F449635

General Info

Members Datasets Scaffolds Average Seq Length
466 260 466 211

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100000779|Ga0068863_10000077926
Length 244
Sequence VFWEVPSGALLTRGPRGATRCRMPQAKLSYSGAVRVKICGITNLDDAAEAVLLGAWAIGLIHYDRSPRAVEAGEAAAICAAFRRKCEVVGVFVNPELEEVAKAVEGAGLTMVQLNGAEGPQFCAEVARRTGVKVIKAIHVASAAEVHGAEAYRTDFHLFDRRGKGLWGGTGQSFDWGLLREHRSEVPAIVAGGLRPDNVAEAIAVTHPFAVDVASGVEAEPGRKDHAAMGAFFEAAGVTSVPAP

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
111 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
112 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
113 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
114 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
123 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
127 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
128 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
136 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
137 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
138 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
154 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
155 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
156 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
177 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
207 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
230 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
231 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
232 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
233 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
249 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
254 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
255 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
258 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
259 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.72
Nodule 0
Rhizoplane 11.8
Rhizosphere 83.91
Stem 0
Stem Tuber 0
Unclassified 2.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1001636 3300001977 Bacteria 3586
2 JGI24740J21852_10000878 3300001979 Bacteria 13286
3 JGI24034J26672_10001534 3300002239 Bacteria 3068
4 JGI24742J22300_10012430 3300002244 Bacteria 1419
5 Ga0070683_100015946 3300005329 Bacteria 6610
6 Ga0070683_100023609 3300005329 Bacteria 5502
7 Ga0070670_100388559 3300005331 Bacteria 1230
8 Ga0070677_10000082 3300005333 Bacteria 30305
9 Ga0070682_100000030 3300005337 Bacteria 182768
10 Ga0070682_100509660 3300005337 Archaea 934
11 Ga0068868_100000033 3300005338 Bacteria 75402
12 Ga0070660_100533468 3300005339 Bacteria 978
13 Ga0070661_100000121 3300005344 Bacteria 65344
14 Ga0070668_100001145 3300005347 Bacteria 18672
15 Ga0070668_100260494 3300005347 Bacteria 1442
16 Ga0070674_100000002 3300005356 Bacteria 271088
17 Ga0070674_100000009 3300005356 Bacteria 143336
18 Ga0070673_100181306 3300005364 Bacteria 1803
19 Ga0070688_100030251 3300005365 Bacteria 3248
20 Ga0070659_100063824 3300005366 Bacteria 2914
21 Ga0070667_100007315 3300005367 Bacteria 9177
22 Ga0070711_100001969 3300005439 Bacteria 11529
23 Ga0070663_100199758 3300005455 Bacteria 1560
24 Ga0070663_100509916 3300005455 Unclassified 1000
25 Ga0070678_100010487 3300005456 Bacteria 5666
26 Ga0070662_100000002 3300005457 Bacteria 253208
27 Ga0070662_100000448 3300005457 Bacteria 24327
28 Ga0070685_10000053 3300005466 Bacteria 70868
29 Ga0070685_10001013 3300005466 Bacteria 15114
30 Ga0070685_10008855 3300005466 Bacteria 5189
31 Ga0070679_100193299 3300005530 Bacteria 2003
32 Ga0070684_100011055 3300005535 Bacteria 7180
33 Ga0070684_100091484 3300005535 Bacteria 2706
34 Ga0070684_100133010 3300005535 Bacteria 2245
35 Ga0070684_100640632 3300005535 Bacteria 989
36 Ga0068853_100016611 3300005539 Bacteria 6060
37 Ga0068853_100080887 3300005539 Bacteria 2844
38 Ga0068853_100227075 3300005539 Bacteria 1707
39 Ga0070672_100000112 3300005543 Bacteria 41002
40 Ga0070686_100000026 3300005544 Bacteria 126656
41 Ga0070686_100178001 3300005544 Bacteria 1509
42 Ga0070665_100062981 3300005548 Bacteria 3719
43 Ga0070665_100574069 3300005548 Bacteria 1141
44 Ga0070664_100011461 3300005564 Bacteria 7195
45 Ga0070664_100015617 3300005564 Bacteria 6214
46 Ga0068857_100132941 3300005577 Bacteria 2245
47 Ga0068854_100000333 3300005578 Bacteria 30901
48 Ga0068854_100006276 3300005578 Bacteria 7556
49 Ga0068856_100218348 3300005614 Bacteria 1922
50 Ga0068856_100580882 3300005614 Bacteria 1142
51 Ga0070702_100391366 3300005615 Bacteria 991
52 Ga0068852_100000002 3300005616 Bacteria 268221
53 Ga0068864_100000015 3300005618 Bacteria 303368
54 Ga0068866_10000003 3300005718 Bacteria 281675
55 Ga0068866_10001449 3300005718 Bacteria 10144
56 Ga0068866_10042954 3300005718 Bacteria 2253
57 Ga0068851_10006786 3300005834 Bacteria 5240
58 Ga0068863_100000779 3300005841 Bacteria 32033
59 Ga0068863_100026859 3300005841 Bacteria 5491
60 Ga0068863_100043624 3300005841 Bacteria 4257
61 Ga0068858_100464322 3300005842 Bacteria 1221
62 Ga0068860_100613870 3300005843 Bacteria 1094
63 Ga0068862_100000747 3300005844 Bacteria 32578
64 Ga0081455_10213895 3300005937 Bacteria 1434
65 Ga0081538_10055558 3300005981 Bacteria 2329
66 Ga0081540_1000123 3300005983 Bacteria 81914
67 Ga0081539_10001566 3300005985 Bacteria 37942
68 Ga0070715_10000001 3300006163 Bacteria 693690
69 Ga0097621_100205313 3300006237 Bacteria 1712
70 Ga0068871_100056518 3300006358 Bacteria 3190
71 Ga0075433_10001805 3300006852 Bacteria 16060
72 Ga0105251_10095909 3300009011 Bacteria 1359
73 Ga0105245_10000201 3300009098 Bacteria 57152
74 Ga0105245_10001198 3300009098 Bacteria 23459
75 Ga0105245_10007008 3300009098 Bacteria 9888
76 Ga0105247_10000206 3300009101 Bacteria 57601
77 Ga0105247_10174953 3300009101 Bacteria 1429
78 Ga0105243_10003464 3300009148 Bacteria 12741
79 Ga0105243_10335100 3300009148 Bacteria 1384
80 Ga0105242_10000062 3300009176 Bacteria 74936
81 Ga0105242_10000595 3300009176 Bacteria 28423
82 Ga0105242_10095993 3300009176 Bacteria 2503
83 Ga0105242_10104426 3300009176 Bacteria 2405
84 Ga0105238_10000003 3300009551 Bacteria 422077
85 Ga0105238_10000009 3300009551 Bacteria 288729
86 Ga0105249_10013668 3300009553 Bacteria 7168
87 Ga0105249_10790744 3300009553 Bacteria 1012
88 Ga0105239_10390620 3300010375 Bacteria 1574
89 Ga0157371_10006328 3300013102 Bacteria 9796
90 Ga0157370_10104152 3300013104 Bacteria 2656
91 Ga0157370_10155227 3300013104 Bacteria 2129
92 Ga0157369_10000014 3300013105 Bacteria 266411
93 Ga0157374_10022241 3300013296 Bacteria 5655
94 Ga0157374_10041105 3300013296 Bacteria 4259
95 Ga0157378_10278659 3300013297 Bacteria 1611
96 Ga0157372_10000210 3300013307 Bacteria 65290
97 Ga0157372_10425336 3300013307 Bacteria 1548
98 Ga0157375_10000584 3300013308 Bacteria 32509
99 Ga0157375_10000809 3300013308 Bacteria 27418
100 Ga0157375_10558987 3300013308 Bacteria 1305
101 Ga0163163_10370475 3300014325 Bacteria 1489
102 Ga0163163_10636211 3300014325 Unclassified 1130
103 Ga0163163_10736863 3300014325 Bacteria 1049
104 Ga0157380_10000376 3300014326 Bacteria 26882
105 Ga0157380_10241363 3300014326 Bacteria 1629
106 Ga0157379_10777497 3300014968 Unclassified 903
107 Ga0157376_10351564 3300014969 Bacteria 1411
108 Ga0163161_10000022 3300017792 Bacteria 207890
109 Ga0207656_10001461 3300025321 Bacteria 7829
110 Ga0207653_10091110 3300025885 Bacteria 1068
111 Ga0207682_10000018 3300025893 Bacteria 66215
112 Ga0207642_10000002 3300025899 Bacteria 658166
113 Ga0207642_10000353 3300025899 Bacteria 13789
114 Ga0207642_10145670 3300025899 Bacteria 1254
115 Ga0207710_10002663 3300025900 Bacteria 8226
116 Ga0207685_10000005 3300025905 Bacteria 289944
117 Ga0207663_10005529 3300025916 Bacteria 6373
118 Ga0207649_10000003 3300025920 Bacteria 388908
119 Ga0207652_10004713 3300025921 Bacteria 11056
120 Ga0207694_10000004 3300025924 Bacteria 967075
121 Ga0207694_10000077 3300025924 Bacteria 112188
122 Ga0207650_10452809 3300025925 Bacteria 1068
123 Ga0207687_10000020 3300025927 Bacteria 228407
124 Ga0207687_10000484 3300025927 Bacteria 26903
125 Ga0207687_10000851 3300025927 Bacteria 20636
126 Ga0207700_10000003 3300025928 Bacteria 500797
127 Ga0207664_10021209 3300025929 Bacteria 4826
128 Ga0207690_10002915 3300025932 Bacteria 10309
129 Ga0207706_10000001 3300025933 Bacteria 423014
130 Ga0207706_10000259 3300025933 Bacteria 57912
131 Ga0207686_10000231 3300025934 Bacteria 42432
132 Ga0207686_10000426 3300025934 Bacteria 28776
133 Ga0207686_10065470 3300025934 Bacteria 2318
134 Ga0207709_10009509 3300025935 Bacteria 5348
135 Ga0207669_10000001 3300025937 Bacteria 377747
136 Ga0207669_10000003 3300025937 Bacteria 252239
137 Ga0207704_10193499 3300025938 Bacteria 1481
138 Ga0207691_10000002 3300025940 Bacteria 189785
139 Ga0207661_10010612 3300025944 Bacteria 6638
140 Ga0207661_10015092 3300025944 Bacteria 5676
141 Ga0207679_10002319 3300025945 Bacteria 11707
142 Ga0207679_10024717 3300025945 Bacteria 4122
143 Ga0207651_10004579 3300025960 Bacteria 7000
144 Ga0207712_10000019 3300025961 Bacteria 317060
145 Ga0207712_10006981 3300025961 Bacteria 7121
146 Ga0207668_10001356 3300025972 Bacteria 14490
147 Ga0207668_10079580 3300025972 Bacteria 2371
148 Ga0207640_10000110 3300025981 Bacteria 61907
149 Ga0207640_10006888 3300025981 Bacteria 6250
150 Ga0207658_10002445 3300025986 Bacteria 13591
151 Ga0207677_10000343 3300026023 Bacteria 33031
152 Ga0207677_10001134 3300026023 Bacteria 14537
153 Ga0207703_10083001 3300026035 Bacteria 2676
154 Ga0207639_10037676 3300026041 Bacteria 3592
155 Ga0207639_10159956 3300026041 Bacteria 1897
156 Ga0207708_10228676 3300026075 Bacteria 1493
157 Ga0207702_10007849 3300026078 Bacteria 9052
158 Ga0207702_10079020 3300026078 Bacteria 2850
159 Ga0207702_10330965 3300026078 Bacteria 1453
160 Ga0207641_10002588 3300026088 Bacteria 16628
161 Ga0207641_10121250 3300026088 Bacteria 2334
162 Ga0207676_10000018 3300026095 Bacteria 306375
163 Ga0207683_10015536 3300026121 Bacteria 6482
164 Ga0207698_10000004 3300026142 Bacteria 313614
165 Ga0268266_10077960 3300028379 Bacteria 2882
166 Ga0268266_10674039 3300028379 Bacteria 996
167 Ga0268265_10005097 3300028380 Bacteria 9009
168 Ga0268264_10000969 3300028381 Bacteria 29417
169 Ga0268264_10088341 3300028381 Bacteria 2667
170 Ga0268264_10209292 3300028381 Bacteria 1789
171 Ga0265337_1000955 3300028556 Bacteria 15128
172 Ga0265326_10000041 3300028558 Bacteria 83872
173 Ga0265326_10058107 3300028558 Bacteria 1094
174 Ga0265319_1000014 3300028563 Bacteria 177623
175 Ga0265322_10000004 3300028654 Bacteria 275155
176 Ga0265322_10108706 3300028654 Archaea 789
177 Ga0265336_10005432 3300028666 Bacteria 4697
178 Ga0265336_10010927 3300028666 Bacteria 3097
179 Ga0265338_10000185 3300028800 Bacteria 116333
180 Ga0265324_10000266 3300029957 Bacteria 38549
181 Ga0265324_10070782 3300029957 Bacteria 1188
182 Ga0265320_10000029 3300031240 Bacteria 159627
183 Ga0265325_10046561 3300031241 Bacteria 2249
184 Ga0265339_10050660 3300031249 Bacteria 2270
185 Ga0265331_10086030 3300031250 Bacteria 1456
186 Ga0265327_10000015 3300031251 Bacteria 496677
187 Ga0316575_10000465 3300031665 Bacteria 11619
188 Ga0316579_10003259 3300031691 Bacteria 6296
189 Ga0265314_10000119 3300031711 Bacteria 122334
190 Ga0265342_10107643 3300031712 Bacteria 1581
191 Ga0316576_10000087 3300031727 Bacteria 32443
192 Ga0316578_10001892 3300031728 Bacteria 8842
193 Ga0316578_10226880 3300031728 Bacteria 1122
194 Ga0316577_10003838 3300031733 Bacteria 7658
195 Ga0307413_10270643 3300031824 Bacteria 1272
196 Ga0307406_10551906 3300031901 Bacteria 943
197 Ga0307412_10042158 3300031911 Bacteria 2963
198 Ga0307409_100130266 3300031995 Bacteria 2148
199 Ga0307416_100821552 3300032002 Bacteria 1026
200 Ga0307416_101149297 3300032002 Unclassified 882
201 Ga0307415_100000870 3300032126 Bacteria 13803
202 Ga0316583_10094405 3300032133 Bacteria 1043
203 Ga0316585_10001029 3300032137 Bacteria 7216
204 Ga0316580_10000107 3300032139 Bacteria 15287
205 Ga0316593_10000394 3300032168 Bacteria 7810
206 Ga0316587_1035698 3300033529 Bacteria 889
207 Ga0316596_1000411 3300033541 Bacteria 7126
208 Ga0373923_0130240 3300035111 Bacteria 1130
209 Ga0316574_0005091 3300035398 Bacteria 6983
210 Ga0373933_0607698 3300035724 Unclassified 718
211 Ga0373937_0027522 3300036401 Bacteria 5141
212 Ga0373937_0290440 3300036401 Bacteria 1545
213 Ga0373937_0373905 3300036401 Bacteria 1351
214 Ga0316582_0004765 3300036647 Bacteria 6911
215 Ga0316584_0019141 3300036712 Bacteria 4946
216 Ga0395899_0009678 3300037312 Bacteria 7397
217 Ga0395899_0068219 3300037312 Bacteria 2608
218 Ga0395900_0112368 3300037418 Bacteria 2797
219 Ga0395898_0003507 3300037466 Bacteria 17499
220 Ga0395905_0099276 3300037471 Bacteria 2734
221 Ga0395905_0115596 3300037471 Bacteria 2521
222 Ga0395901_0013568 3300038443 Bacteria 8287
223 Ga0395901_0024125 3300038443 Bacteria 6239
224 Ga0436360_0961099 3300039438 Bacteria 876
225 Ga0451800_1144989 3300041459 Bacteria 1050
226 Ga0451807_2015988 3300041486 Bacteria 1473
227 Ga0451807_2557324 3300041486 Bacteria 1069
228 Ga0451833_0382037 3300041491 Bacteria 2273
229 Ga0466969_0150181 3300044656 Bacteria 1074
230 Ga0466965_0335144 3300044683 Bacteria 826
231 Ga0466966_0083081 3300044684 Unclassified 1993
232 Ga0466961_0046177 3300044693 Bacteria 2786
233 Ga0466961_0118660 3300044693 Unclassified 1662
234 Ga0466963_0000127 3300044694 Bacteria 28865
235 Ga0466963_0057809 3300044694 Bacteria 2584
236 Ga0466957_0003429 3300044842 Bacteria 8705
237 Ga0466957_0113475 3300044842 Bacteria 1721
238 Ga0466959_0444900 3300045049 Bacteria 879
239 Ga0466958_0021104 3300045836 Bacteria 3802
240 Ga0466958_0068710 3300045836 Bacteria 2166
241 Ga0466958_0078670 3300045836 Unclassified 2027
242 Ga0466967_0000006 3300045976 Bacteria 144065
243 Ga0466967_0110030 3300045976 Bacteria 2530
244 Ga0495592_0005546 3300046454 Bacteria 9332
245 Ga0495592_0125425 3300046454 Bacteria 1802
246 Ga0495603_0000033 3300046455 Bacteria 57940
247 Ga0495603_0001486 3300046455 Bacteria 13638
248 Ga0495603_0088382 3300046455 Bacteria 1813
249 Ga0495629_0003072 3300046459 Bacteria 12684
250 Ga0495629_0041194 3300046459 Bacteria 3250
251 Ga0495629_0095306 3300046459 Bacteria 2076
252 Ga0495629_0143000 3300046459 Bacteria 1664
253 Ga0495629_0409881 3300046459 Bacteria 920
254 Ga0495641_0000014 3300046461 Bacteria 140908
255 Ga0495641_0176552 3300046461 Bacteria 956
256 Ga0495651_0054708 3300046462 Bacteria 3068
257 Ga0495651_0127312 3300046462 Bacteria 1864
258 Ga0495651_0171606 3300046462 Bacteria 1544
259 Ga0495653_0039868 3300046463 Bacteria 3676
260 Ga0495653_0069035 3300046463 Bacteria 2649
261 Ga0495653_0183381 3300046463 Bacteria 1434
262 Ga0495582_0000009 3300046473 Bacteria 123633
263 Ga0495662_0000698 3300046476 Bacteria 15931
264 Ga0495662_0018648 3300046476 Bacteria 3358
265 Ga0495662_0104392 3300046476 Bacteria 1387
266 Ga0495594_0000006 3300046499 Bacteria 167901
267 Ga0495606_0000463 3300046507 Bacteria 66752
268 Ga0495608_0000035 3300046511 Bacteria 133011
269 Ga0495608_0003187 3300046511 Bacteria 11744
270 Ga0495608_0115478 3300046511 Bacteria 1723
271 Ga0495608_0125113 3300046511 Bacteria 1647
272 Ga0495608_0412770 3300046511 Bacteria 825
273 Ga0495618_0000070 3300046514 Bacteria 72312
274 Ga0495618_0129331 3300046514 Bacteria 1616
275 Ga0495620_0002920 3300046515 Bacteria 9818
276 Ga0495628_0001620 3300046516 Bacteria 20621
277 Ga0495628_0059689 3300046516 Bacteria 2994
278 Ga0495628_0327391 3300046516 Bacteria 1130
279 Ga0495630_0000362 3300046517 Bacteria 35952
280 Ga0495630_0069317 3300046517 Bacteria 2653
281 Ga0495630_0131936 3300046517 Bacteria 1897
282 Ga0495630_0255355 3300046517 Bacteria 1339
283 Ga0495643_0000692 3300046522 Bacteria 38937
284 Ga0495652_0000010 3300046529 Bacteria 261584
285 Ga0495652_0103187 3300046529 Bacteria 2309
286 Ga0495652_0376965 3300046529 Bacteria 1010
287 Ga0495640_0098475 3300046533 Bacteria 1922
288 Ga0495640_0100282 3300046533 Bacteria 1902
289 Ga0495586_0439969 3300046535 Unclassified 751
290 Ga0495586_0483345 3300046535 Unclassified 714
291 Ga0495587_0001789 3300046536 Bacteria 14353
292 Ga0495587_0085772 3300046536 Bacteria 1823
293 Ga0495587_0097278 3300046536 Bacteria 1697
294 Ga0495587_0303004 3300046536 Bacteria 893
295 Ga0495621_0004240 3300046539 Bacteria 4011
296 Ga0495645_0010315 3300046543 Bacteria 6549
297 Ga0495645_0337540 3300046543 Bacteria 974
298 Ga0495622_0000132 3300046557 Bacteria 63863
299 Ga0495667_0000258 3300046559 Bacteria 34340
300 Ga0495667_0229977 3300046559 Bacteria 1182
301 Ga0495667_0365247 3300046559 Bacteria 911
302 Ga0495656_0001129 3300046615 Bacteria 8678
303 Ga0495668_0047700 3300046616 Bacteria 2378
304 Ga0495634_0000216 3300046642 Bacteria 53765
305 Ga0495634_0004828 3300046642 Bacteria 10464
306 Ga0495634_0100139 3300046642 Bacteria 1873
307 Ga0495634_0354449 3300046642 Bacteria 878
308 Ga0495635_0000057 3300046663 Bacteria 67714
309 Ga0495588_0000229 3300046674 Bacteria 50351
310 Ga0495657_0000026 3300046675 Bacteria 133011
311 Ga0495657_0007638 3300046675 Bacteria 8330
312 Ga0495657_0055122 3300046675 Bacteria 2653
313 Ga0495599_0020843 3300046678 Bacteria 4085
314 Ga0495599_0065495 3300046678 Bacteria 2270
315 Ga0495599_0131563 3300046678 Bacteria 1554
316 Ga0495646_0247519 3300046680 Archaea 956
317 Ga0495647_0000023 3300046681 Bacteria 67025
318 Ga0495647_0009332 3300046681 Bacteria 3321
319 Ga0495647_0031055 3300046681 Bacteria 1985
320 Ga0495658_0000002 3300046683 Bacteria 309651
321 Ga0495658_0106634 3300046683 Bacteria 1680
322 Ga0495669_0000282 3300046684 Bacteria 29109
323 Ga0495613_0000032 3300046689 Bacteria 139806
324 Ga0495613_0002007 3300046689 Bacteria 15449
325 Ga0495613_0052954 3300046689 Bacteria 2988
326 Ga0495613_0132337 3300046689 Bacteria 1786
327 Ga0495624_0000071 3300046690 Bacteria 65995
328 Ga0495624_0001926 3300046690 Bacteria 15801
329 Ga0495649_0003071 3300046694 Bacteria 11425
330 Ga0495600_0006556 3300046809 Bacteria 7086
331 Ga0495600_0021861 3300046809 Bacteria 4102
332 Ga0495600_0378377 3300046809 Bacteria 883
333 Ga0495604_0000100 3300047317 Bacteria 72995
334 Ga0495604_0000305 3300047317 Bacteria 44020
335 Ga0495674_0000010 3300047319 Bacteria 285794
336 Ga0495672_0135762 3300047320 Bacteria 1290
337 Ga0495676_0009565 3300047321 Bacteria 8822
338 Ga0495676_0112630 3300047321 Bacteria 1993
339 Ga0495676_0132599 3300047321 Bacteria 1796
340 Ga0495680_0000312 3300047322 Bacteria 54495
341 Ga0495680_0003440 3300047322 Bacteria 15615
342 Ga0495680_0034290 3300047322 Bacteria 4101
343 Ga0495680_0112420 3300047322 Bacteria 2017
344 Ga0495675_0000015 3300047444 Bacteria 133004
345 Ga0495675_0061786 3300047444 Bacteria 2373
346 Ga0495684_0050501 3300047471 Bacteria 3175
347 Ga0495684_0066579 3300047471 Bacteria 2739
348 Ga0495686_0458170 3300047472 Bacteria 676
349 Ga0495593_0274093 3300047673 Bacteria 844
350 Ga0495602_0000227 3300048088 Bacteria 52680
351 Ga0495602_0001969 3300048088 Bacteria 20606
352 Ga0495602_0015468 3300048088 Bacteria 7699
353 Ga0496100_0000001 3300048903 Bacteria 530179
354 Ga0496100_0000010 3300048903 Bacteria 205204
355 Ga0496101_0000004 3300048904 Bacteria 331599
356 Ga0496101_0000025 3300048904 Bacteria 205204
357 Ga0496102_0002490 3300048905 Bacteria 15727
358 Ga0496102_0297212 3300048905 Bacteria 1522
359 Ga0496102_0367512 3300048905 Bacteria 1354
360 Ga0496103_0000057 3300048906 Bacteria 142223
361 Ga0496103_0300063 3300048906 Bacteria 1033
362 Ga0496104_0000015 3300048907 Bacteria 374530
363 Ga0496104_0000024 3300048907 Bacteria 229913
364 Ga0496104_0000213 3300048907 Bacteria 51219
365 Ga0496104_0094409 3300048907 Bacteria 2862
366 Ga0496105_0000004 3300048908 Bacteria 475798
367 Ga0496105_0000013 3300048908 Bacteria 229894
368 Ga0496105_0000059 3300048908 Bacteria 86884
369 Ga0496106_0000012 3300048909 Bacteria 205158
370 Ga0496106_0000091 3300048909 Bacteria 71361
371 Ga0496106_0000356 3300048909 Bacteria 32385
372 Ga0496106_0164476 3300048909 Bacteria 1756
373 Ga0496107_0000002 3300048910 Bacteria 320871
374 Ga0496107_0000010 3300048910 Bacteria 205188
375 Ga0496108_0000005 3300048911 Bacteria 535059
376 Ga0496108_0000006 3300048911 Bacteria 469473
377 Ga0496108_0000232 3300048911 Bacteria 49846
378 Ga0496108_0013086 3300048911 Bacteria 6762
379 Ga0496108_0192077 3300048911 Bacteria 1770
380 Ga0496109_0000002 3300048912 Bacteria 443393
381 Ga0496109_0000004 3300048912 Bacteria 404818
382 Ga0496109_0000044 3300048912 Bacteria 133779
383 Ga0496109_0111941 3300048912 Bacteria 2538
384 Ga0496109_0126031 3300048912 Bacteria 2388
385 Ga0496109_0145771 3300048912 Bacteria 2215
386 Ga0496109_0430622 3300048912 Bacteria 1246
387 Ga0496110_0028377 3300048913 Bacteria 4807
388 Ga0496110_0064915 3300048913 Bacteria 3227
389 Ga0496110_0115091 3300048913 Bacteria 2420
390 Ga0496110_0195035 3300048913 Bacteria 1839
391 Ga0496110_0281734 3300048913 Bacteria 1514
392 Ga0496112_0000006 3300048915 Bacteria 365227
393 Ga0496112_0018954 3300048915 Bacteria 6486
394 Ga0496112_0866937 3300048915 Bacteria 826
395 Ga0496113_0000434 3300048916 Bacteria 20290
396 Ga0496113_0007952 3300048916 Bacteria 6867
397 Ga0496113_0027941 3300048916 Bacteria 4051
398 Ga0496113_0227155 3300048916 Bacteria 1488
399 Ga0496114_0000056 3300048917 Bacteria 95692
400 Ga0496114_0022975 3300048917 Bacteria 5084
401 Ga0496115_0000016 3300048918 Bacteria 187067
402 Ga0496115_0000031 3300048918 Bacteria 138258
403 Ga0496115_0012760 3300048918 Bacteria 6334
404 Ga0496115_0206100 3300048918 Bacteria 1624
405 Ga0496116_0000257 3300048919 Bacteria 93214
406 Ga0496117_0002686 3300048920 Bacteria 21983
407 Ga0496118_0002280 3300048921 Bacteria 26182
408 Ga0496118_0066682 3300048921 Bacteria 2626
409 Ga0496118_0137101 3300048921 Bacteria 1559
410 Ga0496119_0012123 3300048922 Bacteria 7038
411 Ga0496120_0007583 3300048923 Bacteria 8047
412 Ga0496120_0119749 3300048923 Bacteria 1363
413 Ga0496121_0191752 3300048924 Bacteria 1464
414 Ga0496125_0123426 3300048928 Bacteria 1841
415 Ga0496125_0279716 3300048928 Bacteria 1034
416 Ga0501036_0368884 3300049572 Bacteria 1198
417 Ga0501042_0116397 3300049578 Bacteria 1924
418 Ga0501068_0121508 3300049584 Bacteria 1629
419 Ga0501070_0143322 3300049586 Bacteria 1972
420 Ga0501070_0398666 3300049586 Unclassified 1113
421 Ga0501072_0147756 3300049588 Bacteria 1874
422 Ga0501075_0004268 3300049591 Bacteria 9657
423 Ga0501075_0457578 3300049591 Bacteria 973
424 Ga0501076_0178682 3300049592 Bacteria 1730
425 Ga0501079_0080601 3300049741 Bacteria 2517
426 Ga0501080_0147815 3300049742 Bacteria 2173
427 Ga0501081_0264576 3300049743 Bacteria 1257
428 Ga0501083_0070821 3300049744 Bacteria 2318
429 nmdc:mga03n38_149936_c1 3300050490 Bacteria 1172
430 nmdc:mga0yw44_206055_c1 3300050492 Bacteria 1300
431 nmdc:mga06z11_377514_c1 3300050494 Bacteria 851
432 nmdc:mga06z11_98485_c1 3300050494 Bacteria 1600
433 nmdc:mga05p37_1004224_c1 3300050507 Archaea 886
434 nmdc:mga0a205_386_c1 3300050515 Bacteria 33461
435 nmdc:mga0a205_94_c1 3300050515 Bacteria 50261
436 Ga0495601_0000057 3300053077 Bacteria 61510
437 Ga0495601_0004750 3300053077 Bacteria 7876
438 Ga0495601_0018786 3300053077 Bacteria 4209
439 Ga0495601_0037609 3300053077 Bacteria 3026
440 Ga0495601_0083057 3300053077 Bacteria 2057
441 Ga0495601_0090403 3300053077 Bacteria 1969
442 Ga0495612_0000031 3300053078 Bacteria 80955
443 Ga0495612_0001793 3300053078 Bacteria 8799
444 Ga0495612_0006253 3300053078 Bacteria 4906
445 Ga0495612_0158883 3300053078 Bacteria 986
446 Ga0495655_0000005 3300053083 Bacteria 257472
447 Ga0495595_0000017 3300053084 Bacteria 133011
448 Ga0495595_0000130 3300053084 Bacteria 31250
449 Ga0495595_0157975 3300053084 Bacteria 1118
450 Ga0495595_0191021 3300053084 Bacteria 1018
451 Ga0495619_0000010 3300053085 Bacteria 302390
452 Ga0495619_0000082 3300053085 Bacteria 71788
453 Ga0495619_0000146 3300053085 Bacteria 52136
454 Ga0495619_0001050 3300053085 Bacteria 18097
455 Ga0495619_0002897 3300053085 Bacteria 11142
456 Ga0495619_0003619 3300053085 Bacteria 9953
457 Ga0495619_0008902 3300053085 Bacteria 6340
458 Ga0495619_0086345 3300053085 Bacteria 2120
459 Ga0495619_0089148 3300053085 Bacteria 2087
460 Ga0495619_0274377 3300053085 Bacteria 1168
461 Ga0495619_0281361 3300053085 Bacteria 1153
462 Ga0500566_0000943 3300053094 Bacteria 16679
463 Ga0500614_011688 3300053123 Bacteria 1905
464 Ga0500628_000001 3300053129 Bacteria 564074
465 Ga0500628_001405 3300053129 Bacteria 4125
466 Ga0501084_0945833 3300054114 Bacteria 724

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025885 Ga0207653_10091110 Ga0207653_100911102 173
2 3300009551 Ga0105238_10000003 Ga0105238_1000000352 179
3 3300025924 Ga0207694_10000077 Ga0207694_1000007752 179
4 3300005466 Ga0070685_10008855 Ga0070685_100088554 182
5 3300005466 Ga0070685_10001013 Ga0070685_1000101314 184
6 3300005577 Ga0068857_100132941 Ga0068857_1001329412 198
7 3300047321 Ga0495676_0009565 Ga0495676_0009565_5947_6564 198
8 3300048903 Ga0496100_0000001 Ga0496100_0000001_214478_215095 198
9 3300048904 Ga0496101_0000004 Ga0496101_0000004_15830_16447 198
10 3300048909 Ga0496106_0000091 Ga0496106_0000091_8143_8760 198
11 3300048910 Ga0496107_0000002 Ga0496107_0000002_33393_34010 198
12 3300048915 Ga0496112_0866937 Ga0496112_0866937_84_701 198
13 3300050492 nmdc:mga0yw44_206055_c1 nmdc:mga0yw44_206055_c1_38_676 198
14 3300014325 Ga0163163_10636211 Ga0163163_106362112 199
15 3300044684 Ga0466966_0083081 Ga0466966_0083081_65_679 199
16 3300044693 Ga0466961_0118660 Ga0466961_0118660_60_674 199
17 3300045049 Ga0466959_0444900 Ga0466959_0444900_235_849 199
18 3300045836 Ga0466958_0021104 Ga0466958_0021104_204_818 199
19 3300045836 Ga0466958_0078670 Ga0466958_0078670_1154_1768 199
20 3300048907 Ga0496104_0094409 Ga0496104_0094409_446_1045 199
21 3300048918 Ga0496115_0206100 Ga0496115_0206100_717_1340 199
22 3300050507 nmdc:mga05p37_1004224_c1 nmdc:mga05p37_1004224_c1_62_661 199
23 3300005339 Ga0070660_100533468 Ga0070660_1005334681 200
24 3300044694 Ga0466963_0000127 Ga0466963_0000127_23975_24577 200
25 3300045976 Ga0466967_0000006 Ga0466967_0000006_78839_79441 200
26 3300048911 Ga0496108_0000006 Ga0496108_0000006_54556_55158 200
27 3300048912 Ga0496109_0000004 Ga0496109_0000004_227299_227901 200
28 3300048928 Ga0496125_0279716 Ga0496125_0279716_279_881 200
29 3300050494 nmdc:mga06z11_377514_c1 nmdc:mga06z11_377514_c1_166_837 200
30 3300005615 Ga0070702_100391366 Ga0070702_1003913661 201
31 3300005718 Ga0068866_10000003 Ga0068866_10000003116 201
32 3300025899 Ga0207642_10000002 Ga0207642_10000002368 201
33 3300025905 Ga0207685_10000005 Ga0207685_1000000578 201
34 3300025932 Ga0207690_10002915 Ga0207690_100029159 201
35 3300025937 Ga0207669_10000001 Ga0207669_10000001174 201
36 3300028381 Ga0268264_10000969 Ga0268264_1000096924 201
37 3300044842 Ga0466957_0113475 Ga0466957_0113475_71_676 201
38 3300046454 Ga0495592_0005546 Ga0495592_0005546_4436_5041 201
39 3300046455 Ga0495603_0088382 Ga0495603_0088382_129_734 201
40 3300046462 Ga0495651_0171606 Ga0495651_0171606_596_1201 201
41 3300046463 Ga0495653_0039868 Ga0495653_0039868_1426_2031 201
42 3300046476 Ga0495662_0000698 Ga0495662_0000698_4231_4836 201
43 3300046511 Ga0495608_0003187 Ga0495608_0003187_6956_7561 201
44 3300046514 Ga0495618_0129331 Ga0495618_0129331_735_1340 201
45 3300046516 Ga0495628_0059689 Ga0495628_0059689_1079_1684 201
46 3300046529 Ga0495652_0103187 Ga0495652_0103187_1041_1646 201
47 3300046535 Ga0495586_0439969 Ga0495586_0439969_81_686 201
48 3300046536 Ga0495587_0097278 Ga0495587_0097278_211_816 201
49 3300046678 Ga0495599_0065495 Ga0495599_0065495_1060_1665 201
50 3300046681 Ga0495647_0009332 Ga0495647_0009332_2018_2623 201
51 3300047322 Ga0495680_0000312 Ga0495680_0000312_52643_53248 201
52 3300049592 Ga0501076_0178682 Ga0501076_0178682_690_1295 201
53 3300053077 Ga0495601_0037609 Ga0495601_0037609_424_1029 201
54 3300053084 Ga0495595_0000130 Ga0495595_0000130_15431_16036 201
55 3300031911 Ga0307412_10042158 Ga0307412_100421583 202
56 3300005364 Ga0070673_100181306 Ga0070673_1001813062 203
57 3300005539 Ga0068853_100016611 Ga0068853_1000166114 203
58 3300025960 Ga0207651_10004579 Ga0207651_100045792 203
59 3300026041 Ga0207639_10037676 Ga0207639_100376763 203
60 3300044656 Ga0466969_0150181 Ga0466969_0150181_28_663 204
61 3300044693 Ga0466961_0046177 Ga0466961_0046177_219_854 204
62 3300046683 Ga0495658_0106634 Ga0495658_0106634_888_1520 204
63 3300053129 Ga0500628_001405 Ga0500628_001405_209_847 204
64 3300005457 Ga0070662_100000448 Ga0070662_10000044818 205
65 3300005544 Ga0070686_100000026 Ga0070686_10000002696 205
66 3300025933 Ga0207706_10000259 Ga0207706_1000025911 205
67 3300046522 Ga0495643_0000692 Ga0495643_0000692_17775_18452 205
68 3300005937 Ga0081455_10213895 Ga0081455_102138952 206
69 3300005981 Ga0081538_10055558 Ga0081538_100555583 206
70 3300005985 Ga0081539_10001566 Ga0081539_100015661 206
71 3300009148 Ga0105243_10335100 Ga0105243_103351002 206
72 3300031665 Ga0316575_10000465 Ga0316575_100004657 206
73 3300031691 Ga0316579_10003259 Ga0316579_100032591 206
74 3300031727 Ga0316576_10000087 Ga0316576_1000008728 206
75 3300031728 Ga0316578_10001892 Ga0316578_100018926 206
76 3300031728 Ga0316578_10226880 Ga0316578_102268801 206
77 3300031733 Ga0316577_10003838 Ga0316577_100038383 206
78 3300031901 Ga0307406_10551906 Ga0307406_105519062 206
79 3300032002 Ga0307416_100821552 Ga0307416_1008215522 206
80 3300032137 Ga0316585_10001029 Ga0316585_100010294 206
81 3300032139 Ga0316580_10000107 Ga0316580_100001079 206
82 3300032168 Ga0316593_10000394 Ga0316593_100003948 206
83 3300033529 Ga0316587_1035698 Ga0316587_10356981 206
84 3300033541 Ga0316596_1000411 Ga0316596_10004118 206
85 3300035398 Ga0316574_0005091 Ga0316574_0005091_2169_2807 206
86 3300036647 Ga0316582_0004765 Ga0316582_0004765_3054_3692 206
87 3300036712 Ga0316584_0019141 Ga0316584_0019141_4177_4815 206
88 3300039438 Ga0436360_0961099 Ga0436360_0961099_142_780 206
89 3300044683 Ga0466965_0335144 Ga0466965_0335144_37_696 206
90 3300050490 nmdc:mga03n38_149936_c1 nmdc:mga03n38_149936_c1_495_1133 206
91 3300050494 nmdc:mga06z11_98485_c1 nmdc:mga06z11_98485_c1_214_852 206
92 3300005543 Ga0070672_100000112 Ga0070672_1000001122 208
93 3300005841 Ga0068863_100043624 Ga0068863_1000436246 208
94 3300005842 Ga0068858_100464322 Ga0068858_1004643221 208
95 3300009011 Ga0105251_10095909 Ga0105251_100959092 208
96 3300009101 Ga0105247_10174953 Ga0105247_101749532 208
97 3300025940 Ga0207691_10000002 Ga0207691_10000002162 208
98 3300026088 Ga0207641_10121250 Ga0207641_101212502 208
99 3300032002 Ga0307416_101149297 Ga0307416_1011492971 208
100 3300037312 Ga0395899_0009678 Ga0395899_0009678_1705_2394 208
101 3300037312 Ga0395899_0068219 Ga0395899_0068219_678_1304 208
102 3300037418 Ga0395900_0112368 Ga0395900_0112368_586_1212 208
103 3300037466 Ga0395898_0003507 Ga0395898_0003507_1928_2554 208
104 3300037471 Ga0395905_0099276 Ga0395905_0099276_926_1615 208
105 3300037471 Ga0395905_0115596 Ga0395905_0115596_191_817 208
106 3300038443 Ga0395901_0013568 Ga0395901_0013568_7182_7808 208
107 3300038443 Ga0395901_0024125 Ga0395901_0024125_556_1245 208
108 3300041491 Ga0451833_0382037 Ga0451833_0382037_600_1247 208
109 3300046499 Ga0495594_0000006 Ga0495594_0000006_81104_81751 208
110 3300046557 Ga0495622_0000132 Ga0495622_0000132_53810_54457 208
111 3300048906 Ga0496103_0300063 Ga0496103_0300063_271_900 208
112 3300048918 Ga0496115_0000016 Ga0496115_0000016_171273_171926 208
113 3300005344 Ga0070661_100000121 Ga0070661_10000012131 209
114 3300005530 Ga0070679_100193299 Ga0070679_1001932992 209
115 3300013308 Ga0157375_10000584 Ga0157375_1000058421 209
116 3300025921 Ga0207652_10004713 Ga0207652_1000471313 209
117 3300032126 Ga0307415_100000870 Ga0307415_1000008706 209
118 3300046516 Ga0495628_0327391 Ga0495628_0327391_258_887 209
119 3300046517 Ga0495630_0000362 Ga0495630_0000362_28713_29342 209
120 3300046675 Ga0495657_0055122 Ga0495657_0055122_1709_2338 209
121 3300047317 Ga0495604_0000100 Ga0495604_0000100_4459_5112 209
122 3300047471 Ga0495684_0066579 Ga0495684_0066579_1008_1637 209
123 3300048924 Ga0496121_0191752 Ga0496121_0191752_273_902 209
124 3300049744 Ga0501083_0070821 Ga0501083_0070821_1080_1709 209
125 3300053077 Ga0495601_0004750 Ga0495601_0004750_5300_5929 209
126 3300053078 Ga0495612_0158883 Ga0495612_0158883_43_672 209
127 3300053085 Ga0495619_0274377 Ga0495619_0274377_247_876 209
128 3300005337 Ga0070682_100509660 Ga0070682_1005096601 210
129 3300005356 Ga0070674_100000002 Ga0070674_100000002158 210
130 3300005365 Ga0070688_100030251 Ga0070688_1000302511 210
131 3300005455 Ga0070663_100509916 Ga0070663_1005099161 210
132 3300005535 Ga0070684_100091484 Ga0070684_1000914842 210
133 3300005539 Ga0068853_100080887 Ga0068853_1000808873 210
134 3300005578 Ga0068854_100000333 Ga0068854_10000033315 210
135 3300005616 Ga0068852_100000002 Ga0068852_10000000231 210
136 3300005718 Ga0068866_10001449 Ga0068866_1000144910 210
137 3300005834 Ga0068851_10006786 Ga0068851_100067862 210
138 3300005983 Ga0081540_1000123 Ga0081540_100012353 210
139 3300009098 Ga0105245_10007008 Ga0105245_100070083 210
140 3300009176 Ga0105242_10104426 Ga0105242_101044262 210
141 3300013102 Ga0157371_10006328 Ga0157371_100063282 210
142 3300013104 Ga0157370_10104152 Ga0157370_101041523 210
143 3300013105 Ga0157369_10000014 Ga0157369_10000014120 210
144 3300013307 Ga0157372_10000210 Ga0157372_1000021021 210
145 3300014326 Ga0157380_10241363 Ga0157380_102413632 210
146 3300014969 Ga0157376_10351564 Ga0157376_103515642 210
147 3300025321 Ga0207656_10001461 Ga0207656_100014616 210
148 3300025899 Ga0207642_10000353 Ga0207642_100003534 210
149 3300025927 Ga0207687_10000851 Ga0207687_100008513 210
150 3300025934 Ga0207686_10065470 Ga0207686_100654702 210
151 3300025937 Ga0207669_10000003 Ga0207669_10000003136 210
152 3300025981 Ga0207640_10000110 Ga0207640_1000011014 210
153 3300026041 Ga0207639_10159956 Ga0207639_101599562 210
154 3300026078 Ga0207702_10007849 Ga0207702_100078492 210
155 3300026142 Ga0207698_10000004 Ga0207698_10000004254 210
156 3300044694 Ga0466963_0057809 Ga0466963_0057809_1273_1905 210
157 3300044842 Ga0466957_0003429 Ga0466957_0003429_4242_4874 210
158 3300046463 Ga0495653_0183381 Ga0495653_0183381_408_1040 210
159 3300046476 Ga0495662_0018648 Ga0495662_0018648_1061_1693 210
160 3300046511 Ga0495608_0000035 Ga0495608_0000035_123_755 210
161 3300046674 Ga0495588_0000229 Ga0495588_0000229_18950_19582 210
162 3300046675 Ga0495657_0000026 Ga0495657_0000026_132257_132889 210
163 3300046684 Ga0495669_0000282 Ga0495669_0000282_10270_10902 210
164 3300047444 Ga0495675_0000015 Ga0495675_0000015_132250_132882 210
165 3300048911 Ga0496108_0000005 Ga0496108_0000005_114877_115509 210
166 3300048912 Ga0496109_0000002 Ga0496109_0000002_419583_420215 210
167 3300048912 Ga0496109_0126031 Ga0496109_0126031_1517_2149 210
168 3300048912 Ga0496109_0430622 Ga0496109_0430622_474_1106 210
169 3300048913 Ga0496110_0115091 Ga0496110_0115091_427_1059 210
170 3300048915 Ga0496112_0018954 Ga0496112_0018954_1003_1635 210
171 3300048916 Ga0496113_0000434 Ga0496113_0000434_1272_1904 210
172 3300053084 Ga0495595_0000017 Ga0495595_0000017_132257_132889 210
173 3300053085 Ga0495619_0000082 Ga0495619_0000082_543_1175 210
174 3300053085 Ga0495619_0001050 Ga0495619_0001050_17343_17975 210
175 3300001977 JGI24746J21847_1001636 JGI24746J21847_10016362 211
176 3300001979 JGI24740J21852_10000878 JGI24740J21852_100008784 211
177 3300002239 JGI24034J26672_10001534 JGI24034J26672_100015342 211
178 3300002244 JGI24742J22300_10012430 JGI24742J22300_100124302 211
179 3300005329 Ga0070683_100015946 Ga0070683_1000159463 211
180 3300005329 Ga0070683_100023609 Ga0070683_1000236096 211
181 3300005331 Ga0070670_100388559 Ga0070670_1003885592 211
182 3300005333 Ga0070677_10000082 Ga0070677_1000008225 211
183 3300005337 Ga0070682_100000030 Ga0070682_10000003013 211
184 3300005338 Ga0068868_100000033 Ga0068868_10000003352 211
185 3300005347 Ga0070668_100001145 Ga0070668_1000011456 211
186 3300005347 Ga0070668_100260494 Ga0070668_1002604942 211
187 3300005356 Ga0070674_100000009 Ga0070674_10000000926 211
188 3300005366 Ga0070659_100063824 Ga0070659_1000638242 211
189 3300005367 Ga0070667_100007315 Ga0070667_1000073155 211
190 3300005439 Ga0070711_100001969 Ga0070711_1000019696 211
191 3300005455 Ga0070663_100199758 Ga0070663_1001997582 211
192 3300005456 Ga0070678_100010487 Ga0070678_1000104873 211
193 3300005457 Ga0070662_100000002 Ga0070662_10000000261 211
194 3300005466 Ga0070685_10000053 Ga0070685_1000005315 211
195 3300005535 Ga0070684_100011055 Ga0070684_1000110555 211
196 3300005535 Ga0070684_100133010 Ga0070684_1001330102 211
197 3300005535 Ga0070684_100640632 Ga0070684_1006406321 211
198 3300005539 Ga0068853_100227075 Ga0068853_1002270752 211
199 3300005544 Ga0070686_100178001 Ga0070686_1001780012 211
200 3300005548 Ga0070665_100062981 Ga0070665_1000629813 211
201 3300005548 Ga0070665_100574069 Ga0070665_1005740692 211
202 3300005564 Ga0070664_100011461 Ga0070664_1000114613 211
203 3300005564 Ga0070664_100015617 Ga0070664_1000156176 211
204 3300005578 Ga0068854_100006276 Ga0068854_1000062765 211
205 3300005614 Ga0068856_100218348 Ga0068856_1002183482 211
206 3300005614 Ga0068856_100580882 Ga0068856_1005808821 211
207 3300005618 Ga0068864_100000015 Ga0068864_10000001531 211
208 3300005718 Ga0068866_10042954 Ga0068866_100429542 211
209 3300005841 Ga0068863_100000779 Ga0068863_10000077926 211
210 3300005841 Ga0068863_100026859 Ga0068863_1000268598 211
211 3300005843 Ga0068860_100613870 Ga0068860_1006138701 211
212 3300005844 Ga0068862_100000747 Ga0068862_10000074729 211
213 3300006163 Ga0070715_10000001 Ga0070715_10000001653 211
214 3300006237 Ga0097621_100205313 Ga0097621_1002053132 211
215 3300006358 Ga0068871_100056518 Ga0068871_1000565183 211
216 3300006852 Ga0075433_10001805 Ga0075433_1000180514 211
217 3300009098 Ga0105245_10000201 Ga0105245_1000020129 211
218 3300009098 Ga0105245_10001198 Ga0105245_100011988 211
219 3300009101 Ga0105247_10000206 Ga0105247_1000020634 211
220 3300009148 Ga0105243_10003464 Ga0105243_100034643 211
221 3300009176 Ga0105242_10000062 Ga0105242_1000006260 211
222 3300009176 Ga0105242_10000595 Ga0105242_100005959 211
223 3300009176 Ga0105242_10095993 Ga0105242_100959932 211
224 3300009551 Ga0105238_10000009 Ga0105238_10000009142 211
225 3300009553 Ga0105249_10013668 Ga0105249_100136686 211
226 3300009553 Ga0105249_10790744 Ga0105249_107907442 211
227 3300010375 Ga0105239_10390620 Ga0105239_103906202 211
228 3300013104 Ga0157370_10155227 Ga0157370_101552272 211
229 3300013296 Ga0157374_10022241 Ga0157374_100222416 211
230 3300013296 Ga0157374_10041105 Ga0157374_100411052 211
231 3300013297 Ga0157378_10278659 Ga0157378_102786592 211
232 3300013307 Ga0157372_10425336 Ga0157372_104253362 211
233 3300013308 Ga0157375_10000809 Ga0157375_1000080920 211
234 3300013308 Ga0157375_10558987 Ga0157375_105589872 211
235 3300014325 Ga0163163_10370475 Ga0163163_103704752 211
236 3300014325 Ga0163163_10736863 Ga0163163_107368631 211
237 3300014326 Ga0157380_10000376 Ga0157380_100003762 211
238 3300014968 Ga0157379_10777497 Ga0157379_107774971 211
239 3300017792 Ga0163161_10000022 Ga0163161_10000022155 211
240 3300025893 Ga0207682_10000018 Ga0207682_1000001821 211
241 3300025899 Ga0207642_10145670 Ga0207642_101456702 211
242 3300025900 Ga0207710_10002663 Ga0207710_100026639 211
243 3300025916 Ga0207663_10005529 Ga0207663_100055295 211
244 3300025920 Ga0207649_10000003 Ga0207649_10000003288 211
245 3300025924 Ga0207694_10000004 Ga0207694_10000004153 211
246 3300025925 Ga0207650_10452809 Ga0207650_104528092 211
247 3300025927 Ga0207687_10000020 Ga0207687_10000020168 211
248 3300025927 Ga0207687_10000484 Ga0207687_100004846 211
249 3300025928 Ga0207700_10000003 Ga0207700_10000003484 211
250 3300025929 Ga0207664_10021209 Ga0207664_100212092 211
251 3300025933 Ga0207706_10000001 Ga0207706_10000001241 211
252 3300025934 Ga0207686_10000231 Ga0207686_1000023128 211
253 3300025934 Ga0207686_10000426 Ga0207686_1000042618 211
254 3300025935 Ga0207709_10009509 Ga0207709_100095093 211
255 3300025938 Ga0207704_10193499 Ga0207704_101934992 211
256 3300025944 Ga0207661_10010612 Ga0207661_100106126 211
257 3300025944 Ga0207661_10015092 Ga0207661_100150922 211
258 3300025945 Ga0207679_10002319 Ga0207679_1000231912 211
259 3300025945 Ga0207679_10024717 Ga0207679_100247174 211
260 3300025961 Ga0207712_10000019 Ga0207712_10000019138 211
261 3300025961 Ga0207712_10006981 Ga0207712_100069816 211
262 3300025972 Ga0207668_10001356 Ga0207668_100013566 211
263 3300025972 Ga0207668_10079580 Ga0207668_100795802 211
264 3300025981 Ga0207640_10006888 Ga0207640_100068883 211
265 3300025986 Ga0207658_10002445 Ga0207658_100024456 211
266 3300026023 Ga0207677_10000343 Ga0207677_1000034321 211
267 3300026023 Ga0207677_10001134 Ga0207677_1000113412 211
268 3300026035 Ga0207703_10083001 Ga0207703_100830012 211
269 3300026075 Ga0207708_10228676 Ga0207708_102286762 211
270 3300026078 Ga0207702_10079020 Ga0207702_100790202 211
271 3300026078 Ga0207702_10330965 Ga0207702_103309652 211
272 3300026088 Ga0207641_10002588 Ga0207641_1000258816 211
273 3300026095 Ga0207676_10000018 Ga0207676_10000018269 211
274 3300026121 Ga0207683_10015536 Ga0207683_100155365 211
275 3300028379 Ga0268266_10077960 Ga0268266_100779603 211
276 3300028379 Ga0268266_10674039 Ga0268266_106740392 211
277 3300028380 Ga0268265_10005097 Ga0268265_1000509710 211
278 3300028381 Ga0268264_10088341 Ga0268264_100883412 211
279 3300028381 Ga0268264_10209292 Ga0268264_102092922 211
280 3300028556 Ga0265337_1000955 Ga0265337_10009558 211
281 3300028558 Ga0265326_10000041 Ga0265326_1000004174 211
282 3300028558 Ga0265326_10058107 Ga0265326_100581072 211
283 3300028563 Ga0265319_1000014 Ga0265319_100001418 211
284 3300028654 Ga0265322_10000004 Ga0265322_1000000474 211
285 3300028654 Ga0265322_10108706 Ga0265322_101087062 211
286 3300028666 Ga0265336_10005432 Ga0265336_100054322 211
287 3300028666 Ga0265336_10010927 Ga0265336_100109272 211
288 3300028800 Ga0265338_10000185 Ga0265338_1000018516 211
289 3300029957 Ga0265324_10000266 Ga0265324_100002669 211
290 3300029957 Ga0265324_10070782 Ga0265324_100707822 211
291 3300031240 Ga0265320_10000029 Ga0265320_1000002973 211
292 3300031241 Ga0265325_10046561 Ga0265325_100465612 211
293 3300031249 Ga0265339_10050660 Ga0265339_100506602 211
294 3300031250 Ga0265331_10086030 Ga0265331_100860301 211
295 3300031251 Ga0265327_10000015 Ga0265327_1000001536 211
296 3300031711 Ga0265314_10000119 Ga0265314_100001195 211
297 3300031712 Ga0265342_10107643 Ga0265342_101076432 211
298 3300031824 Ga0307413_10270643 Ga0307413_102706431 211
299 3300031995 Ga0307409_100130266 Ga0307409_1001302663 211
300 3300032133 Ga0316583_10094405 Ga0316583_100944052 211
301 3300035111 Ga0373923_0130240 Ga0373923_0130240_357_992 211
302 3300035724 Ga0373933_0607698 Ga0373933_0607698_55_690 211
303 3300036401 Ga0373937_0027522 Ga0373937_0027522_2551_3186 211
304 3300036401 Ga0373937_0290440 Ga0373937_0290440_54_689 211
305 3300036401 Ga0373937_0373905 Ga0373937_0373905_683_1318 211
306 3300041459 Ga0451800_1144989 Ga0451800_1144989_141_776 211
307 3300041486 Ga0451807_2015988 Ga0451807_2015988_452_1087 211
308 3300041486 Ga0451807_2557324 Ga0451807_2557324_382_1017 211
309 3300045836 Ga0466958_0068710 Ga0466958_0068710_1432_2067 211
310 3300045976 Ga0466967_0110030 Ga0466967_0110030_177_812 211
311 3300046454 Ga0495592_0125425 Ga0495592_0125425_669_1304 211
312 3300046455 Ga0495603_0000033 Ga0495603_0000033_45379_46014 211
313 3300046455 Ga0495603_0001486 Ga0495603_0001486_6684_7319 211
314 3300046459 Ga0495629_0003072 Ga0495629_0003072_10848_11483 211
315 3300046459 Ga0495629_0041194 Ga0495629_0041194_1218_1853 211
316 3300046459 Ga0495629_0095306 Ga0495629_0095306_57_692 211
317 3300046459 Ga0495629_0143000 Ga0495629_0143000_698_1333 211
318 3300046459 Ga0495629_0409881 Ga0495629_0409881_51_686 211
319 3300046461 Ga0495641_0000014 Ga0495641_0000014_8986_9621 211
320 3300046461 Ga0495641_0176552 Ga0495641_0176552_45_680 211
321 3300046462 Ga0495651_0054708 Ga0495651_0054708_1226_1861 211
322 3300046462 Ga0495651_0127312 Ga0495651_0127312_337_972 211
323 3300046463 Ga0495653_0069035 Ga0495653_0069035_679_1314 211
324 3300046473 Ga0495582_0000009 Ga0495582_0000009_32157_32792 211
325 3300046476 Ga0495662_0104392 Ga0495662_0104392_680_1315 211
326 3300046507 Ga0495606_0000463 Ga0495606_0000463_10981_11616 211
327 3300046511 Ga0495608_0115478 Ga0495608_0115478_1056_1691 211
328 3300046511 Ga0495608_0125113 Ga0495608_0125113_672_1307 211
329 3300046511 Ga0495608_0412770 Ga0495608_0412770_50_685 211
330 3300046514 Ga0495618_0000070 Ga0495618_0000070_13509_14144 211
331 3300046515 Ga0495620_0002920 Ga0495620_0002920_8020_8655 211
332 3300046516 Ga0495628_0001620 Ga0495628_0001620_1195_1830 211
333 3300046517 Ga0495630_0069317 Ga0495630_0069317_1872_2507 211
334 3300046517 Ga0495630_0131936 Ga0495630_0131936_1187_1822 211
335 3300046517 Ga0495630_0255355 Ga0495630_0255355_351_986 211
336 3300046529 Ga0495652_0000010 Ga0495652_0000010_53700_54335 211
337 3300046529 Ga0495652_0376965 Ga0495652_0376965_285_920 211
338 3300046533 Ga0495640_0098475 Ga0495640_0098475_360_995 211
339 3300046533 Ga0495640_0100282 Ga0495640_0100282_977_1612 211
340 3300046535 Ga0495586_0483345 Ga0495586_0483345_22_657 211
341 3300046536 Ga0495587_0001789 Ga0495587_0001789_2009_2644 211
342 3300046536 Ga0495587_0085772 Ga0495587_0085772_507_1142 211
343 3300046536 Ga0495587_0303004 Ga0495587_0303004_88_723 211
344 3300046539 Ga0495621_0004240 Ga0495621_0004240_2793_3428 211
345 3300046543 Ga0495645_0010315 Ga0495645_0010315_1701_2336 211
346 3300046543 Ga0495645_0337540 Ga0495645_0337540_261_896 211
347 3300046559 Ga0495667_0000258 Ga0495667_0000258_4368_5003 211
348 3300046559 Ga0495667_0229977 Ga0495667_0229977_50_685 211
349 3300046559 Ga0495667_0365247 Ga0495667_0365247_151_786 211
350 3300046615 Ga0495656_0001129 Ga0495656_0001129_4398_5033 211
351 3300046616 Ga0495668_0047700 Ga0495668_0047700_1179_1814 211
352 3300046642 Ga0495634_0000216 Ga0495634_0000216_32206_32841 211
353 3300046642 Ga0495634_0004828 Ga0495634_0004828_7729_8364 211
354 3300046642 Ga0495634_0100139 Ga0495634_0100139_1208_1843 211
355 3300046642 Ga0495634_0354449 Ga0495634_0354449_165_800 211
356 3300046663 Ga0495635_0000057 Ga0495635_0000057_65832_66467 211
357 3300046675 Ga0495657_0007638 Ga0495657_0007638_6449_7084 211
358 3300046678 Ga0495599_0020843 Ga0495599_0020843_1507_2142 211
359 3300046678 Ga0495599_0131563 Ga0495599_0131563_650_1285 211
360 3300046680 Ga0495646_0247519 Ga0495646_0247519_76_711 211
361 3300046681 Ga0495647_0000023 Ga0495647_0000023_46330_46965 211
362 3300046681 Ga0495647_0031055 Ga0495647_0031055_922_1557 211
363 3300046683 Ga0495658_0000002 Ga0495658_0000002_32152_32787 211
364 3300046689 Ga0495613_0000032 Ga0495613_0000032_137643_138278 211
365 3300046689 Ga0495613_0002007 Ga0495613_0002007_13620_14255 211
366 3300046689 Ga0495613_0052954 Ga0495613_0052954_1231_1866 211
367 3300046689 Ga0495613_0132337 Ga0495613_0132337_681_1316 211
368 3300046690 Ga0495624_0000071 Ga0495624_0000071_11971_12606 211
369 3300046690 Ga0495624_0001926 Ga0495624_0001926_13925_14560 211
370 3300046694 Ga0495649_0003071 Ga0495649_0003071_1922_2557 211
371 3300046809 Ga0495600_0006556 Ga0495600_0006556_2251_2886 211
372 3300046809 Ga0495600_0021861 Ga0495600_0021861_2942_3577 211
373 3300046809 Ga0495600_0378377 Ga0495600_0378377_60_695 211
374 3300047317 Ga0495604_0000305 Ga0495604_0000305_26100_26735 211
375 3300047319 Ga0495674_0000010 Ga0495674_0000010_156026_156664 211
376 3300047320 Ga0495672_0135762 Ga0495672_0135762_16_651 211
377 3300047321 Ga0495676_0112630 Ga0495676_0112630_138_773 211
378 3300047321 Ga0495676_0132599 Ga0495676_0132599_360_995 211
379 3300047322 Ga0495680_0003440 Ga0495680_0003440_13857_14492 211
380 3300047322 Ga0495680_0034290 Ga0495680_0034290_1095_1730 211
381 3300047322 Ga0495680_0112420 Ga0495680_0112420_145_780 211
382 3300047444 Ga0495675_0061786 Ga0495675_0061786_484_1122 211
383 3300047471 Ga0495684_0050501 Ga0495684_0050501_87_722 211
384 3300047472 Ga0495686_0458170 Ga0495686_0458170_31_666 211
385 3300047673 Ga0495593_0274093 Ga0495593_0274093_144_779 211
386 3300048088 Ga0495602_0000227 Ga0495602_0000227_33394_34029 211
387 3300048088 Ga0495602_0001969 Ga0495602_0001969_1173_1808 211
388 3300048088 Ga0495602_0015468 Ga0495602_0015468_372_1007 211
389 3300048903 Ga0496100_0000010 Ga0496100_0000010_2490_3125 211
390 3300048904 Ga0496101_0000025 Ga0496101_0000025_2490_3125 211
391 3300048905 Ga0496102_0002490 Ga0496102_0002490_1190_1825 211
392 3300048905 Ga0496102_0297212 Ga0496102_0297212_185_832 211
393 3300048905 Ga0496102_0367512 Ga0496102_0367512_114_749 211
394 3300048906 Ga0496103_0000057 Ga0496103_0000057_91941_92576 211
395 3300048907 Ga0496104_0000015 Ga0496104_0000015_29959_30594 211
396 3300048907 Ga0496104_0000024 Ga0496104_0000024_174885_175520 211
397 3300048907 Ga0496104_0000213 Ga0496104_0000213_50299_50934 211
398 3300048908 Ga0496105_0000004 Ga0496105_0000004_445205_445840 211
399 3300048908 Ga0496105_0000013 Ga0496105_0000013_54394_55029 211
400 3300048908 Ga0496105_0000059 Ga0496105_0000059_64516_65151 211
401 3300048909 Ga0496106_0000012 Ga0496106_0000012_202052_202687 211
402 3300048909 Ga0496106_0000356 Ga0496106_0000356_20935_21570 211
403 3300048909 Ga0496106_0164476 Ga0496106_0164476_830_1465 211
404 3300048910 Ga0496107_0000010 Ga0496107_0000010_202064_202699 211
405 3300048911 Ga0496108_0000232 Ga0496108_0000232_44935_45570 211
406 3300048911 Ga0496108_0013086 Ga0496108_0013086_49_684 211
407 3300048911 Ga0496108_0192077 Ga0496108_0192077_996_1631 211
408 3300048912 Ga0496109_0000044 Ga0496109_0000044_128843_129478 211
409 3300048912 Ga0496109_0111941 Ga0496109_0111941_1702_2337 211
410 3300048912 Ga0496109_0145771 Ga0496109_0145771_1362_1997 211
411 3300048913 Ga0496110_0028377 Ga0496110_0028377_3212_3847 211
412 3300048913 Ga0496110_0064915 Ga0496110_0064915_1045_1713 211
413 3300048913 Ga0496110_0195035 Ga0496110_0195035_304_939 211
414 3300048913 Ga0496110_0281734 Ga0496110_0281734_615_1250 211
415 3300048915 Ga0496112_0000006 Ga0496112_0000006_141733_142368 211
416 3300048916 Ga0496113_0007952 Ga0496113_0007952_6076_6711 211
417 3300048916 Ga0496113_0027941 Ga0496113_0027941_2205_2840 211
418 3300048916 Ga0496113_0227155 Ga0496113_0227155_816_1451 211
419 3300048917 Ga0496114_0000056 Ga0496114_0000056_18655_19290 211
420 3300048917 Ga0496114_0022975 Ga0496114_0022975_3814_4449 211
421 3300048918 Ga0496115_0000031 Ga0496115_0000031_1244_1879 211
422 3300048918 Ga0496115_0012760 Ga0496115_0012760_1515_2150 211
423 3300048919 Ga0496116_0000257 Ga0496116_0000257_27252_27899 211
424 3300048920 Ga0496117_0002686 Ga0496117_0002686_16671_17318 211
425 3300048921 Ga0496118_0002280 Ga0496118_0002280_2375_3022 211
426 3300048921 Ga0496118_0066682 Ga0496118_0066682_1400_2047 211
427 3300048921 Ga0496118_0137101 Ga0496118_0137101_749_1396 211
428 3300048922 Ga0496119_0012123 Ga0496119_0012123_4666_5313 211
429 3300048923 Ga0496120_0007583 Ga0496120_0007583_4602_5249 211
430 3300048923 Ga0496120_0119749 Ga0496120_0119749_426_1061 211
431 3300048928 Ga0496125_0123426 Ga0496125_0123426_1078_1725 211
432 3300049572 Ga0501036_0368884 Ga0501036_0368884_259_894 211
433 3300049578 Ga0501042_0116397 Ga0501042_0116397_106_741 211
434 3300049584 Ga0501068_0121508 Ga0501068_0121508_930_1565 211
435 3300049586 Ga0501070_0143322 Ga0501070_0143322_155_793 211
436 3300049586 Ga0501070_0398666 Ga0501070_0398666_18_653 211
437 3300049588 Ga0501072_0147756 Ga0501072_0147756_185_820 211
438 3300049591 Ga0501075_0004268 Ga0501075_0004268_948_1583 211
439 3300049591 Ga0501075_0457578 Ga0501075_0457578_121_756 211
440 3300049741 Ga0501079_0080601 Ga0501079_0080601_1024_1686 211
441 3300049742 Ga0501080_0147815 Ga0501080_0147815_27_668 211
442 3300049743 Ga0501081_0264576 Ga0501081_0264576_21_683 211
443 3300050515 nmdc:mga0a205_386_c1 nmdc:mga0a205_386_c1_5456_6091 211
444 3300050515 nmdc:mga0a205_94_c1 nmdc:mga0a205_94_c1_48997_49632 211
445 3300053077 Ga0495601_0000057 Ga0495601_0000057_19195_19830 211
446 3300053077 Ga0495601_0018786 Ga0495601_0018786_1520_2155 211
447 3300053077 Ga0495601_0083057 Ga0495601_0083057_404_1039 211
448 3300053077 Ga0495601_0090403 Ga0495601_0090403_150_785 211
449 3300053078 Ga0495612_0000031 Ga0495612_0000031_9925_10560 211
450 3300053078 Ga0495612_0001793 Ga0495612_0001793_6864_7499 211
451 3300053078 Ga0495612_0006253 Ga0495612_0006253_4184_4819 211
452 3300053083 Ga0495655_0000005 Ga0495655_0000005_53823_54458 211
453 3300053084 Ga0495595_0157975 Ga0495595_0157975_223_858 211
454 3300053084 Ga0495595_0191021 Ga0495595_0191021_361_996 211
455 3300053085 Ga0495619_0000010 Ga0495619_0000010_226318_226953 211
456 3300053085 Ga0495619_0000146 Ga0495619_0000146_4353_4988 211
457 3300053085 Ga0495619_0002897 Ga0495619_0002897_9149_9784 211
458 3300053085 Ga0495619_0003619 Ga0495619_0003619_7293_7928 211
459 3300053085 Ga0495619_0008902 Ga0495619_0008902_985_1620 211
460 3300053085 Ga0495619_0086345 Ga0495619_0086345_1269_1904 211
461 3300053085 Ga0495619_0089148 Ga0495619_0089148_1335_1970 211
462 3300053085 Ga0495619_0281361 Ga0495619_0281361_62_697 211
463 3300053094 Ga0500566_0000943 Ga0500566_0000943_15453_16088 211
464 3300053123 Ga0500614_011688 Ga0500614_011688_104_739 211
465 3300053129 Ga0500628_000001 Ga0500628_000001_34353_34988 211
466 3300054114 Ga0501084_0945833 Ga0501084_0945833_35_697 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00697

PRAI

N-(5'phosphoribosyl)anthranilate (PRA) isomerase

36

235

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lbm-assembly1.cif.gz_A crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) 0.9443 1 205
1dl3-assembly2.cif.gz_B crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9417 1 205
1dl3-assembly1.cif.gz_A crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9371 1 205
1lbm-assembly1.cif.gz_A crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) 0.9301 1 205
1nsj-assembly1.cif.gz_A-2 crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima 0.9281 1 205
ID Description Score Start End Superfamily
1dl3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9371 1 205 3.20.20.70
af_P00909_260_447_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.927 6 200 3.20.20.70
1dl3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9228 1 205 3.20.20.70
af_P00909_260_447_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9176 6 200 3.20.20.70
1v5xB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9167 1 205 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A537YV11-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9982 1 206 GO:0000162
GO:0004640
GO:0006568
AF-A0A7J9YSZ1-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9927 1 206 GO:0000162
GO:0004640
GO:0006568
AF-A0A7V9HRX4-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9917 1 206 GO:0000162
GO:0004640
GO:0006568
AF-A0A7W0Z8Z4-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9863 1 207 GO:0000162
GO:0004640
GO:0006568
AF-A0A7V9F097-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (EC 5.3.1.24) 0.9841 1 207 GO:0000162
GO:0004640
GO:0006568

Feature Viewer

pLDDT pTM Quality
92.87 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map