_0192077_996_1631 | 211 |
| 408 | 3300048912 | Ga0496109_0000044 | Ga0496109_0000044_128843_129478 | 211 |
| 409 | 3300048912 | Ga0496109_0111941 | Ga0496109_0111941_1702_2337 | 211 |
| 410 | 3300048912 | Ga0496109_0145771 | Ga0496109_0145771_1362_1997 | 211 |
| 411 | 3300048913 | Ga0496110_0028377 | Ga0496110_0028377_3212_3847 | 211 |
| 412 | 3300048913 | Ga0496110_0064915 | Ga0496110_0064915_1045_1713 | 211 |
| 413 | 3300048913 | Ga0496110_0195035 | Ga0496110_0195035_304_939 | 211 |
| 414 | 3300048913 | Ga0496110_0281734 | Ga0496110_0281734_615_1250 | 211 |
| 415 | 3300048915 | Ga0496112_0000006 | Ga0496112_0000006_141733_142368 | 211 |
| 416 | 3300048916 | Ga0496113_0007952 | Ga0496113_0007952_6076_6711 | 211 |
| 417 | 3300048916 | Ga0496113_0027941 | Ga0496113_0027941_2205_2840 | 211 |
| 418 | 3300048916 | Ga0496113_0227155 | Ga0496113_0227155_816_1451 | 211 |
| 419 | 3300048917 | Ga0496114_0000056 | Ga0496114_0000056_18655_19290 | 211 |
| 420 | 3300048917 | Ga0496114_0022975 | Ga0496114_0022975_3814_4449 | 211 |
| 421 | 3300048918 | Ga0496115_0000031 | Ga0496115_0000031_1244_1879 | 211 |
| 422 | 3300048918 | Ga0496115_0012760 | Ga0496115_0012760_1515_2150 | 211 |
| 423 | 3300048919 | Ga0496116_0000257 | Ga0496116_0000257_27252_27899 | 211 |
| 424 | 3300048920 | Ga0496117_0002686 | Ga0496117_0002686_16671_17318 | 211 |
| 425 | 3300048921 | Ga0496118_0002280 | Ga0496118_0002280_2375_3022 | 211 |
| 426 | 3300048921 | Ga0496118_0066682 | Ga0496118_0066682_1400_2047 | 211 |
| 427 | 3300048921 | Ga0496118_0137101 | Ga0496118_0137101_749_1396 | 211 |
| 428 | 3300048922 | Ga0496119_0012123 | Ga0496119_0012123_4666_5313 | 211 |
| 429 | 3300048923 | Ga0496120_0007583 | Ga0496120_0007583_4602_5249 | 211 |
| 430 | 3300048923 | Ga0496120_0119749 | Ga0496120_0119749_426_1061 | 211 |
| 431 | 3300048928 | Ga0496125_0123426 | Ga0496125_0123426_1078_1725 | 211 |
| 432 | 3300049572 | Ga0501036_0368884 | Ga0501036_0368884_259_894 | 211 |
| 433 | 3300049578 | Ga0501042_0116397 | Ga0501042_0116397_106_741 | 211 |
| 434 | 3300049584 | Ga0501068_0121508 | Ga0501068_0121508_930_1565 | 211 |
| 435 | 3300049586 | Ga0501070_0143322 | Ga0501070_0143322_155_793 | 211 |
| 436 | 3300049586 | Ga0501070_0398666 | Ga0501070_0398666_18_653 | 211 |
| 437 | 3300049588 | Ga0501072_0147756 | Ga0501072_0147756_185_820 | 211 |
| 438 | 3300049591 | Ga0501075_0004268 | Ga0501075_0004268_948_1583 | 211 |
| 439 | 3300049591 | Ga0501075_0457578 | Ga0501075_0457578_121_756 | 211 |
| 440 | 3300049741 | Ga0501079_0080601 | Ga0501079_0080601_1024_1686 | 211 |
| 441 | 3300049742 | Ga0501080_0147815 | Ga0501080_0147815_27_668 | 211 |
| 442 | 3300049743 | Ga0501081_0264576 | Ga0501081_0264576_21_683 | 211 |
| 443 | 3300050515 | nmdc:mga0a205_386_c1 | nmdc:mga0a205_386_c1_5456_6091 | 211 |
| 444 | 3300050515 | nmdc:mga0a205_94_c1 | nmdc:mga0a205_94_c1_48997_49632 | 211 |
| 445 | 3300053077 | Ga0495601_0000057 | Ga0495601_0000057_19195_19830 | 211 |
| 446 | 3300053077 | Ga0495601_0018786 | Ga0495601_0018786_1520_2155 | 211 |
| 447 | 3300053077 | Ga0495601_0083057 | Ga0495601_0083057_404_1039 | 211 |
| 448 | 3300053077 | Ga0495601_0090403 | Ga0495601_0090403_150_785 | 211 |
| 449 | 3300053078 | Ga0495612_0000031 | Ga0495612_0000031_9925_10560 | 211 |
