F449603

General Info

Members Datasets Scaffolds Average Seq Length
466 216 932 286

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10000321|Ga0065712_1000032111
Length 284
Sequence VIPVAFDYERATSLDDAVARLKAAGGSAKIVAGGHSLVPLMKLRLSEPQLLIDIARIPELRGVTETGGTISIGAATTHHEIATSAALQQRCPVLSDAAAMIGDQQVRNRGTIGGSLAHADPSADYPAVMLALDASFQLVGPKGRREVKAVDFFKDLMTVDLAADEILASVHFTPVRTAAYAKLVQRASHYAIVGVAAALEVKGGSIASARVGLTGGSSHARRLTNVEQALAGQKASKDTIEAAARLAGSGVDYVNSDLHASEEYRRAMIDVFARRALTAALARA

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
169 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
181 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
182 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
195 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
196 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
197 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
198 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
199 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
200 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
201 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
202 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
203 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3
Rhizosphere 97
Stem 0
Stem Tuber 0
Unclassified 18.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10000321 3300005290 Bacteria 25129
2 SwRhRL2b_contig_855396 2162886007 Bacteria 1307
3 JGI24751J29686_10000018 3300002459 Bacteria 107255
4 JGI25406J46586_10002103 3300003203 Bacteria 9402
5 Ga0065704_10155759 3300005289 Bacteria 1392
6 Ga0065712_10000125 3300005290 Bacteria 81248
7 Ga0065712_10001038 3300005290 Bacteria 8554
8 Ga0065715_10000869 3300005293 Bacteria 16473
9 Ga0065715_10007935 3300005293 Bacteria 4260
10 Ga0065715_10095875 3300005293 Unclassified 3989
11 Ga0065715_10098658 3300005293 Unclassified 3516
12 Ga0065715_10143571 3300005293 Bacteria 1818
13 Ga0065715_10186875 3300005293 Unclassified 1439
14 Ga0065715_10311023 3300005293 Bacteria 1020
15 Ga0065707_10004961 3300005295 Bacteria 4182
16 Ga0065707_10144587 3300005295 Unclassified 1729
17 Ga0065707_10184037 3300005295 Bacteria 1400
18 Ga0070690_100080537 3300005330 Unclassified 2130
19 Ga0070670_100000176 3300005331 Bacteria 57932
20 Ga0070670_100028811 3300005331 Unclassified 4780
21 Ga0070670_100319888 3300005331 Unclassified 1359
22 Ga0070670_100347424 3300005331 Bacteria 1303
23 Ga0068869_100072367 3300005334 Unclassified 2554
24 Ga0068869_100153196 3300005334 Bacteria 1789
25 Ga0068869_100244716 3300005334 Bacteria 1430
26 Ga0068868_100006627 3300005338 Bacteria 8213
27 Ga0068868_100011087 3300005338 Bacteria 6556
28 Ga0070660_100163371 3300005339 Bacteria 1795
29 Ga0070689_100005163 3300005340 Bacteria 8887
30 Ga0070689_100058267 3300005340 Bacteria 2999
31 Ga0070689_100284270 3300005340 Bacteria 1373
32 Ga0070687_100011804 3300005343 Bacteria 3836
33 Ga0070687_100018431 3300005343 Bacteria 3229
34 Ga0070687_100094046 3300005343 Bacteria 1664
35 Ga0070661_100034491 3300005344 Unclassified 3669
36 Ga0070692_10030731 3300005345 Bacteria 2687
37 Ga0070668_100017119 3300005347 Bacteria 5425
38 Ga0070669_100112018 3300005353 Bacteria 2072
39 Ga0070669_100135824 3300005353 Unclassified 1891
40 Ga0070669_100136702 3300005353 Bacteria 1886
41 Ga0070675_100099578 3300005354 Bacteria 2447
42 Ga0070675_100151392 3300005354 Unclassified 1989
43 Ga0070675_100218898 3300005354 Bacteria 1657
44 Ga0070671_100046648 3300005355 Bacteria 3603
45 Ga0070671_100062375 3300005355 Bacteria 3104
46 Ga0070673_100006772 3300005364 Bacteria 7479
47 Ga0070673_100116468 3300005364 Unclassified 2223
48 Ga0070673_100246416 3300005364 Unclassified 1556
49 Ga0070673_100250299 3300005364 Bacteria 1544
50 Ga0070673_100400788 3300005364 Unclassified 1227
51 Ga0070659_100030064 3300005366 Unclassified 4202
52 Ga0070667_100171325 3300005367 Bacteria 1916
53 Ga0070701_10005112 3300005438 Bacteria 5390
54 Ga0070701_10016641 3300005438 Bacteria 3423
55 Ga0070705_100044442 3300005440 Bacteria 2551
56 Ga0070700_100000082 3300005441 Bacteria 63662
57 Ga0070700_100035385 3300005441 Unclassified 3022
58 Ga0070700_100065704 3300005441 Bacteria 2301
59 Ga0070700_100147838 3300005441 Bacteria 1604
60 Ga0070700_100247396 3300005441 Bacteria 1277
61 Ga0070694_100009095 3300005444 Bacteria 6092
62 Ga0070694_100145943 3300005444 Bacteria 1723
63 Ga0070694_100177138 3300005444 Bacteria 1575
64 Ga0070694_100180324 3300005444 Bacteria 1562
65 Ga0070694_100195799 3300005444 Bacteria 1504
66 Ga0070694_100248565 3300005444 Bacteria 1344
67 Ga0070708_100000223 3300005445 Bacteria 42136
68 Ga0070708_100504727 3300005445 Bacteria 1141
69 Ga0070678_100046025 3300005456 Bacteria 3126
70 Ga0070662_100108325 3300005457 Bacteria 2113
71 Ga0070662_100125953 3300005457 Unclassified 1969
72 Ga0070662_100376295 3300005457 Bacteria 1168
73 Ga0070681_10009470 3300005458 Bacteria 9583
74 Ga0070681_10014884 3300005458 Bacteria 7734
75 Ga0070681_10061997 3300005458 Bacteria 3713
76 Ga0068867_100015476 3300005459 Bacteria 5410
77 Ga0068867_100310818 3300005459 Bacteria 1302
78 Ga0070685_10188797 3300005466 Bacteria 1331
79 Ga0070706_100000032 3300005467 Bacteria 152892
80 Ga0070707_100072778 3300005468 Bacteria 3313
81 Ga0070707_100083892 3300005468 Bacteria 3079
82 Ga0070698_100008020 3300005471 Bacteria 11420
83 Ga0070698_100212887 3300005471 Bacteria 1867
84 Ga0070699_100000714 3300005518 Bacteria 30821
85 Ga0070699_100002628 3300005518 Bacteria 16041
86 Ga0070699_100256778 3300005518 Bacteria 1562
87 Ga0070699_100301414 3300005518 Bacteria 1438
88 Ga0070679_100109832 3300005530 Bacteria 2744
89 Ga0070697_100003302 3300005536 Bacteria 12394
90 Ga0070697_100268109 3300005536 Unclassified 1463
91 Ga0068853_100007832 3300005539 Bacteria 8567
92 Ga0068853_100106784 3300005539 Unclassified 2482
93 Ga0070672_100115132 3300005543 Bacteria 2195
94 Ga0070686_100002689 3300005544 Bacteria 9785
95 Ga0070686_100005483 3300005544 Bacteria 7024
96 Ga0070686_100319131 3300005544 Bacteria 1158
97 Ga0070695_100048138 3300005545 Bacteria 2725
98 Ga0070695_100138691 3300005545 Bacteria 1684
99 Ga0070695_100173586 3300005545 Bacteria 1522
100 Ga0070695_100235128 3300005545 Unclassified 1327
101 Ga0070696_100148342 3300005546 Unclassified 1719
102 Ga0070693_100018571 3300005547 Bacteria 3635
103 Ga0070693_100064755 3300005547 Unclassified 2135
104 Ga0070665_100006825 3300005548 Bacteria 11610
105 Ga0070665_100305064 3300005548 Unclassified 1595
106 Ga0070704_100094240 3300005549 Unclassified 2240
107 Ga0070704_100203172 3300005549 Bacteria 1601
108 Ga0068855_100082255 3300005563 Bacteria 3732
109 Ga0070664_100001410 3300005564 Bacteria 19208
110 Ga0068857_100003981 3300005577 Bacteria 12443
111 Ga0068857_100030455 3300005577 Bacteria 4764
112 Ga0068854_100116690 3300005578 Bacteria 2021
113 Ga0068854_100166624 3300005578 Bacteria 1711
114 Ga0068856_100005832 3300005614 Bacteria 12138
115 Ga0070702_100059173 3300005615 Bacteria 2222
116 Ga0070702_100123071 3300005615 Unclassified 1627
117 Ga0070702_100129334 3300005615 Unclassified 1592
118 Ga0070702_100197751 3300005615 Bacteria 1328
119 Ga0070702_100292610 3300005615 Bacteria 1123
120 Ga0070702_100493286 3300005615 Unclassified 898
121 Ga0068852_100173618 3300005616 Unclassified 2022
122 Ga0068859_100001602 3300005617 Bacteria 23116
123 Ga0068859_100011867 3300005617 Bacteria 8752
124 Ga0068859_100014099 3300005617 Bacteria 8015
125 Ga0068859_100021159 3300005617 Bacteria 6527
126 Ga0068859_100061728 3300005617 Bacteria 3777
127 Ga0068859_100065086 3300005617 Bacteria 3679
128 Ga0068859_100115957 3300005617 Bacteria 2743
129 Ga0068859_100227389 3300005617 Unclassified 1953
130 Ga0068859_100238707 3300005617 Bacteria 1906
131 Ga0068859_100270770 3300005617 Bacteria 1790
132 Ga0068859_100469270 3300005617 Bacteria 1354
133 Ga0068864_100003131 3300005618 Bacteria 13668
134 Ga0068864_100006172 3300005618 Bacteria 9826
135 Ga0068864_100022484 3300005618 Bacteria 5287
136 Ga0068864_100097909 3300005618 Bacteria 2597
137 Ga0068864_100225207 3300005618 Unclassified 1732
138 Ga0068864_100498705 3300005618 Bacteria 1171
139 Ga0068861_100004341 3300005719 Bacteria 9515
140 Ga0068861_100057787 3300005719 Bacteria 2964
141 Ga0068861_100065373 3300005719 Bacteria 2801
142 Ga0068861_100228498 3300005719 Unclassified 1577
143 Ga0068861_100357621 3300005719 Bacteria 1283
144 Ga0068851_10005465 3300005834 Bacteria 5764
145 Ga0068870_10125647 3300005840 Bacteria 1483
146 Ga0068863_100076897 3300005841 Unclassified 3158
147 Ga0068863_100091212 3300005841 Unclassified 2889
148 Ga0068863_100099037 3300005841 Bacteria 2769
149 Ga0068858_100046756 3300005842 Unclassified 4012
150 Ga0068858_100070781 3300005842 Unclassified 3233
151 Ga0068858_100084133 3300005842 Unclassified 2959
152 Ga0068858_100122231 3300005842 Bacteria 2436
153 Ga0068858_100288606 3300005842 Unclassified 1563
154 Ga0068860_100033748 3300005843 Bacteria 4910
155 Ga0068860_100046903 3300005843 Bacteria 4118
156 Ga0068860_100225155 3300005843 Bacteria 1822
157 Ga0068860_100573206 3300005843 Unclassified 1132
158 Ga0068862_100097063 3300005844 Bacteria 2573
159 Ga0068862_100238195 3300005844 Bacteria 1653
160 Ga0081539_10000119 3300005985 Bacteria 184136
161 Ga0081539_10000614 3300005985 Bacteria 72137
162 Ga0081539_10000681 3300005985 Bacteria 68157
163 Ga0081539_10001119 3300005985 Bacteria 48656
164 Ga0070715_10000007 3300006163 Bacteria 192075
165 Ga0070716_100264725 3300006173 Unclassified 1178
166 Ga0097621_100003512 3300006237 Bacteria 10823
167 Ga0097621_100009079 3300006237 Bacteria 7205
168 Ga0097621_100009802 3300006237 Bacteria 6973
169 Ga0068871_100003510 3300006358 Bacteria 10795
170 Ga0068871_100022061 3300006358 Bacteria 4905
171 Ga0075428_100257877 3300006844 Bacteria 1878
172 Ga0075428_100285786 3300006844 Unclassified 1775
173 Ga0075431_100289706 3300006847 Unclassified 1657
174 Ga0075431_100703444 3300006847 Unclassified 988
175 Ga0075433_10123545 3300006852 Bacteria 2300
176 Ga0075433_10126410 3300006852 Bacteria 2270
177 Ga0075433_10169859 3300006852 Bacteria 1941
178 Ga0075433_10176424 3300006852 Bacteria 1902
179 Ga0075434_100051719 3300006871 Bacteria 4082
180 Ga0075434_100202236 3300006871 Bacteria 2007
181 Ga0075434_100240618 3300006871 Bacteria 1830
182 Ga0075434_100590767 3300006871 Unclassified 1129
183 Ga0075429_100084385 3300006880 Bacteria 2768
184 Ga0075429_100257511 3300006880 Bacteria 1528
185 Ga0075429_100532090 3300006880 Unclassified 1030
186 Ga0068865_100055207 3300006881 Bacteria 2763
187 Ga0075436_100031411 3300006914 Bacteria 3657
188 Ga0097620_100001602 3300006931 Bacteria 23116
189 Ga0097620_100011867 3300006931 Bacteria 8752
190 Ga0097620_100014099 3300006931 Bacteria 8015
191 Ga0097620_100021159 3300006931 Bacteria 6527
192 Ga0097620_100061735 3300006931 Bacteria 3777
193 Ga0097620_100065091 3300006931 Bacteria 3679
194 Ga0097620_100115953 3300006931 Bacteria 2743
195 Ga0097620_100227392 3300006931 Unclassified 1953
196 Ga0097620_100238706 3300006931 Bacteria 1906
197 Ga0097620_100270765 3300006931 Bacteria 1790
198 Ga0097620_100469274 3300006931 Bacteria 1354
199 Ga0075435_100015961 3300007076 Bacteria 5655
200 Ga0105251_10093485 3300009011 Bacteria 1379
201 Ga0105240_10084684 3300009093 Bacteria 3887
202 Ga0111539_10006286 3300009094 Bacteria 15335
203 Ga0111539_10016398 3300009094 Bacteria 9187
204 Ga0111539_10515852 3300009094 Unclassified 1392
205 Ga0111539_10568454 3300009094 Bacteria 1320
206 Ga0111539_10640428 3300009094 Bacteria 1238
207 Ga0105245_10182800 3300009098 Bacteria 2004
208 Ga0105247_10003612 3300009101 Bacteria 10040
209 Ga0114129_10034451 3300009147 Bacteria 7152
210 Ga0114129_10129563 3300009147 Bacteria 3467
211 Ga0114129_10187283 3300009147 Bacteria 2812
212 Ga0114129_10191959 3300009147 Bacteria 2773
213 Ga0114129_10248770 3300009147 Bacteria 2387
214 Ga0105243_10028504 3300009148 Bacteria 4287
215 Ga0105243_10671135 3300009148 Bacteria 1007
216 Ga0105241_10119889 3300009174 Bacteria 2117
217 Ga0105241_10367309 3300009174 Bacteria 1254
218 Ga0105242_10006452 3300009176 Bacteria 9035
219 Ga0105248_10001348 3300009177 Bacteria 27373
220 Ga0105248_10011693 3300009177 Bacteria 9674
221 Ga0105248_10024369 3300009177 Bacteria 6729
222 Ga0105248_10024852 3300009177 Bacteria 6658
223 Ga0105248_10044144 3300009177 Bacteria 4999
224 Ga0105248_10081448 3300009177 Bacteria 3638
225 Ga0105248_10104485 3300009177 Bacteria 3193
226 Ga0105248_10125253 3300009177 Bacteria 2898
227 Ga0105248_10288875 3300009177 Bacteria 1846
228 Ga0105237_10001297 3300009545 Bacteria 33271
229 Ga0105237_10036933 3300009545 Bacteria 4940
230 Ga0105238_10011553 3300009551 Bacteria 8897
231 Ga0105249_10000139 3300009553 Bacteria 94384
232 Ga0105249_10134777 3300009553 Bacteria 2362
233 Ga0105249_10148706 3300009553 Bacteria 2253
234 Ga0105249_10295037 3300009553 Bacteria 1624
235 Ga0105249_10373297 3300009553 Bacteria 1450
236 Ga0105239_10033805 3300010375 Bacteria 5614
237 Ga0105239_10155680 3300010375 Bacteria 2552
238 Ga0105239_10349274 3300010375 Bacteria 1670
239 Ga0105239_10553946 3300010375 Unclassified 1310
240 Ga0105239_10816691 3300010375 Bacteria 1068
241 Ga0105246_10066101 3300011119 Bacteria 2531
242 Ga0105246_10212200 3300011119 Bacteria 1512
243 Ga0105246_10225604 3300011119 Bacteria 1472
244 Ga0157373_10006864 3300013100 Bacteria 8474
245 Ga0157373_10065178 3300013100 Bacteria 2578
246 Ga0157374_10036167 3300013296 Bacteria 4521
247 Ga0157378_10000124 3300013297 Bacteria 74694
248 Ga0157378_10020542 3300013297 Bacteria 5806
249 Ga0157378_10024795 3300013297 Bacteria 5281
250 Ga0157378_10231706 3300013297 Unclassified 1760
251 Ga0157378_10380717 3300013297 Bacteria 1385
252 Ga0163162_10000045 3300013306 Bacteria 127819
253 Ga0163162_10015318 3300013306 Bacteria 7490
254 Ga0163162_10250552 3300013306 Bacteria 1903
255 Ga0157372_10055956 3300013307 Bacteria 4407
256 Ga0157372_10846256 3300013307 Unclassified 1062
257 Ga0157375_10026434 3300013308 Bacteria 5409
258 Ga0157375_10198126 3300013308 Bacteria 2164
259 Ga0157375_10202548 3300013308 Unclassified 2141
260 Ga0163163_10000511 3300014325 Bacteria 34726
261 Ga0163163_10002463 3300014325 Bacteria 15642
262 Ga0163163_10017887 3300014325 Bacteria 6620
263 Ga0163163_10131954 3300014325 Unclassified 2538
264 Ga0163163_10135202 3300014325 Bacteria 2507
265 Ga0163163_10211493 3300014325 Bacteria 1988
266 Ga0163163_10341694 3300014325 Unclassified 1552
267 Ga0163163_10513248 3300014325 Bacteria 1261
268 Ga0157380_10035629 3300014326 Bacteria 3844
269 Ga0157380_10055848 3300014326 Bacteria 3138
270 Ga0157380_10060191 3300014326 Bacteria 3033
271 Ga0157380_10103305 3300014326 Bacteria 2378
272 Ga0157380_10195763 3300014326 Bacteria 1789
273 Ga0157380_10470248 3300014326 Bacteria 1213
274 Ga0157377_10044360 3300014745 Bacteria 2479
275 Ga0157379_10031311 3300014968 Bacteria 4738
276 Ga0157379_10153111 3300014968 Unclassified 2080
277 Ga0157379_10289613 3300014968 Bacteria 1491
278 Ga0157379_10372772 3300014968 Unclassified 1309
279 Ga0163161_10028019 3300017792 Bacteria 3998
280 Ga0163161_10255852 3300017792 Bacteria 1366
281 Ga0207697_10048078 3300025315 Bacteria 1759
282 Ga0207656_10004610 3300025321 Bacteria 4828
283 Ga0207653_10007514 3300025885 Bacteria 3397
284 Ga0207642_10024299 3300025899 Bacteria 2434
285 Ga0207710_10004336 3300025900 Bacteria 6206
286 Ga0207647_10013271 3300025904 Bacteria 5718
287 Ga0207685_10000007 3300025905 Bacteria 278341
288 Ga0207643_10031918 3300025908 Unclassified 2939
289 Ga0207643_10204166 3300025908 Unclassified 1204
290 Ga0207684_10000065 3300025910 Bacteria 194463
291 Ga0207654_10016705 3300025911 Unclassified 3825
292 Ga0207654_10441464 3300025911 Unclassified 911
293 Ga0207707_10010340 3300025912 Bacteria 8096
294 Ga0207707_10191851 3300025912 Bacteria 1782
295 Ga0207695_10071823 3300025913 Bacteria 3534
296 Ga0207671_10010635 3300025914 Bacteria 7572
297 Ga0207660_10170151 3300025917 Unclassified 1686
298 Ga0207662_10011161 3300025918 Bacteria 4973
299 Ga0207662_10068090 3300025918 Unclassified 2149
300 Ga0207662_10178383 3300025918 Unclassified 1366
301 Ga0207662_10277386 3300025918 Bacteria 1108
302 Ga0207649_10012772 3300025920 Unclassified 4672
303 Ga0207652_10085118 3300025921 Bacteria 2771
304 Ga0207681_10232115 3300025923 Bacteria 1432
305 Ga0207681_10336102 3300025923 Bacteria 1205
306 Ga0207694_10265120 3300025924 Bacteria 1408
307 Ga0207650_10000080 3300025925 Bacteria 129319
308 Ga0207650_10037227 3300025925 Unclassified 3544
309 Ga0207650_10248250 3300025925 Bacteria 1440
310 Ga0207650_10271613 3300025925 Unclassified 1378
311 Ga0207650_10274086 3300025925 Bacteria 1372
312 Ga0207659_10163917 3300025926 Bacteria 1748
313 Ga0207644_10245460 3300025931 Unclassified 1427
314 Ga0207690_10149278 3300025932 Bacteria 1731
315 Ga0207690_10314612 3300025932 Unclassified 1229
316 Ga0207706_10123419 3300025933 Bacteria 2278
317 Ga0207706_10233340 3300025933 Bacteria 1609
318 Ga0207706_10299069 3300025933 Bacteria 1402
319 Ga0207686_10049159 3300025934 Bacteria 2616
320 Ga0207686_10291437 3300025934 Bacteria 1209
321 Ga0207709_10104807 3300025935 Unclassified 1877
322 Ga0207670_10115744 3300025936 Bacteria 1940
323 Ga0207704_10013938 3300025938 Bacteria 4044
324 Ga0207704_10020246 3300025938 Bacteria 3515
325 Ga0207704_10088531 3300025938 Bacteria 2026
326 Ga0207665_10312109 3300025939 Unclassified 1178
327 Ga0207691_10010591 3300025940 Bacteria 8844
328 Ga0207711_10002623 3300025941 Bacteria 15929
329 Ga0207711_10020826 3300025941 Bacteria 5473
330 Ga0207711_10026929 3300025941 Bacteria 4827
331 Ga0207711_10207612 3300025941 Bacteria 1789
332 Ga0207689_10004507 3300025942 Bacteria 12607
333 Ga0207689_10106130 3300025942 Bacteria 2308
334 Ga0207679_10012167 3300025945 Bacteria 5603
335 Ga0207679_10281928 3300025945 Bacteria 1425
336 Ga0207679_10483766 3300025945 Bacteria 1102
337 Ga0207651_10019007 3300025960 Bacteria 4107
338 Ga0207651_10343734 3300025960 Bacteria 1254
339 Ga0207651_10369716 3300025960 Bacteria 1213
340 Ga0207712_10004949 3300025961 Bacteria 8421
341 Ga0207712_10006149 3300025961 Bacteria 7570
342 Ga0207712_10028251 3300025961 Bacteria 3750
343 Ga0207712_10053897 3300025961 Unclassified 2823
344 Ga0207712_10080975 3300025961 Bacteria 2363
345 Ga0207668_10006797 3300025972 Bacteria 6775
346 Ga0207640_10108532 3300025981 Bacteria 1962
347 Ga0207658_10049683 3300025986 Bacteria 3083
348 Ga0207703_10043599 3300026035 Bacteria 3601
349 Ga0207703_10103540 3300026035 Bacteria 2416
350 Ga0207703_10336993 3300026035 Bacteria 1385
351 Ga0207639_10036221 3300026041 Unclassified 3655
352 Ga0207639_10142872 3300026041 Bacteria 1996
353 Ga0207708_10000063 3300026075 Bacteria 87390
354 Ga0207708_10044072 3300026075 Bacteria 3399
355 Ga0207708_10074574 3300026075 Bacteria 2600
356 Ga0207708_10199166 3300026075 Bacteria 1597
357 Ga0207641_10013045 3300026088 Bacteria 6816
358 Ga0207641_10022525 3300026088 Bacteria 5185
359 Ga0207648_10015941 3300026089 Bacteria 6886
360 Ga0207648_10051811 3300026089 Bacteria 3587
361 Ga0207648_10626793 3300026089 Bacteria 993
362 Ga0207676_10001281 3300026095 Bacteria 18692
363 Ga0207676_10184580 3300026095 Bacteria 1829
364 Ga0207676_10204905 3300026095 Bacteria 1745
365 Ga0207676_10442961 3300026095 Bacteria 1223
366 Ga0207676_10559604 3300026095 Unclassified 1093
367 Ga0207674_10000006 3300026116 Bacteria 233530
368 Ga0207674_10059081 3300026116 Bacteria 3882
369 Ga0207674_10069649 3300026116 Bacteria 3538
370 Ga0207675_100008176 3300026118 Bacteria 9861
371 Ga0207675_100018226 3300026118 Bacteria 6545
372 Ga0207675_100080953 3300026118 Bacteria 3045
373 Ga0207683_10028838 3300026121 Bacteria 4802
374 Ga0207683_10058089 3300026121 Bacteria 3396
375 Ga0207428_10019082 3300027907 Bacteria 5848
376 Ga0268265_10067620 3300028380 Bacteria 2767
377 Ga0268265_10075128 3300028380 Bacteria 2646
378 Ga0268265_10079385 3300028380 Unclassified 2584
379 Ga0268264_10095048 3300028381 Bacteria 2578
380 Ga0268264_10203499 3300028381 Bacteria 1813
381 Ga0268264_10508067 3300028381 Bacteria 1176
382 Ga0268264_10528413 3300028381 Bacteria 1154
383 Ga0307408_100007358 3300031548 Bacteria 7287
384 Ga0307408_100102388 3300031548 Archaea 2184
385 Ga0307413_10016275 3300031824 Bacteria 3837
386 Ga0307410_10030919 3300031852 Bacteria 3428
387 Ga0307406_10010389 3300031901 Bacteria 5248
388 Ga0307406_10272427 3300031901 Unclassified 1287
389 Ga0307412_10014734 3300031911 Bacteria 4620
390 Ga0307409_100186237 3300031995 Bacteria 1843
391 Ga0307416_100065606 3300032002 Bacteria 2984
392 Ga0307416_100131705 3300032002 Bacteria 2252
393 Ga0307416_100224267 3300032002 Unclassified 1806
394 Ga0307414_10033381 3300032004 Bacteria 3401
395 Ga0307411_10017040 3300032005 Bacteria 4127
396 Ga0307411_10564601 3300032005 Bacteria 973
397 Ga0307415_100010471 3300032126 Bacteria 5255
398 Ga0307415_100037182 3300032126 Bacteria 3197
399 Ga0373949_0006037 3300035090 Bacteria 2682
400 Ga0395898_0267443 3300037466 Bacteria 1631
401 Ga0395898_0345448 3300037466 Bacteria 1419
402 Ga0395905_0167416 3300037471 Unclassified 2065
403 Ga0395901_0735001 3300038443 Unclassified 981
404 Ga0439448_0027314 3300042005 Unclassified 1798
405 Ga0466964_0000330 3300044706 Bacteria 14138
406 Ga0466959_0051556 3300045049 Bacteria 3017
407 Ga0451576_0576143 3300045051 Bacteria 1183
408 Ga0496102_0149350 3300048905 Bacteria 2195
409 Ga0496102_0229851 3300048905 Bacteria 1749
410 Ga0496104_0002670 3300048907 Bacteria 15352
411 Ga0496104_0079373 3300048907 Unclassified 3128
412 Ga0496106_0139074 3300048909 Unclassified 1909
413 Ga0496107_0051456 3300048910 Bacteria 2971
414 Ga0496108_0006977 3300048911 Bacteria 9143
415 Ga0496109_0007194 3300048912 Bacteria 9405
416 Ga0496110_0045559 3300048913 Bacteria 3834
417 Ga0496110_0162320 3300048913 Bacteria 2026
418 Ga0496110_0420306 3300048913 Bacteria 1219
419 Ga0496110_0430887 3300048913 Bacteria 1202
420 Ga0496112_0182761 3300048915 Bacteria 2060
421 Ga0496112_0341106 3300048915 Bacteria 1442
422 Ga0501298_000531 3300049521 Bacteria 5170
423 Ga0501299_006109 3300049522 Bacteria 1878
424 Ga0501300_008842 3300049523 Bacteria 1473
425 Ga0501032_0337917 3300049569 Bacteria 971
426 Ga0501036_0232706 3300049572 Bacteria 1546
427 Ga0501038_0026488 3300049574 Bacteria 5163
428 Ga0501039_0276416 3300049575 Bacteria 1320
429 Ga0501039_0290761 3300049575 Bacteria 1285
430 Ga0501042_0069764 3300049578 Bacteria 2514
431 Ga0501046_0132104 3300049580 Bacteria 1893
432 Ga0501048_0161276 3300049582 Bacteria 1587
433 Ga0501071_0237114 3300049587 Bacteria 1375
434 Ga0501074_0265473 3300049590 Bacteria 1220
435 Ga0501075_0015394 3300049591 Bacteria 5489
436 Ga0501076_0009768 3300049592 Bacteria 7088
437 Ga0501202_019657 3300049652 Bacteria 1336
438 Ga0501214_003934 3300049659 Unclassified 1348
439 Ga0501217_001021 3300049661 Bacteria 5074
440 Ga0501224_005458 3300049664 Bacteria 1821
441 Ga0501227_002864 3300049665 Bacteria 3783
442 Ga0501235_009074 3300049669 Bacteria 2172
443 Ga0501225_0001206 3300049705 Bacteria 8063
444 Ga0501225_0007272 3300049705 Bacteria 3212
445 Ga0501229_000458 3300049706 Bacteria 4598
446 Ga0501273_016245 3300049770 Unclassified 973
447 Ga0501283_000478 3300049779 Bacteria 5258
448 Ga0501035_0452558 3300049822 Bacteria 1062
449 Ga0501226_000663 3300049853 Bacteria 4672
450 nmdc:mga05p37_119462_c1 3300050507 Bacteria 3238
451 nmdc:mga05p37_257910_c1 3300050507 Unclassified 2088
452 nmdc:mga05p37_36503_c1 3300050507 Bacteria 6029
453 nmdc:mga09592_299195_c1 3300050508 Bacteria 1395
454 nmdc:mga0qj67_127709_c1 3300050509 Unclassified 2058
455 nmdc:mga06r32_247604_c1 3300050510 Bacteria 1770
456 nmdc:mga08y16_19368_c1 3300050511 Bacteria 7174
457 nmdc:mga08y16_33601_c1 3300050511 Bacteria 5386
458 nmdc:mga0n895_172324_c1 3300050512 Bacteria 2196
459 nmdc:mga0n895_86934_c1 3300050512 Bacteria 3123
460 nmdc:mga08x19_11829_c1 3300050514 Bacteria 5251
461 nmdc:mga0a205_139314_c1 3300050515 Bacteria 2326
462 nmdc:mga0a205_275535_c1 3300050515 Bacteria 1559
463 nmdc:mga0a205_615488_c1 3300050515 Unclassified 939
464 Ga0501084_0063806 3300054114 Bacteria 3084
465 Ga0501082_0073881 3300060353 Bacteria 2936
466 Ga0530510_0071008 3300061734 Bacteria 2527
467 Ga0065712_10000321
468 SwRhRL2b_contig_855396
469 JGI24751J29686_10000018
470 JGI25406J46586_10002103
471 Ga0065704_10155759
472 Ga0065712_10000125
473 Ga0065712_10001038
474 Ga0065715_10000869
475 Ga0065715_10007935
476 Ga0065715_10095875
477 Ga0065715_10098658
478 Ga0065715_10143571
479 Ga0065715_10186875
480 Ga0065715_10311023
481 Ga0065707_10004961
482 Ga0065707_10144587
483 Ga0065707_10184037
484 Ga0070690_100080537
485 Ga0070670_100000176
486 Ga0070670_100028811
487 Ga0070670_100319888
488 Ga0070670_100347424
489 Ga0068869_100072367
490 Ga0068869_100153196
491 Ga0068869_100244716
492 Ga0068868_100006627
493 Ga0068868_100011087
494 Ga0070660_100163371
495 Ga0070689_100005163
496 Ga0070689_100058267
497 Ga0070689_100284270
498 Ga0070687_100011804
499 Ga0070687_100018431
500 Ga0070687_100094046
501 Ga0070661_100034491
502 Ga0070692_10030731
503 Ga0070668_100017119
504 Ga0070669_100112018
505 Ga0070669_100135824
506 Ga0070669_100136702
507 Ga0070675_100099578
508 Ga0070675_100151392
509 Ga0070675_100218898
510 Ga0070671_100046648
511 Ga0070671_100062375
512 Ga0070673_100006772
513 Ga0070673_100116468
514 Ga0070673_100246416
515 Ga0070673_100250299
516 Ga0070673_100400788
517 Ga0070659_100030064
518 Ga0070667_100171325
519 Ga0070701_10005112
520 Ga0070701_10016641
521 Ga0070705_100044442
522 Ga0070700_100000082
523 Ga0070700_100035385
524 Ga0070700_100065704
525 Ga0070700_100147838
526 Ga0070700_100247396
527 Ga0070694_100009095
528 Ga0070694_100145943
529 Ga0070694_100177138
530 Ga0070694_100180324
531 Ga0070694_100195799
532 Ga0070694_100248565
533 Ga0070708_100000223
534 Ga0070708_100504727
535 Ga0070678_100046025
536 Ga0070662_100108325
537 Ga0070662_100125953
538 Ga0070662_100376295
539 Ga0070681_10009470
540 Ga0070681_10014884
541 Ga0070681_10061997
542 Ga0068867_100015476
543 Ga0068867_100310818
544 Ga0070685_10188797
545 Ga0070706_100000032
546 Ga0070707_100072778
547 Ga0070707_100083892
548 Ga0070698_100008020
549 Ga0070698_100212887
550 Ga0070699_100000714
551 Ga0070699_100002628
552 Ga0070699_100256778
553 Ga0070699_100301414
554 Ga0070679_100109832
555 Ga0070697_100003302
556 Ga0070697_100268109
557 Ga0068853_100007832
558 Ga0068853_100106784
559 Ga0070672_100115132
560 Ga0070686_100002689
561 Ga0070686_100005483
562 Ga0070686_100319131
563 Ga0070695_100048138
564 Ga0070695_100138691
565 Ga0070695_100173586
566 Ga0070695_100235128
567 Ga0070696_100148342
568 Ga0070693_100018571
569 Ga0070693_100064755
570 Ga0070665_100006825
571 Ga0070665_100305064
572 Ga0070704_100094240
573 Ga0070704_100203172
574 Ga0068855_100082255
575 Ga0070664_100001410
576 Ga0068857_100003981
577 Ga0068857_100030455
578 Ga0068854_100116690
579 Ga0068854_100166624
580 Ga0068856_100005832
581 Ga0070702_100059173
582 Ga0070702_100123071
583 Ga0070702_100129334
584 Ga0070702_100197751
585 Ga0070702_100292610
586 Ga0070702_100493286
587 Ga0068852_100173618
588 Ga0068859_100001602
589 Ga0068859_100011867
590 Ga0068859_100014099
591 Ga0068859_100021159
592 Ga0068859_100061728
593 Ga0068859_100065086
594 Ga0068859_100115957
595 Ga0068859_100227389
596 Ga0068859_100238707
597 Ga0068859_100270770
598 Ga0068859_100469270
599 Ga0068864_100003131
600 Ga0068864_100006172
601 Ga0068864_100022484
602 Ga0068864_100097909
603 Ga0068864_100225207
604 Ga0068864_100498705
605 Ga0068861_100004341
606 Ga0068861_100057787
607 Ga0068861_100065373
608 Ga0068861_100228498
609 Ga0068861_100357621
610 Ga0068851_10005465
611 Ga0068870_10125647
612 Ga0068863_100076897
613 Ga0068863_100091212
614 Ga0068863_100099037
615 Ga0068858_100046756
616 Ga0068858_100070781
617 Ga0068858_100084133
618 Ga0068858_100122231
619 Ga0068858_100288606
620 Ga0068860_100033748
621 Ga0068860_100046903
622 Ga0068860_100225155
623 Ga0068860_100573206
624 Ga0068862_100097063
625 Ga0068862_100238195
626 Ga0081539_10000119
627 Ga0081539_10000614
628 Ga0081539_10000681
629 Ga0081539_10001119
630 Ga0070715_10000007
631 Ga0070716_100264725
632 Ga0097621_100003512
633 Ga0097621_100009079
634 Ga0097621_100009802
635 Ga0068871_100003510
636 Ga0068871_100022061
637 Ga0075428_100257877
638 Ga0075428_100285786
639 Ga0075431_100289706
640 Ga0075431_100703444
641 Ga0075433_10123545
642 Ga0075433_10126410
643 Ga0075433_10169859
644 Ga0075433_10176424
645 Ga0075434_100051719
646 Ga0075434_100202236
647 Ga0075434_100240618
648 Ga0075434_100590767
649 Ga0075429_100084385
650 Ga0075429_100257511
651 Ga0075429_100532090
652 Ga0068865_100055207
653 Ga0075436_100031411
654 Ga0097620_100001602
655 Ga0097620_100011867
656 Ga0097620_100014099
657 Ga0097620_100021159
658 Ga0097620_100061735
659 Ga0097620_100065091
660 Ga0097620_100115953
661 Ga0097620_100227392
662 Ga0097620_100238706
663 Ga0097620_100270765
664 Ga0097620_100469274
665 Ga0075435_100015961
666 Ga0105251_10093485
667 Ga0105240_10084684
668 Ga0111539_10006286
669 Ga0111539_10016398
670 Ga0111539_10515852
671 Ga0111539_10568454
672 Ga0111539_10640428
673 Ga0105245_10182800
674 Ga0105247_10003612
675 Ga0114129_10034451
676 Ga0114129_10129563
677 Ga0114129_10187283
678 Ga0114129_10191959
679 Ga0114129_10248770
680 Ga0105243_10028504
681 Ga0105243_10671135
682 Ga0105241_10119889
683 Ga0105241_10367309
684 Ga0105242_10006452
685 Ga0105248_10001348
686 Ga0105248_10011693
687 Ga0105248_10024369
688 Ga0105248_10024852
689 Ga0105248_10044144
690 Ga0105248_10081448
691 Ga0105248_10104485
692 Ga0105248_10125253
693 Ga0105248_10288875
694 Ga0105237_10001297
695 Ga0105237_10036933
696 Ga0105238_10011553
697 Ga0105249_10000139
698 Ga0105249_10134777
699 Ga0105249_10148706
700 Ga0105249_10295037
701 Ga0105249_10373297
702 Ga0105239_10033805
703 Ga0105239_10155680
704 Ga0105239_10349274
705 Ga0105239_10553946
706 Ga0105239_10816691
707 Ga0105246_10066101
708 Ga0105246_10212200
709 Ga0105246_10225604
710 Ga0157373_10006864
711 Ga0157373_10065178
712 Ga0157374_10036167
713 Ga0157378_10000124
714 Ga0157378_10020542
715 Ga0157378_10024795
716 Ga0157378_10231706
717 Ga0157378_10380717
718 Ga0163162_10000045
719 Ga0163162_10015318
720 Ga0163162_10250552
721 Ga0157372_10055956
722 Ga0157372_10846256
723 Ga0157375_10026434
724 Ga0157375_10198126
725 Ga0157375_10202548
726 Ga0163163_10000511
727 Ga0163163_10002463
728 Ga0163163_10017887
729 Ga0163163_10131954
730 Ga0163163_10135202
731 Ga0163163_10211493
732 Ga0163163_10341694
733 Ga0163163_10513248
734 Ga0157380_10035629
735 Ga0157380_10055848
736 Ga0157380_10060191
737 Ga0157380_10103305
738 Ga0157380_10195763
739 Ga0157380_10470248
740 Ga0157377_10044360
741 Ga0157379_10031311
742 Ga0157379_10153111
743 Ga0157379_10289613
744 Ga0157379_10372772
745 Ga0163161_10028019
746 Ga0163161_10255852
747 Ga0207697_10048078
748 Ga0207656_10004610
749 Ga0207653_10007514
750 Ga0207642_10024299
751 Ga0207710_10004336
752 Ga0207647_10013271
753 Ga0207685_10000007
754 Ga0207643_10031918
755 Ga0207643_10204166
756 Ga0207684_10000065
757 Ga0207654_10016705
758 Ga0207654_10441464
759 Ga0207707_10010340
760 Ga0207707_10191851
761 Ga0207695_10071823
762 Ga0207671_10010635
763 Ga0207660_10170151
764 Ga0207662_10011161
765 Ga0207662_10068090
766 Ga0207662_10178383
767 Ga0207662_10277386
768 Ga0207649_10012772
769 Ga0207652_10085118
770 Ga0207681_10232115
771 Ga0207681_10336102
772 Ga0207694_10265120
773 Ga0207650_10000080
774 Ga0207650_10037227
775 Ga0207650_10248250
776 Ga0207650_10271613
777 Ga0207650_10274086
778 Ga0207659_10163917
779 Ga0207644_10245460
780 Ga0207690_10149278
781 Ga0207690_10314612
782 Ga0207706_10123419
783 Ga0207706_10233340
784 Ga0207706_10299069
785 Ga0207686_10049159
786 Ga0207686_10291437
787 Ga0207709_10104807
788 Ga0207670_10115744
789 Ga0207704_10013938
790 Ga0207704_10020246
791 Ga0207704_10088531
792 Ga0207665_10312109
793 Ga0207691_10010591
794 Ga0207711_10002623
795 Ga0207711_10020826
796 Ga0207711_10026929
797 Ga0207711_10207612
798 Ga0207689_10004507
799 Ga0207689_10106130
800 Ga0207679_10012167
801 Ga0207679_10281928
802 Ga0207679_10483766
803 Ga0207651_10019007
804 Ga0207651_10343734
805 Ga0207651_10369716
806 Ga0207712_10004949
807 Ga0207712_10006149
808 Ga0207712_10028251
809 Ga0207712_10053897
810 Ga0207712_10080975
811 Ga0207668_10006797
812 Ga0207640_10108532
813 Ga0207658_10049683
814 Ga0207703_10043599
815 Ga0207703_10103540
816 Ga0207703_10336993
817 Ga0207639_10036221
818 Ga0207639_10142872
819 Ga0207708_10000063
820 Ga0207708_10044072
821 Ga0207708_10074574
822 Ga0207708_10199166
823 Ga0207641_10013045
824 Ga0207641_10022525
825 Ga0207648_10015941
826 Ga0207648_10051811
827 Ga0207648_10626793
828 Ga0207676_10001281
829 Ga0207676_10184580
830 Ga0207676_10204905
831 Ga0207676_10442961
832 Ga0207676_10559604
833 Ga0207674_10000006
834 Ga0207674_10059081
835 Ga0207674_10069649
836 Ga0207675_100008176
837 Ga0207675_100018226
838 Ga0207675_100080953
839 Ga0207683_10028838
840 Ga0207683_10058089
841 Ga0207428_10019082
842 Ga0268265_10067620
843 Ga0268265_10075128
844 Ga0268265_10079385
845 Ga0268264_10095048
846 Ga0268264_10203499
847 Ga0268264_10508067
848 Ga0268264_10528413
849 Ga0307408_100007358
850 Ga0307408_100102388
851 Ga0307413_10016275
852 Ga0307410_10030919
853 Ga0307406_10010389
854 Ga0307406_10272427
855 Ga0307412_10014734
856 Ga0307409_100186237
857 Ga0307416_100065606
858 Ga0307416_100131705
859 Ga0307416_100224267
860 Ga0307414_10033381
861 Ga0307411_10017040
862 Ga0307411_10564601
863 Ga0307415_100010471
864 Ga0307415_100037182
865 Ga0373949_0006037
866 Ga0395898_0267443
867 Ga0395898_0345448
868 Ga0395905_0167416
869 Ga0395901_0735001
870 Ga0439448_0027314
871 Ga0466964_0000330
872 Ga0466959_0051556
873 Ga0451576_0576143
874 Ga0496102_0149350
875 Ga0496102_0229851
876 Ga0496104_0002670
877 Ga0496104_0079373
878 Ga0496106_0139074
879 Ga0496107_0051456
880 Ga0496108_0006977
881 Ga0496109_0007194
882 Ga0496110_0045559
883 Ga0496110_0162320
884 Ga0496110_0420306
885 Ga0496110_0430887
886 Ga0496112_0182761
887 Ga0496112_0341106
888 Ga0501298_000531
889 Ga0501299_006109
890 Ga0501300_008842
891 Ga0501032_0337917
892 Ga0501036_0232706
893 Ga0501038_0026488
894 Ga0501039_0276416
895 Ga0501039_0290761
896 Ga0501042_0069764
897 Ga0501046_0132104
898 Ga0501048_0161276
899 Ga0501071_0237114
900 Ga0501074_0265473
901 Ga0501075_0015394
902 Ga0501076_0009768
903 Ga0501202_019657
904 Ga0501214_003934
905 Ga0501217_001021
906 Ga0501224_005458
907 Ga0501227_002864
908 Ga0501235_009074
909 Ga0501225_0001206
910 Ga0501225_0007272
911 Ga0501229_000458
912 Ga0501273_016245
913 Ga0501283_000478
914 Ga0501035_0452558
915 Ga0501226_000663
916 nmdc:mga05p37_119462_c1
917 nmdc:mga05p37_257910_c1
918 nmdc:mga05p37_36503_c1
919 nmdc:mga09592_299195_c1
920 nmdc:mga0qj67_127709_c1
921 nmdc:mga06r32_247604_c1
922 nmdc:mga08y16_19368_c1
923 nmdc:mga08y16_33601_c1
924 nmdc:mga0n895_172324_c1
925 nmdc:mga0n895_86934_c1
926 nmdc:mga08x19_11829_c1
927 nmdc:mga0a205_139314_c1
928 nmdc:mga0a205_275535_c1
929 nmdc:mga0a205_615488_c1
930 Ga0501084_0063806
931 Ga0501082_0073881
932 Ga0530510_0071008

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

4

174

0.98

PF03450

CO_deh_flav_C

CO dehydrogenase flavoprotein C-terminal domain

178

280

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n5w-assembly1.cif.gz_C crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9488 1 288
1n5w-assembly1.cif.gz_C crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9456 1 288
1ffv-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9454 1 288
1ffu-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor 0.9452 1 288
1zxi-assembly1.cif.gz_F reconstituted co dehydrogenase from oligotropha carboxidovorans 0.9445 1 286
ID Description Score Start End Superfamily
1ffvC03 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.976 60 172 3.30.465.10
af_I6Y7N2_57_165_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9693 65 172 3.30.465.10
1t3qF02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9674 60 175 3.30.465.10
4zohB02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9668 60 172 3.30.465.10
af_Q46800_56_173_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9637 60 173 3.30.465.10
ID Description Score Start End GO Terms
AF-A0A354NZN7-F1-model_v4 Carbon monoxide dehydrogenase 0.9835 113 288 GO:0016491
GO:0071949
AF-A0A537LX60-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9826 184 285
AF-A0A2V7CLG6-F1-model_v4 Carbon monoxide dehydrogenase 0.9791 92 285 GO:0016491
GO:0071949
AF-A0A7V8SVY9-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9771 182 286
AF-A0A7X3VH49-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9769 107 285 GO:0016491
GO:0071949

Map