| 450 | 3300053078 | Ga0495612_0001793 | Ga0495612_0001793_6864_7499 | 211 |
| 451 | 3300053078 | Ga0495612_0006253 | Ga0495612_0006253_4184_4819 | 211 |
| 452 | 3300053083 | Ga0495655_0000005 | Ga0495655_0000005_53823_54458 | 211 |
| 453 | 3300053084 | Ga0495595_0157975 | Ga0495595_0157975_223_858 | 211 |
| 454 | 3300053084 | Ga0495595_0191021 | Ga0495595_0191021_361_996 | 211 |
| 455 | 3300053085 | Ga0495619_0000010 | Ga0495619_0000010_226318_226953 | 211 |
| 456 | 3300053085 | Ga0495619_0000146 | Ga0495619_0000146_4353_4988 | 211 |
| 457 | 3300053085 | Ga0495619_0002897 | Ga0495619_0002897_9149_9784 | 211 |
| 458 | 3300053085 | Ga0495619_0003619 | Ga0495619_0003619_7293_7928 | 211 |
| 459 | 3300053085 | Ga0495619_0008902 | Ga0495619_0008902_985_1620 | 211 |
| 460 | 3300053085 | Ga0495619_0086345 | Ga0495619_0086345_1269_1904 | 211 |
| 461 | 3300053085 | Ga0495619_0089148 | Ga0495619_0089148_1335_1970 | 211 |
| 462 | 3300053085 | Ga0495619_0281361 | Ga0495619_0281361_62_697 | 211 |
| 463 | 3300053094 | Ga0500566_0000943 | Ga0500566_0000943_15453_16088 | 211 |
| 464 | 3300053123 | Ga0500614_011688 | Ga0500614_011688_104_739 | 211 |
| 465 | 3300053129 | Ga0500628_000001 | Ga0500628_000001_34353_34988 | 211 |
| 466 | 3300054114 | Ga0501084_0945833 | Ga0501084_0945833_35_697 | 211 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1lbm-assembly1.cif.gz_A | crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) | 0.9443 | 1 | 205 |
| 1dl3-assembly2.cif.gz_B | crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima | 0.9417 | 1 | 205 |
| 1dl3-assembly1.cif.gz_A | crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima | 0.9371 | 1 | 205 |
| 1lbm-assembly1.cif.gz_A | crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) | 0.9301 | 1 | 205 |
| 1nsj-assembly1.cif.gz_A-2 | crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima | 0.9281 | 1 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1dl3A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9371 | 1 | 205 | 3.20.20.70 |
| af_P00909_260_447_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.927 | 6 | 200 | 3.20.20.70 |
| 1dl3A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9228 | 1 | 205 | 3.20.20.70 |
| af_P00909_260_447_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9176 | 6 | 200 | 3.20.20.70 |
| 1v5xB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9167 | 1 | 205 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537YV11-F1-model_v4 | N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) | 0.9982 | 1 | 206 |
GO:0000162
GO:0004640 GO:0006568 |
| AF-A0A7J9YSZ1-F1-model_v4 | N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) | 0.9927 | 1 | 206 |
GO:0000162
GO:0004640 GO:0006568 |
| AF-A0A7V9HRX4-F1-model_v4 | N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) | 0.9917 | 1 | 206 |
GO:0000162
GO:0004640 GO:0006568 |
| AF-A0A7W0Z8Z4-F1-model_v4 | N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) | 0.9863 | 1 | 207 |
GO:0000162
GO:0004640 GO:0006568 |
| AF-A0A7V9F097-F1-model_v4 | N-(5'-phosphoribosyl)anthranilate isomerase (EC 5.3.1.24) | 0.9841 | 1 | 207 |
GO:0000162
GO:0004640 GO:0006568 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar