metagRoot

F449572

General Info

Members	Datasets	Scaffolds	Average Seq Length
465	260	452	133

Family's Representative Sequence

Representative Sequence	3300050509\|nmdc:mga0qj67_10766_c1\|nmdc:mga0qj67_10766_c1_896_1333
Length	145
Sequence	LLPASLIEQESPTMYAVEVRDRIMIAHSLPDPFFGPAQNMHGATFVVDVAFFRETLTRQNVVVDIGAALDVLNKTLKPLAYQNLDVLPQFKGMLTTTEFLCRYVFDAMAKAAEAGALGEDGKGLAKIRVTLRETDLARASFEGPV

Samples

	Sample ID	Description	Type	Environment
1	2643221733	Bosea sp. Root381	Isolate	Unclassified
2	2643221734	Bosea sp. Root670	Isolate	Unclassified
3	2643221736	Bosea sp. Root483D1	Isolate	Unclassified
4	2818991467	Bosea vestrisii 3192	Isolate	Unclassified
5	2841760612	Bosea sp. Tri-49	Isolate	Nodule
6	2841911363	Bosea caraganae RCAM04685	Isolate	Nodule
7	2841917233	Bosea caraganae RCAM04680	Isolate	Nodule
8	2844104063	Bosea sp. Tri-39	Isolate	Nodule
9	2851182111	Bosea sp. Tri-44	Isolate	Nodule
10	2851246043	Bosea sp. Tri-54	Isolate	Nodule
11	2917699015	Bosea sp. F3-2	Isolate	Rhizosphere
12	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
13	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
14	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
15	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
16	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
17	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
18	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
19	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
20	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
21	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
22	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
23	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
24	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
25	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
26	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
27	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
28	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
29	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
30	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
31	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
32	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
33	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
34	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
35	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
36	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
37	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
38	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
39	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
40	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
41	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
42	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
43	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
44	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
45	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
46	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
47	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
48	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
49	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
50	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
51	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
52	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
53	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
54	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
55	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
56	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
57	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
58	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
59	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
60	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
61	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
62	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
63	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
64	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
65	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
66	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
67	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
68	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
69	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
70	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
71	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
72	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
73	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
74	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
75	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
76	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
77	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
78	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
79	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
80	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
81	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
82	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
83	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
84	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
85	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
86	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
87	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
88	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
89	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
90	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
91	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
92	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
93	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
94	3300013250	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05	Metagenome	Rhizosphere
95	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
96	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
97	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
98	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
99	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
100	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
101	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
102	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
103	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
104	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
105	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
106	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
107	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
108	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
109	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
143	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
144	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
147	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
148	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
149	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
150	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
151	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
152	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
153	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
154	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
155	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
156	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
157	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
158	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
159	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
160	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
161	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
162	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
163	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
164	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
165	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
166	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
167	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
168	3300039145	Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1	Metagenome	Unclassified
169	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
170	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
171	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
172	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
173	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
174	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
175	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
176	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
177	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
178	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
179	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
180	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
181	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
182	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
183	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
184	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
185	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
186	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
187	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
188	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
189	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
190	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
191	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
192	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
193	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
194	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
195	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
196	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
197	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
198	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
199	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
200	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
201	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
202	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
203	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
204	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
205	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
206	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
207	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
208	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
209	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
210	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
211	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
212	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
213	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
214	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
215	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
216	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
217	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
218	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
219	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
220	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
221	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
222	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
223	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
224	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
225	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
226	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
227	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
228	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
229	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
230	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
231	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
232	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
233	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
234	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
235	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
236	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
237	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
238	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
239	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
240	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
241	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
242	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
243	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
244	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
245	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
246	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
247	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
248	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
249	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
250	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
251	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
252	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
253	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
254	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
255	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
256	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
257	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
258	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
259	8001845381	Ancylobacter sonchi VKM B-3145	Isolate	Unclassified
260	8057529695	Bosea vestrisii A18/4-2	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	96.99
Metatranscriptomes	0.22
Isolates	2.8

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	10.54
Nodule	1.51
Rhizoplane	6.02
Rhizosphere	78.06
Stem	0
Stem Tuber	0
Unclassified	3.87

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25159J45721_1013162	3300002987	Bacteria	1931
2	JGI25151J46595_10000019	3300003187	Bacteria	236340
3	Ga0006562J51391_1076649	3300003578	Bacteria	1510
4	JGI25404J52841_10030788	3300003659	Bacteria	1148
5	Ga0055526_1000150	3300003771	Bacteria	61554
6	Ga0055526_1001003	3300003771	Bacteria	20750
7	Ga0055524_1000086	3300003775	Bacteria	116519
8	Ga0055524_1013178	3300003775	Bacteria	3132
9	JGI25405J52794_10168856	3300003911	Bacteria	502
10	Ga0065165_1001715	3300005262	Bacteria	21983
11	Ga0070683_100468113	3300005329	Unclassified	1203
12	Ga0070690_100848099	3300005330	Bacteria	711
13	Ga0068869_100099953	3300005334	Unclassified	2193
14	Ga0068869_100319318	3300005334	Bacteria	1259
15	Ga0068868_100717020	3300005338	Bacteria	896
16	Ga0070660_100376761	3300005339	Bacteria	1171
17	Ga0070689_100002844	3300005340	Bacteria	11378
18	Ga0070687_100150614	3300005343	Unclassified	1365
19	Ga0070661_100087874	3300005344	Bacteria	2300
20	Ga0070661_100678686	3300005344	Bacteria	838
21	Ga0070668_100681641	3300005347	Bacteria	905
22	Ga0070675_100000565	3300005354	Bacteria	25513
23	Ga0070675_100594997	3300005354	Unclassified	1003
24	Ga0070674_101961904	3300005356	Bacteria	533
25	Ga0070688_100117193	3300005365	Bacteria	1779
26	Ga0070688_100687727	3300005365	Bacteria	791
27	Ga0070667_101468673	3300005367	Bacteria	640
28	Ga0070667_102006294	3300005367	Bacteria	545
29	Ga0070703_10535347	3300005406	Unclassified	532
30	Ga0070701_10160751	3300005438	Bacteria	1301
31	Ga0070701_10263824	3300005438	Bacteria	1045
32	Ga0070705_100010874	3300005440	Bacteria	4570
33	Ga0070700_100030247	3300005441	Bacteria	3235
34	Ga0070700_100300359	3300005441	Bacteria	1172
35	Ga0070694_100216055	3300005444	Bacteria	1436
36	Ga0070663_100014591	3300005455	Bacteria	5047
37	Ga0070663_100475080	3300005455	Bacteria	1034
38	Ga0070678_100008256	3300005456	Bacteria	6230
39	Ga0070678_100152564	3300005456	Unclassified	1863
40	Ga0070678_101662870	3300005456	Bacteria	600
41	Ga0070681_10013175	3300005458	Bacteria	8214
42	Ga0068867_100447954	3300005459	Bacteria	1099
43	Ga0070685_10151956	3300005466	Unclassified	1468
44	Ga0070679_101635558	3300005530	Bacteria	592
45	Ga0068853_100010412	3300005539	Bacteria	7525
46	Ga0070686_100247371	3300005544	Unclassified	1301
47	Ga0070695_100032631	3300005545	Bacteria	3255
48	Ga0070695_100036588	3300005545	Unclassified	3090
49	Ga0070696_100003568	3300005546	Bacteria	10369
50	Ga0070665_101026176	3300005548	Bacteria	837
51	Ga0070665_102448493	3300005548	Unclassified	524
52	Ga0070704_100111372	3300005549	Bacteria	2083
53	Ga0070704_100220583	3300005549	Bacteria	1541
54	Ga0068855_100019146	3300005563	Bacteria	8227
55	Ga0070664_100023914	3300005564	Bacteria	5048
56	Ga0070664_100847885	3300005564	Bacteria	856
57	Ga0068856_100840780	3300005614	Bacteria	937
58	Ga0068859_100011940	3300005617	Bacteria	8725
59	Ga0068859_100130759	3300005617	Bacteria	2582
60	Ga0068859_100499286	3300005617	Bacteria	1312
61	Ga0068861_100015775	3300005719	Bacteria	5333
62	Ga0068870_10396586	3300005840	Unclassified	897
63	Ga0068863_100100922	3300005841	Bacteria	2743
64	Ga0068863_100760870	3300005841	Bacteria	965
65	Ga0068858_100077899	3300005842	Unclassified	3080
66	Ga0068860_100078866	3300005843	Unclassified	3131
67	Ga0068860_100085486	3300005843	Unclassified	3002
68	Ga0068860_101257209	3300005843	Bacteria	761
69	Ga0068862_101086091	3300005844	Bacteria	795
70	Ga0068862_101625957	3300005844	Bacteria	653
71	Ga0081455_10000086	3300005937	Bacteria	101126
72	Ga0081540_1000644	3300005983	Bacteria	33105
73	Ga0081540_1077381	3300005983	Bacteria	1512
74	Ga0081539_10322797	3300005985	Bacteria	656
75	Ga0075365_10054648	3300006038	Bacteria	2649
76	Ga0075365_11233695	3300006038	Bacteria	526
77	Ga0075368_10001413	3300006042	Bacteria	7677
78	Ga0075368_10001857	3300006042	Bacteria	6782
79	Ga0075363_100007351	3300006048	Bacteria	5055
80	Ga0075363_100021522	3300006048	Bacteria	3250
81	Ga0075363_100065374	3300006048	Unclassified	1966
82	Ga0075363_100806074	3300006048	Bacteria	571
83	Ga0075364_10030526	3300006051	Bacteria	3460
84	Ga0070715_10039996	3300006163	Bacteria	1957
85	Ga0075367_10023207	3300006178	Bacteria	3488
86	Ga0075367_10115668	3300006178	Unclassified	1649
87	Ga0075367_10154265	3300006178	Bacteria	1426
88	Ga0075369_10192216	3300006186	Bacteria	941
89	Ga0075369_10439388	3300006186	Bacteria	617
90	Ga0097621_100385643	3300006237	Bacteria	1252
91	Ga0075370_10457800	3300006353	Bacteria	768
92	Ga0068871_100313129	3300006358	Bacteria	1380
93	Ga0075428_100013354	3300006844	Bacteria	9134
94	Ga0075428_100030684	3300006844	Bacteria	5943
95	Ga0075428_100084579	3300006844	Bacteria	3461
96	Ga0075428_100085554	3300006844	Bacteria	3439
97	Ga0075428_100126579	3300006844	Bacteria	2780
98	Ga0075428_100224988	3300006844	Bacteria	2026
99	Ga0075430_100225114	3300006846	Bacteria	1556
100	Ga0075430_100242349	3300006846	Bacteria	1494
101	Ga0075430_100265136	3300006846	Bacteria	1422
102	Ga0075431_100000050	3300006847	Bacteria	63805
103	Ga0075431_100087121	3300006847	Bacteria	3223
104	Ga0075431_100110998	3300006847	Bacteria	2830
105	Ga0075431_100138258	3300006847	Bacteria	2511
106	Ga0075431_100292576	3300006847	Bacteria	1647
107	Ga0075431_100357992	3300006847	Bacteria	1466
108	Ga0075431_100606346	3300006847	Bacteria	1078
109	Ga0075433_10015158	3300006852	Bacteria	6315
110	Ga0075433_10199935	3300006852	Unclassified	1777
111	Ga0075434_100013941	3300006871	Bacteria	7670
112	Ga0075434_100019370	3300006871	Bacteria	6585
113	Ga0075434_100280103	3300006871	Bacteria	1687
114	Ga0075434_100880378	3300006871	Bacteria	911
115	Ga0075434_101055771	3300006871	Bacteria	826
116	Ga0075429_100012050	3300006880	Bacteria	7494
117	Ga0075429_100086284	3300006880	Bacteria	2736
118	Ga0075429_101563312	3300006880	Bacteria	573
119	Ga0097620_100011941	3300006931	Bacteria	8725
120	Ga0097620_100130754	3300006931	Bacteria	2582
121	Ga0097620_100499263	3300006931	Bacteria	1312
122	Ga0097620_100606837	3300006931	Bacteria	1187
123	Ga0075435_100017577	3300007076	Bacteria	5417
124	Ga0075435_100134406	3300007076	Bacteria	2071
125	Ga0075435_100349815	3300007076	Bacteria	1267
126	Ga0105240_11176463	3300009093	Bacteria	813
127	Ga0111539_10054438	3300009094	Bacteria	4761
128	Ga0111539_10089938	3300009094	Bacteria	3608
129	Ga0111539_10151584	3300009094	Bacteria	2713
130	Ga0111539_10378416	3300009094	Bacteria	1648
131	Ga0111539_10421669	3300009094	Bacteria	1554
132	Ga0111539_11736784	3300009094	Bacteria	724
133	Ga0105245_10036704	3300009098	Bacteria	4354
134	Ga0105245_10121610	3300009098	Bacteria	2440
135	Ga0105247_10592375	3300009101	Bacteria	821
136	Ga0114129_10023596	3300009147	Bacteria	8718
137	Ga0114129_10037006	3300009147	Bacteria	6890
138	Ga0114129_10264352	3300009147	Bacteria	2304
139	Ga0114129_11080682	3300009147	Bacteria	1005
140	Ga0114129_11770012	3300009147	Bacteria	752
141	Ga0105243_10034246	3300009148	Plasmid	3930
142	Ga0105243_10777625	3300009148	Bacteria	941
143	Ga0105243_12199002	3300009148	Unclassified	588
144	Ga0105241_10311926	3300009174	Bacteria	1353
145	Ga0105248_12829070	3300009177	Bacteria	553
146	Ga0105237_10009552	3300009545	Bacteria	10386
147	Ga0105238_10011039	3300009551	Bacteria	9083
148	Ga0105249_10401368	3300009553	Bacteria	1401
149	Ga0105249_10476211	3300009553	Bacteria	1291
150	Ga0105249_12080545	3300009553	Bacteria	640
151	Ga0105239_10381455	3300010375	Bacteria	1594
152	Ga0105246_10045650	3300011119	Unclassified	2985
153	Ga0105246_10453158	3300011119	Bacteria	1079
154	Ga0105246_11996210	3300011119	Bacteria	559
155	Ga0171462_1006	3300013250	Bacteria	432986
156	Ga0157378_10736355	3300013297	Bacteria	1008
157	Ga0163162_10287797	3300013306	Bacteria	1775
158	Ga0163162_11176414	3300013306	Bacteria	870
159	Ga0157372_10878969	3300013307	Unclassified	1040
160	Ga0157372_10906145	3300013307	Bacteria	1023
161	Ga0157375_10156923	3300013308	Bacteria	2415
162	Ga0157375_10336045	3300013308	Bacteria	1676
163	Ga0157375_13196191	3300013308	Bacteria	546
164	Ga0163163_10501477	3300014325	Bacteria	1276
165	Ga0163163_11238105	3300014325	Bacteria	809
166	Ga0157380_10677141	3300014326	Bacteria	1033
167	Ga0157380_12235326	3300014326	Bacteria	611
168	Ga0157379_10030267	3300014968	Bacteria	4817
169	Ga0157379_10039761	3300014968	Bacteria	4196
170	Ga0157379_10489064	3300014968	Bacteria	1139
171	Ga0157376_11081580	3300014969	Unclassified	827
172	Ga0209565_1053184	3300025263	Bacteria	721
173	Ga0209130_1000343	3300025284	Bacteria	53596
174	Ga0209675_1000444	3300025291	Bacteria	32224
175	Ga0209025_1000008	3300025294	Bacteria	1130876
176	Ga0209025_1000835	3300025294	Bacteria	48894
177	Ga0209564_1000015	3300025295	Bacteria	615324
178	Ga0209564_1000041	3300025295	Bacteria	405199
179	Ga0209256_1000062	3300025299	Bacteria	253433
180	Ga0209256_1000277	3300025299	Bacteria	89863
181	Ga0207688_10586342	3300025901	Bacteria	702
182	Ga0207647_10102987	3300025904	Bacteria	1693
183	Ga0207685_10028904	3300025905	Bacteria	1957
184	Ga0207645_10886384	3300025907	Bacteria	606
185	Ga0207654_10146106	3300025911	Bacteria	1513
186	Ga0207671_10027526	3300025914	Bacteria	4250
187	Ga0207660_10014188	3300025917	Bacteria	5232
188	Ga0207649_10433847	3300025920	Bacteria	989
189	Ga0207652_10039275	3300025921	Bacteria	4017
190	Ga0207652_10865544	3300025921	Bacteria	800
191	Ga0207652_11353430	3300025921	Bacteria	615
192	Ga0207694_10163244	3300025924	Bacteria	1800
193	Ga0207687_10314861	3300025927	Bacteria	1265
194	Ga0207690_10113513	3300025932	Bacteria	1955
195	Ga0207690_10601493	3300025932	Bacteria	897
196	Ga0207706_10694478	3300025933	Bacteria	870
197	Ga0207709_10290640	3300025935	Bacteria	1211
198	Ga0207709_10535694	3300025935	Bacteria	919
199	Ga0207670_10005579	3300025936	Bacteria	6916
200	Ga0207670_10593784	3300025936	Bacteria	908
201	Ga0207669_10169785	3300025937	Bacteria	1551
202	Ga0207704_11474796	3300025938	Bacteria	584
203	Ga0207689_10165970	3300025942	Bacteria	1819
204	Ga0207661_10701529	3300025944	Unclassified	931
205	Ga0207667_10871732	3300025949	Unclassified	893
206	Ga0207651_11344981	3300025960	Bacteria	642
207	Ga0207712_10260978	3300025961	Bacteria	1405
208	Ga0207712_11113874	3300025961	Bacteria	703
209	Ga0207712_11505206	3300025961	Bacteria	603
210	Ga0207668_10791559	3300025972	Unclassified	839
211	Ga0207668_10810847	3300025972	Bacteria	829
212	Ga0207640_10635010	3300025981	Bacteria	908
213	Ga0207658_11155361	3300025986	Bacteria	708
214	Ga0207703_10040755	3300026035	Unclassified	3718
215	Ga0207703_11494001	3300026035	Bacteria	650
216	Ga0207703_12073241	3300026035	Bacteria	545
217	Ga0207639_10057905	3300026041	Bacteria	2978
218	Ga0207678_10000332	3300026067	Bacteria	42422
219	Ga0207678_10633385	3300026067	Bacteria	939
220	Ga0207708_10737569	3300026075	Bacteria	845
221	Ga0207641_12464355	3300026088	Bacteria	519
222	Ga0207648_10131440	3300026089	Bacteria	2204
223	Ga0207683_10391556	3300026121	Bacteria	1278
224	Ga0207698_12066156	3300026142	Bacteria	584
225	Ga0209813_10004108	3300027866	Bacteria	3455
226	Ga0209813_10008023	3300027866	Bacteria	2653
227	Ga0207428_10148572	3300027907	Bacteria	1785
228	Ga0207428_10268963	3300027907	Bacteria	1268
229	Ga0207428_10360793	3300027907	Bacteria	1068
230	Ga0207428_10576852	3300027907	Unclassified	812
231	Ga0268266_11192238	3300028379	Bacteria	736
232	Ga0268266_11384136	3300028379	Bacteria	679
233	Ga0268264_10005517	3300028381	Bacteria	10729
234	Ga0268264_10459112	3300028381	Bacteria	1235
235	Ga0268264_10516133	3300028381	Bacteria	1167
236	Ga0268264_10970885	3300028381	Bacteria	855
237	Ga0307406_10211818	3300031901	Bacteria	1434
238	Ga0307406_10878135	3300031901	Bacteria	762
239	Ga0307409_101411005	3300031995	Bacteria	723
240	Ga0307409_101688402	3300031995	Bacteria	662
241	Ga0307414_10756614	3300032004	Bacteria	883
242	Ga0373938_0006642	3300034957	Bacteria	2007
243	Ga0373938_0068386	3300034957	Bacteria	844
244	Ga0373928_0002653	3300035084	Bacteria	3467
245	Ga0373929_0065367	3300035085	Bacteria	860
246	Ga0373944_0314843	3300035089	Unclassified	590
247	Ga0373949_0008810	3300035090	Bacteria	2207
248	Ga0373949_0022941	3300035090	Bacteria	1442
249	Ga0373952_0008994	3300035092	Bacteria	1904
250	Ga0373945_0030101	3300035116	Bacteria	1912
251	Ga0373960_0019952	3300035121	Bacteria	1767
252	Ga0373943_0405174	3300035170	Bacteria	788
253	Ga0373943_0527253	3300035170	Bacteria	692
254	Ga0373962_0003605	3300035242	Bacteria	3723
255	Ga0373962_0005490	3300035242	Bacteria	3067
256	Ga0316574_0043386	3300035398	Bacteria	2779
257	Ga0373931_0000159	3300035691	Bacteria	29428
258	Ga0373931_0007394	3300035691	Bacteria	5173
259	Ga0373927_1014400	3300035695	Bacteria	547
260	Ga0373933_0871325	3300035724	Unclassified	593
261	Ga0373947_0836317	3300035725	Bacteria	628
262	Ga0373947_0849604	3300035725	Unclassified	623
263	Ga0373925_0234372	3300037068	Bacteria	1468
264	Ga0395905_0679412	3300037471	Bacteria	932
265	Ga0395901_0214783	3300038443	Bacteria	2012
266	Ga0395901_0467855	3300038443	Bacteria	1287
267	Ga0400483_063203	3300039062	Unclassified	1029
268	Ga0400483_154198	3300039062	Bacteria	2250
269	Ga0400483_259502	3300039062	Bacteria	2214
270	Ga0237816_09673	3300039145	Bacteria	571
271	Ga0451797_0307969	3300041453	Bacteria	801
272	Ga0451841_1358050	3300041498	Bacteria	1283
273	Ga0439431_0273733	3300041997	Bacteria	505
274	Ga0451576_0025080	3300045051	Bacteria	6429
275	Ga0451576_0681274	3300045051	Bacteria	1080
276	Ga0495603_0074590	3300046455	Bacteria	1992
277	Ga0495629_1012815	3300046459	Bacteria	540
278	Ga0495584_0085925	3300046491	Bacteria	1585
279	Ga0495584_0256610	3300046491	Bacteria	889
280	Ga0495594_0595842	3300046499	Bacteria	627
281	Ga0495594_0718984	3300046499	Bacteria	564
282	Ga0495633_0524419	3300046558	Bacteria	534
283	Ga0495656_0591209	3300046615	Bacteria	594
284	Ga0495668_0584187	3300046616	Bacteria	617
285	Ga0495625_0428784	3300046660	Bacteria	821
286	Ga0495588_0599257	3300046674	Bacteria	577
287	Ga0495581_0305222	3300047315	Bacteria	930
288	Ga0495604_0476008	3300047317	Bacteria	813
289	Ga0495684_0463692	3300047471	Bacteria	878
290	Ga0495615_0045962	3300048090	Bacteria	1108
291	Ga0496100_0024469	3300048903	Bacteria	3684
292	Ga0496101_0057249	3300048904	Unclassified	2819
293	Ga0496101_1153283	3300048904	Bacteria	608
294	Ga0496102_0058863	3300048905	Bacteria	3512
295	Ga0496102_0149606	3300048905	Bacteria	2193
296	Ga0496103_0117357	3300048906	Bacteria	1694
297	Ga0496103_0151896	3300048906	Bacteria	1483
298	Ga0496104_0010481	3300048907	Bacteria	8280
299	Ga0496105_0036019	3300048908	Bacteria	4075
300	Ga0496105_0107789	3300048908	Bacteria	2300
301	Ga0496106_0017098	3300048909	Bacteria	5368
302	Ga0496106_0952969	3300048909	Bacteria	676
303	Ga0496107_0015705	3300048910	Bacteria	5308
304	Ga0496108_0177940	3300048911	Bacteria	1842
305	Ga0496108_0407722	3300048911	Bacteria	1187
306	Ga0496109_0058136	3300048912	Bacteria	3532
307	Ga0496109_0652090	3300048912	Bacteria	990
308	Ga0496109_0832518	3300048912	Bacteria	861
309	Ga0496110_0063419	3300048913	Bacteria	3265
310	Ga0496110_0339758	3300048913	Bacteria	1368
311	Ga0496110_0580852	3300048913	Bacteria	1017
312	Ga0496111_0074090	3300048914	Bacteria	2479
313	Ga0496112_0083086	3300048915	Bacteria	3167
314	Ga0496112_0195946	3300048915	Bacteria	1981
315	Ga0496113_0607324	3300048916	Bacteria	876
316	Ga0496114_0631149	3300048917	Bacteria	943
317	Ga0496115_0016712	3300048918	Bacteria	5592
318	Ga0496116_0308340	3300048919	Bacteria	749
319	Ga0496117_0051214	3300048920	Bacteria	2921
320	Ga0496118_0248227	3300048921	Bacteria	1013
321	Ga0496122_0045785	3300048925	Bacteria	3395
322	Ga0496122_0162608	3300048925	Bacteria	1359
323	Ga0496124_0243435	3300048927	Bacteria	1336
324	Ga0496126_0531762	3300048929	Bacteria	935
325	Ga0501032_0222761	3300049569	Bacteria	1227
326	Ga0501033_0232935	3300049570	Bacteria	1308
327	Ga0501034_0043226	3300049571	Bacteria	4561
328	Ga0501036_0652519	3300049572	Bacteria	871
329	Ga0501036_1264841	3300049572	Bacteria	600
330	Ga0501037_0386474	3300049573	Bacteria	961
331	Ga0501037_0402450	3300049573	Bacteria	939
332	Ga0501038_0850463	3300049574	Bacteria	676
333	Ga0501039_0357664	3300049575	Bacteria	1147
334	Ga0501039_0469829	3300049575	Bacteria	988
335	Ga0501039_0671146	3300049575	Bacteria	811
336	Ga0501040_0100919	3300049576	Bacteria	2013
337	Ga0501041_0548509	3300049577	Bacteria	737
338	Ga0501041_0676815	3300049577	Bacteria	660
339	Ga0501042_0372119	3300049578	Bacteria	1034
340	Ga0501042_1271200	3300049578	Bacteria	537
341	Ga0501043_0252212	3300049579	Bacteria	1359
342	Ga0501046_0004178	3300049580	Bacteria	13147
343	Ga0501046_0034494	3300049580	Bacteria	4083
344	Ga0501046_0053479	3300049580	Bacteria	3180
345	Ga0501046_0223841	3300049580	Bacteria	1392
346	Ga0501047_0023955	3300049581	Bacteria	5862
347	Ga0501047_0233284	3300049581	Bacteria	1693
348	Ga0501048_0000606	3300049582	Bacteria	25495
349	Ga0501067_0002553	3300049583	Bacteria	10051
350	Ga0501067_0049104	3300049583	Bacteria	2339
351	Ga0501067_0060811	3300049583	Bacteria	2091
352	Ga0501067_0304752	3300049583	Bacteria	887
353	Ga0501068_0448124	3300049584	Bacteria	835
354	Ga0501070_1221585	3300049586	Bacteria	576
355	Ga0501071_0323601	3300049587	Bacteria	1171
356	Ga0501071_0992276	3300049587	Bacteria	649
357	Ga0501071_1074244	3300049587	Bacteria	622
358	Ga0501072_0080131	3300049588	Bacteria	2586
359	Ga0501074_0145558	3300049590	Bacteria	1694
360	Ga0501074_0397490	3300049590	Bacteria	977
361	Ga0501074_1123575	3300049590	Bacteria	552
362	Ga0501075_0102622	3300049591	Bacteria	2172
363	Ga0501075_0243404	3300049591	Bacteria	1371
364	Ga0501075_0259292	3300049591	Bacteria	1325
365	Ga0501076_0009511	3300049592	Bacteria	7179
366	Ga0501076_0174925	3300049592	Bacteria	1750
367	Ga0501076_0186837	3300049592	Bacteria	1690
368	Ga0501076_1637653	3300049592	Bacteria	528
369	Ga0501077_0004496	3300049593	Bacteria	8471
370	Ga0501077_0012684	3300049593	Bacteria	5278
371	Ga0501077_0113364	3300049593	Bacteria	1719
372	Ga0501077_0133211	3300049593	Bacteria	1576
373	Ga0501079_0008964	3300049741	Bacteria	7575
374	Ga0501079_0335655	3300049741	Bacteria	1184
375	Ga0501079_1198375	3300049741	Bacteria	598
376	Ga0501079_1229402	3300049741	Bacteria	590
377	Ga0501079_1569474	3300049741	Bacteria	518
378	Ga0501079_1626681	3300049741	Bacteria	508
379	Ga0501080_0007284	3300049742	Bacteria	9981
380	Ga0501081_0006905	3300049743	Bacteria	7377
381	Ga0501081_0747482	3300049743	Bacteria	735
382	Ga0501081_0834761	3300049743	Bacteria	694
383	Ga0501081_1492862	3300049743	Bacteria	513
384	Ga0501083_0311725	3300049744	Bacteria	1023
385	Ga0501035_0277024	3300049822	Bacteria	1419
386	Ga0501035_0571801	3300049822	Bacteria	924
387	Ga0501044_0115289	3300049823	Bacteria	2692
388	Ga0501044_0273313	3300049823	Bacteria	1625
389	Ga0501045_0032465	3300049824	Bacteria	3783
390	Ga0501045_0057504	3300049824	Bacteria	2846
391	Ga0501045_0149791	3300049824	Bacteria	1735
392	Ga0501045_0716378	3300049824	Bacteria	738
393	nmdc:mga03n38_115425_c1	3300050490	Bacteria	1313
394	nmdc:mga03n38_61273_c1	3300050490	Bacteria	1713
395	nmdc:mga03n38_793_c1	3300050490	Bacteria	8393
396	nmdc:mga00v17_115176_c1	3300050491	Bacteria	1708
397	nmdc:mga00v17_13509_c1	3300050491	Bacteria	4537
398	nmdc:mga0yw44_43336_c1	3300050492	Bacteria	2686
399	nmdc:mga0yw44_50869_c1	3300050492	Bacteria	2507
400	nmdc:mga06z11_11655_c1	3300050494	Bacteria	3799
401	nmdc:mga06z11_3967_c1	3300050494	Bacteria	5771
402	nmdc:mga06z11_4120_c1	3300050494	Bacteria	5681
403	nmdc:mga04h51_3528_c1	3300050495	Bacteria	3805
404	nmdc:mga04h51_9240_c1	3300050495	Bacteria	2664
405	nmdc:mga05p37_832105_c1	3300050507	Unclassified	1005
406	nmdc:mga05p37_887939_c1	3300050507	Bacteria	963
407	nmdc:mga09592_15701_c1	3300050508	Bacteria	6187
408	nmdc:mga09592_1585156_c1	3300050508	Bacteria	531
409	nmdc:mga09592_36651_c1	3300050508	Bacteria	4109
410	nmdc:mga09592_959517_c1	3300050508	Unclassified	716
411	nmdc:mga0qj67_10766_c1	3300050509	Bacteria	6840
412	nmdc:mga0qj67_11268_c1	3300050509	Bacteria	6697
413	nmdc:mga0qj67_198508_c1	3300050509	Bacteria	1630
414	nmdc:mga0qj67_8188_c1	3300050509	Bacteria	7748
415	nmdc:mga06r32_100105_c1	3300050510	Bacteria	2843
416	nmdc:mga06r32_139821_c1	3300050510	Bacteria	2397
417	nmdc:mga06r32_1897_c1	3300050510	Bacteria	18623
418	nmdc:mga06r32_354787_c1	3300050510	Bacteria	1451
419	nmdc:mga06r32_58027_c1	3300050510	Bacteria	3720
420	nmdc:mga06r32_69432_c1	3300050510	Bacteria	3405
421	nmdc:mga06r32_91583_c1	3300050510	Bacteria	2972
422	nmdc:mga08y16_169891_c1	3300050511	Bacteria	2265
423	nmdc:mga08y16_180069_c1	3300050511	Bacteria	2195
424	nmdc:mga08y16_252060_c1	3300050511	Bacteria	1824
425	nmdc:mga08y16_261758_c1	3300050511	Bacteria	1786
426	nmdc:mga08y16_70910_c1	3300050511	Bacteria	3632
427	nmdc:mga0n895_10458_c1	3300050512	Bacteria	8200
428	nmdc:mga0n895_1524124_c1	3300050512	Bacteria	634
429	nmdc:mga0rr50_117317_c1	3300050513	Bacteria	2114
430	nmdc:mga0rr50_24646_c1	3300050513	Bacteria	4170
431	nmdc:mga0a205_219693_c1	3300050515	Bacteria	1786
432	nmdc:mga0a205_625411_c1	3300050515	Bacteria	929
433	nmdc:mga0a205_631475_c1	3300050515	Bacteria	923
434	nmdc:mga0a205_94539_c1	3300050515	Bacteria	2888
435	nmdc:mga0sz30_178823_c1	3300050516	Bacteria	941
436	nmdc:mga0sz30_383650_c1	3300050516	Bacteria	629
437	Ga0495601_0344911	3300053077	Bacteria	969
438	Ga0495619_0143543	3300053085	Unclassified	1645
439	Ga0500595_053822	3300053119	Bacteria	1238
440	Ga0500616_0015679	3300053153	Bacteria	4326
441	Ga0501084_0000417	3300054114	Bacteria	32966
442	Ga0501084_0085493	3300054114	Bacteria	2648
443	Ga0501084_1478644	3300054114	Bacteria	569
444	Ga0501082_0013858	3300060353	Bacteria	6932
445	Ga0501082_0041798	3300060353	Bacteria	3953
446	Ga0501082_0052111	3300060353	Bacteria	3527
447	Ga0501082_0354263	3300060353	Bacteria	1280
448	Ga0501082_1301824	3300060353	Bacteria	635
449	Ga0530510_0034781	3300061734	Bacteria	3630
450	Ga0530510_0171850	3300061734	Bacteria	1605
451	Ga0530510_0212399	3300061734	Bacteria	1438
452	Ga0530510_0268206	3300061734	Bacteria	1274

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005354	Ga0070675_100594997	Ga0070675_1005949972	122
2	3300009148	Ga0105243_12199002	Ga0105243_121990021	122
3	3300009177	Ga0105248_12829070	Ga0105248_128290701	122
4	3300014969	Ga0157376_11081580	Ga0157376_110815801	122
5	3300045051	Ga0451576_0681274	Ga0451576_0681274_212_580	122
6	3300049584	Ga0501068_0448124	Ga0501068_0448124_22_390	122
7	3300049590	Ga0501074_1123575	Ga0501074_1123575_159_527	122
8	3300049741	Ga0501079_1626681	Ga0501079_1626681_28_396	122
9	3300050515	nmdc:mga0a205_625411_c1	nmdc:mga0a205_625411_c1_49_417	122
10	3300037471	Ga0395905_0679412	Ga0395905_0679412_19_402	123
11	3300041997	Ga0439431_0273733	Ga0439431_0273733_116_487	123
12	3300028381	Ga0268264_10970885	Ga0268264_109708852	127
13	iso_pu_bacteria	2643221733	2644731782	129
14	iso_pu_bacteria	2643221734	2644736732	129
15	iso_pu_bacteria	2643221736	2644745152	129
16	iso_pu_bacteria	2818991467	2819719235	129
17	iso_pu_bacteria	2841760612	2841760668	129
18	iso_pu_bacteria	2841911363	2841915858	129
19	iso_pu_bacteria	2841917233	2841921762	129
20	iso_pu_bacteria	2844104063	2844106325	129
21	iso_pu_bacteria	2851182111	2851187276	129
22	iso_pu_bacteria	2851246043	2851246681	129
23	iso_pu_bacteria	2917699015	2917704446	129
24	iso_pu_bacteria	8001845381	8001846528	129
25	iso_pu_bacteria	8057529695	8057531123	129
26	3300003659	JGI25404J52841_10030788	JGI25404J52841_100307882	132
27	3300003911	JGI25405J52794_10168856	JGI25405J52794_101688561	132
28	3300005329	Ga0070683_100468113	Ga0070683_1004681132	132
29	3300005330	Ga0070690_100848099	Ga0070690_1008480992	132
30	3300005334	Ga0068869_100099953	Ga0068869_1000999533	132
31	3300005334	Ga0068869_100319318	Ga0068869_1003193182	132
32	3300005338	Ga0068868_100717020	Ga0068868_1007170201	132
33	3300005340	Ga0070689_100002844	Ga0070689_10000284410	132
34	3300005343	Ga0070687_100150614	Ga0070687_1001506142	132
35	3300005344	Ga0070661_100678686	Ga0070661_1006786861	132
36	3300005347	Ga0070668_100681641	Ga0070668_1006816412	132
37	3300005354	Ga0070675_100000565	Ga0070675_10000056510	132
38	3300005356	Ga0070674_101961904	Ga0070674_1019619041	132
39	3300005365	Ga0070688_100117193	Ga0070688_1001171931	132
40	3300005367	Ga0070667_101468673	Ga0070667_1014686731	132
41	3300005367	Ga0070667_102006294	Ga0070667_1020062941	132
42	3300005438	Ga0070701_10160751	Ga0070701_101607512	132
43	3300005438	Ga0070701_10263824	Ga0070701_102638242	132
44	3300005441	Ga0070700_100030247	Ga0070700_1000302472	132
45	3300005441	Ga0070700_100300359	Ga0070700_1003003591	132
46	3300005444	Ga0070694_100216055	Ga0070694_1002160552	132
47	3300005455	Ga0070663_100475080	Ga0070663_1004750802	132
48	3300005456	Ga0070678_100152564	Ga0070678_1001525642	132
49	3300005456	Ga0070678_101662870	Ga0070678_1016628702	132
50	3300005459	Ga0068867_100447954	Ga0068867_1004479542	132
51	3300005466	Ga0070685_10151956	Ga0070685_101519561	132
52	3300005544	Ga0070686_100247371	Ga0070686_1002473711	132
53	3300005545	Ga0070695_100032631	Ga0070695_1000326312	132
54	3300005548	Ga0070665_101026176	Ga0070665_1010261762	132
55	3300005549	Ga0070704_100111372	Ga0070704_1001113722	132
56	3300005549	Ga0070704_100220583	Ga0070704_1002205832	132
57	3300005564	Ga0070664_100847885	Ga0070664_1008478852	132
58	3300005617	Ga0068859_100011940	Ga0068859_1000119402	132
59	3300005617	Ga0068859_100130759	Ga0068859_1001307593	132
60	3300005617	Ga0068859_100499286	Ga0068859_1004992862	132
61	3300005719	Ga0068861_100015775	Ga0068861_1000157753	132
62	3300005840	Ga0068870_10396586	Ga0068870_103965862	132
63	3300005841	Ga0068863_100100922	Ga0068863_1001009223	132
64	3300005843	Ga0068860_100078866	Ga0068860_1000788663	132
65	3300005843	Ga0068860_101257209	Ga0068860_1012572092	132
66	3300005844	Ga0068862_101086091	Ga0068862_1010860912	132
67	3300005937	Ga0081455_10000086	Ga0081455_1000008691	132
68	3300005983	Ga0081540_1000644	Ga0081540_10006445	132
69	3300005985	Ga0081539_10322797	Ga0081539_103227972	132
70	3300006038	Ga0075365_10054648	Ga0075365_100546483	132
71	3300006042	Ga0075368_10001413	Ga0075368_100014133	132
72	3300006042	Ga0075368_10001857	Ga0075368_100018577	132
73	3300006048	Ga0075363_100007351	Ga0075363_1000073513	132
74	3300006048	Ga0075363_100021522	Ga0075363_1000215223	132
75	3300006048	Ga0075363_100065374	Ga0075363_1000653742	132
76	3300006051	Ga0075364_10030526	Ga0075364_100305261	132
77	3300006163	Ga0070715_10039996	Ga0070715_100399962	132
78	3300006178	Ga0075367_10023207	Ga0075367_100232074	132
79	3300006178	Ga0075367_10115668	Ga0075367_101156682	132
80	3300006178	Ga0075367_10154265	Ga0075367_101542652	132
81	3300006844	Ga0075428_100013354	Ga0075428_1000133547	132
82	3300006844	Ga0075428_100030684	Ga0075428_1000306846	132
83	3300006844	Ga0075428_100084579	Ga0075428_1000845792	132
84	3300006844	Ga0075428_100085554	Ga0075428_1000855544	132
85	3300006844	Ga0075428_100126579	Ga0075428_1001265794	132
86	3300006846	Ga0075430_100225114	Ga0075430_1002251142	132
87	3300006846	Ga0075430_100242349	Ga0075430_1002423491	132
88	3300006846	Ga0075430_100265136	Ga0075430_1002651362	132
89	3300006847	Ga0075431_100000050	Ga0075431_10000005041	132
90	3300006847	Ga0075431_100087121	Ga0075431_1000871212	132
91	3300006847	Ga0075431_100110998	Ga0075431_1001109983	132
92	3300006847	Ga0075431_100138258	Ga0075431_1001382582	132
93	3300006847	Ga0075431_100292576	Ga0075431_1002925762	132
94	3300006847	Ga0075431_100357992	Ga0075431_1003579922	132
95	3300006847	Ga0075431_100606346	Ga0075431_1006063462	132
96	3300006852	Ga0075433_10015158	Ga0075433_100151583	132
97	3300006852	Ga0075433_10199935	Ga0075433_101999352	132
98	3300006871	Ga0075434_100013941	Ga0075434_1000139413	132
99	3300006871	Ga0075434_100019370	Ga0075434_1000193704	132
100	3300006871	Ga0075434_100280103	Ga0075434_1002801032	132
101	3300006871	Ga0075434_100880378	Ga0075434_1008803782	132
102	3300006871	Ga0075434_101055771	Ga0075434_1010557712	132
103	3300006880	Ga0075429_100012050	Ga0075429_1000120507	132
104	3300006880	Ga0075429_100086284	Ga0075429_1000862842	132
105	3300006880	Ga0075429_101563312	Ga0075429_1015633121	132
106	3300006931	Ga0097620_100011941	Ga0097620_1000119412	132
107	3300006931	Ga0097620_100130754	Ga0097620_1001307543	132
108	3300006931	Ga0097620_100499263	Ga0097620_1004992632	132
109	3300007076	Ga0075435_100017577	Ga0075435_1000175774	132
110	3300007076	Ga0075435_100134406	Ga0075435_1001344063	132
111	3300007076	Ga0075435_100349815	Ga0075435_1003498151	132
112	3300009094	Ga0111539_10054438	Ga0111539_100544384	132
113	3300009094	Ga0111539_10089938	Ga0111539_100899383	132
114	3300009094	Ga0111539_10151584	Ga0111539_101515842	132
115	3300009094	Ga0111539_10378416	Ga0111539_103784162	132
116	3300009094	Ga0111539_11736784	Ga0111539_117367841	132
117	3300009098	Ga0105245_10121610	Ga0105245_101216102	132
118	3300009101	Ga0105247_10592375	Ga0105247_105923752	132
119	3300009147	Ga0114129_10023596	Ga0114129_100235963	132
120	3300009147	Ga0114129_10037006	Ga0114129_100370063	132
121	3300009147	Ga0114129_10264352	Ga0114129_102643522	132
122	3300009147	Ga0114129_11080682	Ga0114129_110806822	132
123	3300009147	Ga0114129_11770012	Ga0114129_117700122	132
124	3300009148	Ga0105243_10777625	Ga0105243_107776252	132
125	3300009553	Ga0105249_12080545	Ga0105249_120805451	132
126	3300011119	Ga0105246_11996210	Ga0105246_119962101	132
127	3300013297	Ga0157378_10736355	Ga0157378_107363552	132
128	3300013308	Ga0157375_10156923	Ga0157375_101569233	132
129	3300014325	Ga0163163_10501477	Ga0163163_105014772	132
130	3300014325	Ga0163163_11238105	Ga0163163_112381051	132
131	3300014326	Ga0157380_10677141	Ga0157380_106771412	132
132	3300014326	Ga0157380_12235326	Ga0157380_122353262	132
133	3300014968	Ga0157379_10039761	Ga0157379_100397613	132
134	3300014968	Ga0157379_10489064	Ga0157379_104890642	132
135	3300025901	Ga0207688_10586342	Ga0207688_105863421	132
136	3300025905	Ga0207685_10028904	Ga0207685_100289042	132
137	3300025907	Ga0207645_10886384	Ga0207645_108863842	132
138	3300025927	Ga0207687_10314861	Ga0207687_103148612	132
139	3300025932	Ga0207690_10601493	Ga0207690_106014932	132
140	3300025933	Ga0207706_10694478	Ga0207706_106944782	132
141	3300025935	Ga0207709_10290640	Ga0207709_102906402	132
142	3300025936	Ga0207670_10005579	Ga0207670_100055797	132
143	3300025936	Ga0207670_10593784	Ga0207670_105937842	132
144	3300025937	Ga0207669_10169785	Ga0207669_101697852	132
145	3300025938	Ga0207704_11474796	Ga0207704_114747962	132
146	3300025944	Ga0207661_10701529	Ga0207661_107015292	132
147	3300025960	Ga0207651_11344981	Ga0207651_113449811	132
148	3300025961	Ga0207712_11113874	Ga0207712_111138742	132
149	3300025961	Ga0207712_11505206	Ga0207712_115052061	132
150	3300025972	Ga0207668_10810847	Ga0207668_108108472	132
151	3300025986	Ga0207658_11155361	Ga0207658_111553611	132
152	3300026035	Ga0207703_11494001	Ga0207703_114940011	132
153	3300026035	Ga0207703_12073241	Ga0207703_120732411	132
154	3300026067	Ga0207678_10633385	Ga0207678_106333852	132
155	3300026075	Ga0207708_10737569	Ga0207708_107375691	132
156	3300026088	Ga0207641_12464355	Ga0207641_124643551	132
157	3300026089	Ga0207648_10131440	Ga0207648_101314403	132
158	3300026121	Ga0207683_10391556	Ga0207683_103915562	132
159	3300027866	Ga0209813_10004108	Ga0209813_100041083	132
160	3300027866	Ga0209813_10008023	Ga0209813_100080232	132
161	3300027907	Ga0207428_10268963	Ga0207428_102689632	132
162	3300027907	Ga0207428_10360793	Ga0207428_103607932	132
163	3300027907	Ga0207428_10576852	Ga0207428_105768521	132
164	3300028379	Ga0268266_11192238	Ga0268266_111922382	132
165	3300028381	Ga0268264_10005517	Ga0268264_100055173	132
166	3300028381	Ga0268264_10516133	Ga0268264_105161331	132
167	3300034957	Ga0373938_0006642	Ga0373938_0006642_838_1236	132
168	3300034957	Ga0373938_0068386	Ga0373938_0068386_309_707	132
169	3300035084	Ga0373928_0002653	Ga0373928_0002653_2438_2836	132
170	3300035085	Ga0373929_0065367	Ga0373929_0065367_61_459	132
171	3300035090	Ga0373949_0008810	Ga0373949_0008810_156_554	132
172	3300035090	Ga0373949_0022941	Ga0373949_0022941_712_1110	132
173	3300035092	Ga0373952_0008994	Ga0373952_0008994_1194_1592	132
174	3300035121	Ga0373960_0019952	Ga0373960_0019952_24_422	132
175	3300035170	Ga0373943_0527253	Ga0373943_0527253_186_584	132
176	3300035242	Ga0373962_0003605	Ga0373962_0003605_1312_1710	132
177	3300035242	Ga0373962_0005490	Ga0373962_0005490_1665_2063	132
178	3300035691	Ga0373931_0000159	Ga0373931_0000159_2109_2507	132
179	3300035691	Ga0373931_0007394	Ga0373931_0007394_3978_4376	132
180	3300035695	Ga0373927_1014400	Ga0373927_1014400_128_526	132
181	3300035725	Ga0373947_0849604	Ga0373947_0849604_20_418	132
182	3300039062	Ga0400483_154198	Ga0400483_154198_1153_1551	132
183	3300041498	Ga0451841_1358050	Ga0451841_1358050_413_844	132
184	3300046455	Ga0495603_0074590	Ga0495603_0074590_1379_1777	132
185	3300046459	Ga0495629_1012815	Ga0495629_1012815_76_474	132
186	3300046491	Ga0495584_0085925	Ga0495584_0085925_543_941	132
187	3300046491	Ga0495584_0256610	Ga0495584_0256610_404_802	132
188	3300046499	Ga0495594_0595842	Ga0495594_0595842_115_513	132
189	3300046558	Ga0495633_0524419	Ga0495633_0524419_57_455	132
190	3300046615	Ga0495656_0591209	Ga0495656_0591209_157_555	132
191	3300046616	Ga0495668_0584187	Ga0495668_0584187_115_513	132
192	3300048905	Ga0496102_0058863	Ga0496102_0058863_1303_1701	132
193	3300048906	Ga0496103_0117357	Ga0496103_0117357_643_1041	132
194	3300048907	Ga0496104_0010481	Ga0496104_0010481_5196_5594	132
195	3300048908	Ga0496105_0036019	Ga0496105_0036019_346_744	132
196	3300048909	Ga0496106_0952969	Ga0496106_0952969_98_496	132
197	3300048911	Ga0496108_0177940	Ga0496108_0177940_1262_1660	132
198	3300048911	Ga0496108_0407722	Ga0496108_0407722_725_1123	132
199	3300048912	Ga0496109_0058136	Ga0496109_0058136_795_1193	132
200	3300048912	Ga0496109_0652090	Ga0496109_0652090_238_636	132
201	3300048913	Ga0496110_0063419	Ga0496110_0063419_1226_1624	132
202	3300048914	Ga0496111_0074090	Ga0496111_0074090_25_423	132
203	3300048915	Ga0496112_0083086	Ga0496112_0083086_2149_2547	132
204	3300048915	Ga0496112_0195946	Ga0496112_0195946_98_496	132
205	3300048916	Ga0496113_0607324	Ga0496113_0607324_170_568	132
206	3300049570	Ga0501033_0232935	Ga0501033_0232935_124_522	132
207	3300049572	Ga0501036_1264841	Ga0501036_1264841_156_554	132
208	3300049575	Ga0501039_0357664	Ga0501039_0357664_560_958	132
209	3300049577	Ga0501041_0548509	Ga0501041_0548509_94_492	132
210	3300049577	Ga0501041_0676815	Ga0501041_0676815_52_450	132
211	3300049579	Ga0501043_0252212	Ga0501043_0252212_686_1084	132
212	3300049580	Ga0501046_0034494	Ga0501046_0034494_3097_3495	132
213	3300049580	Ga0501046_0223841	Ga0501046_0223841_698_1096	132
214	3300049583	Ga0501067_0304752	Ga0501067_0304752_224_622	132
215	3300049587	Ga0501071_0323601	Ga0501071_0323601_306_704	132
216	3300049587	Ga0501071_0992276	Ga0501071_0992276_79_477	132
217	3300049588	Ga0501072_0080131	Ga0501072_0080131_2167_2565	132
218	3300049590	Ga0501074_0397490	Ga0501074_0397490_413_811	132
219	3300049591	Ga0501075_0102622	Ga0501075_0102622_1092_1490	132
220	3300049591	Ga0501075_0243404	Ga0501075_0243404_848_1246	132
221	3300049592	Ga0501076_0009511	Ga0501076_0009511_3848_4246	132
222	3300049592	Ga0501076_0174925	Ga0501076_0174925_209_607	132
223	3300049592	Ga0501076_0186837	Ga0501076_0186837_476_874	132
224	3300049592	Ga0501076_1637653	Ga0501076_1637653_62_460	132
225	3300049593	Ga0501077_0012684	Ga0501077_0012684_3591_3989	132
226	3300049593	Ga0501077_0113364	Ga0501077_0113364_1119_1517	132
227	3300049593	Ga0501077_0133211	Ga0501077_0133211_1103_1501	132
228	3300049741	Ga0501079_0008964	Ga0501079_0008964_5830_6228	132
229	3300049741	Ga0501079_1229402	Ga0501079_1229402_94_492	132
230	3300049742	Ga0501080_0007284	Ga0501080_0007284_3832_4230	132
231	3300049743	Ga0501081_0006905	Ga0501081_0006905_542_940	132
232	3300049743	Ga0501081_0747482	Ga0501081_0747482_262_660	132
233	3300049743	Ga0501081_0834761	Ga0501081_0834761_201_599	132
234	3300049744	Ga0501083_0311725	Ga0501083_0311725_490_888	132
235	3300049824	Ga0501045_0057504	Ga0501045_0057504_1887_2285	132
236	3300049824	Ga0501045_0149791	Ga0501045_0149791_1020_1418	132
237	3300050490	nmdc:mga03n38_115425_c1	nmdc:mga03n38_115425_c1_369_776	132
238	3300050490	nmdc:mga03n38_61273_c1	nmdc:mga03n38_61273_c1_201_599	132
239	3300050490	nmdc:mga03n38_793_c1	nmdc:mga03n38_793_c1_6748_7146	132
240	3300050491	nmdc:mga00v17_115176_c1	nmdc:mga00v17_115176_c1_56_463	132
241	3300050491	nmdc:mga00v17_13509_c1	nmdc:mga00v17_13509_c1_12_419	132
242	3300050492	nmdc:mga0yw44_43336_c1	nmdc:mga0yw44_43336_c1_2065_2463	132
243	3300050492	nmdc:mga0yw44_50869_c1	nmdc:mga0yw44_50869_c1_70_477	132
244	3300050494	nmdc:mga06z11_11655_c1	nmdc:mga06z11_11655_c1_591_989	132
245	3300050494	nmdc:mga06z11_3967_c1	nmdc:mga06z11_3967_c1_1239_1637	132
246	3300050494	nmdc:mga06z11_4120_c1	nmdc:mga06z11_4120_c1_1661_2068	132
247	3300050495	nmdc:mga04h51_3528_c1	nmdc:mga04h51_3528_c1_2132_2539	132
248	3300050495	nmdc:mga04h51_9240_c1	nmdc:mga04h51_9240_c1_1530_1928	132
249	3300050507	nmdc:mga05p37_832105_c1	nmdc:mga05p37_832105_c1_405_803	132
250	3300050507	nmdc:mga05p37_887939_c1	nmdc:mga05p37_887939_c1_405_803	132
251	3300050508	nmdc:mga09592_15701_c1	nmdc:mga09592_15701_c1_3912_4310	132
252	3300050508	nmdc:mga09592_1585156_c1	nmdc:mga09592_1585156_c1_71_469	132
253	3300050508	nmdc:mga09592_36651_c1	nmdc:mga09592_36651_c1_2817_3215	132
254	3300050508	nmdc:mga09592_959517_c1	nmdc:mga09592_959517_c1_37_435	132
255	3300050509	nmdc:mga0qj67_10766_c1	nmdc:mga0qj67_10766_c1_896_1333	132
256	3300050509	nmdc:mga0qj67_11268_c1	nmdc:mga0qj67_11268_c1_6004_6402	132
257	3300050509	nmdc:mga0qj67_198508_c1	nmdc:mga0qj67_198508_c1_256_654	132
258	3300050509	nmdc:mga0qj67_8188_c1	nmdc:mga0qj67_8188_c1_6455_6853	132
259	3300050510	nmdc:mga06r32_100105_c1	nmdc:mga06r32_100105_c1_1564_1962	132
260	3300050510	nmdc:mga06r32_139821_c1	nmdc:mga06r32_139821_c1_304_702	132
261	3300050510	nmdc:mga06r32_1897_c1	nmdc:mga06r32_1897_c1_9965_10363	132
262	3300050510	nmdc:mga06r32_354787_c1	nmdc:mga06r32_354787_c1_885_1283	132
263	3300050510	nmdc:mga06r32_58027_c1	nmdc:mga06r32_58027_c1_961_1398	132
264	3300050510	nmdc:mga06r32_69432_c1	nmdc:mga06r32_69432_c1_1033_1431	132
265	3300050510	nmdc:mga06r32_91583_c1	nmdc:mga06r32_91583_c1_167_565	132
266	3300050511	nmdc:mga08y16_169891_c1	nmdc:mga08y16_169891_c1_1599_1997	132
267	3300050511	nmdc:mga08y16_180069_c1	nmdc:mga08y16_180069_c1_1583_1981	132
268	3300050511	nmdc:mga08y16_252060_c1	nmdc:mga08y16_252060_c1_1245_1643	132
269	3300050511	nmdc:mga08y16_261758_c1	nmdc:mga08y16_261758_c1_335_733	132
270	3300050512	nmdc:mga0n895_10458_c1	nmdc:mga0n895_10458_c1_6495_6893	132
271	3300050512	nmdc:mga0n895_1524124_c1	nmdc:mga0n895_1524124_c1_35_433	132
272	3300050513	nmdc:mga0rr50_117317_c1	nmdc:mga0rr50_117317_c1_1622_2020	132
273	3300050513	nmdc:mga0rr50_24646_c1	nmdc:mga0rr50_24646_c1_1743_2141	132
274	3300050515	nmdc:mga0a205_219693_c1	nmdc:mga0a205_219693_c1_16_414	132
275	3300050515	nmdc:mga0a205_631475_c1	nmdc:mga0a205_631475_c1_195_614	132
276	3300050515	nmdc:mga0a205_94539_c1	nmdc:mga0a205_94539_c1_317_715	132
277	3300053085	Ga0495619_0143543	Ga0495619_0143543_450_848	132
278	3300054114	Ga0501084_0000417	Ga0501084_0000417_19753_20151	132
279	3300054114	Ga0501084_0085493	Ga0501084_0085493_34_432	132
280	3300060353	Ga0501082_0013858	Ga0501082_0013858_5966_6364	132
281	3300060353	Ga0501082_0052111	Ga0501082_0052111_2713_3111	132
282	3300060353	Ga0501082_1301824	Ga0501082_1301824_53_451	132
283	3300061734	Ga0530510_0034781	Ga0530510_0034781_1052_1450	132
284	3300061734	Ga0530510_0268206	Ga0530510_0268206_782_1180	132
285	3300002987	JGI25159J45721_1013162	JGI25159J45721_10131623	133
286	3300003187	JGI25151J46595_10000019	JGI25151J46595_1000001932	133
287	3300003578	Ga0006562J51391_1076649	Ga0006562J51391_10766492	133
288	3300003771	Ga0055526_1000150	Ga0055526_10001506	133
289	3300003771	Ga0055526_1001003	Ga0055526_100100314	133
290	3300003775	Ga0055524_1000086	Ga0055524_100008696	133
291	3300003775	Ga0055524_1013178	Ga0055524_10131783	133
292	3300005262	Ga0065165_1001715	Ga0065165_100171513	133
293	3300005339	Ga0070660_100376761	Ga0070660_1003767612	133
294	3300005344	Ga0070661_100087874	Ga0070661_1000878742	133
295	3300005365	Ga0070688_100687727	Ga0070688_1006877272	133
296	3300005406	Ga0070703_10535347	Ga0070703_105353472	133
297	3300005440	Ga0070705_100010874	Ga0070705_1000108744	133
298	3300005455	Ga0070663_100014591	Ga0070663_1000145913	133
299	3300005456	Ga0070678_100008256	Ga0070678_1000082565	133
300	3300005458	Ga0070681_10013175	Ga0070681_100131755	133
301	3300005530	Ga0070679_101635558	Ga0070679_1016355581	133
302	3300005539	Ga0068853_100010412	Ga0068853_1000104123	133
303	3300005545	Ga0070695_100036588	Ga0070695_1000365882	133
304	3300005546	Ga0070696_100003568	Ga0070696_1000035688	133
305	3300005548	Ga0070665_102448493	Ga0070665_1024484932	133
306	3300005563	Ga0068855_100019146	Ga0068855_1000191468	133
307	3300005564	Ga0070664_100023914	Ga0070664_1000239143	133
308	3300005614	Ga0068856_100840780	Ga0068856_1008407802	133
309	3300005841	Ga0068863_100760870	Ga0068863_1007608702	133
310	3300005842	Ga0068858_100077899	Ga0068858_1000778993	133
311	3300005843	Ga0068860_100085486	Ga0068860_1000854863	133
312	3300005844	Ga0068862_101625957	Ga0068862_1016259572	133
313	3300005983	Ga0081540_1077381	Ga0081540_10773812	133
314	3300006038	Ga0075365_11233695	Ga0075365_112336951	133
315	3300006048	Ga0075363_100806074	Ga0075363_1008060742	133
316	3300006186	Ga0075369_10192216	Ga0075369_101922161	133
317	3300006186	Ga0075369_10439388	Ga0075369_104393881	133
318	3300006237	Ga0097621_100385643	Ga0097621_1003856432	133
319	3300006353	Ga0075370_10457800	Ga0075370_104578002	133
320	3300006358	Ga0068871_100313129	Ga0068871_1003131292	133
321	3300006844	Ga0075428_100224988	Ga0075428_1002249882	133
322	3300006931	Ga0097620_100606837	Ga0097620_1006068372	133
323	3300009093	Ga0105240_11176463	Ga0105240_111764632	133
324	3300009094	Ga0111539_10421669	Ga0111539_104216692	133
325	3300009098	Ga0105245_10036704	Ga0105245_100367043	133
326	3300009148	Ga0105243_10034246	Ga0105243_100342466	133
327	3300009174	Ga0105241_10311926	Ga0105241_103119262	133
328	3300009545	Ga0105237_10009552	Ga0105237_100095526	133
329	3300009551	Ga0105238_10011039	Ga0105238_100110398	133
330	3300009553	Ga0105249_10401368	Ga0105249_104013682	133
331	3300009553	Ga0105249_10476211	Ga0105249_104762112	133
332	3300010375	Ga0105239_10381455	Ga0105239_103814553	133
333	3300011119	Ga0105246_10045650	Ga0105246_100456503	133
334	3300011119	Ga0105246_10453158	Ga0105246_104531582	133
335	3300013250	Ga0171462_1006	Ga0171462_1006308	133
336	3300013306	Ga0163162_10287797	Ga0163162_102877972	133
337	3300013306	Ga0163162_11176414	Ga0163162_111764141	133
338	3300013307	Ga0157372_10878969	Ga0157372_108789692	133
339	3300013307	Ga0157372_10906145	Ga0157372_109061452	133
340	3300013308	Ga0157375_10336045	Ga0157375_103360452	133
341	3300013308	Ga0157375_13196191	Ga0157375_131961911	133
342	3300014968	Ga0157379_10030267	Ga0157379_100302675	133
343	3300025263	Ga0209565_1053184	Ga0209565_10531842	133
344	3300025284	Ga0209130_1000343	Ga0209130_100034320	133
345	3300025291	Ga0209675_1000444	Ga0209675_100044423	133
346	3300025294	Ga0209025_1000008	Ga0209025_1000008465	133
347	3300025294	Ga0209025_1000835	Ga0209025_100083519	133
348	3300025295	Ga0209564_1000015	Ga0209564_1000015543	133
349	3300025295	Ga0209564_1000041	Ga0209564_1000041124	133
350	3300025299	Ga0209256_1000062	Ga0209256_100006218	133
351	3300025299	Ga0209256_1000277	Ga0209256_100027717	133
352	3300025904	Ga0207647_10102987	Ga0207647_101029872	133
353	3300025911	Ga0207654_10146106	Ga0207654_101461062	133
354	3300025914	Ga0207671_10027526	Ga0207671_100275262	133
355	3300025917	Ga0207660_10014188	Ga0207660_100141885	133
356	3300025920	Ga0207649_10433847	Ga0207649_104338472	133
357	3300025921	Ga0207652_10039275	Ga0207652_100392753	133
358	3300025921	Ga0207652_10865544	Ga0207652_108655441	133
359	3300025921	Ga0207652_11353430	Ga0207652_113534302	133
360	3300025924	Ga0207694_10163244	Ga0207694_101632442	133
361	3300025932	Ga0207690_10113513	Ga0207690_101135132	133
362	3300025935	Ga0207709_10535694	Ga0207709_105356942	133
363	3300025942	Ga0207689_10165970	Ga0207689_101659701	133
364	3300025949	Ga0207667_10871732	Ga0207667_108717322	133
365	3300025961	Ga0207712_10260978	Ga0207712_102609782	133
366	3300025972	Ga0207668_10791559	Ga0207668_107915592	133
367	3300025981	Ga0207640_10635010	Ga0207640_106350102	133
368	3300026035	Ga0207703_10040755	Ga0207703_100407554	133
369	3300026041	Ga0207639_10057905	Ga0207639_100579053	133
370	3300026067	Ga0207678_10000332	Ga0207678_1000033241	133
371	3300026142	Ga0207698_12066156	Ga0207698_120661561	133
372	3300027907	Ga0207428_10148572	Ga0207428_101485722	133
373	3300028379	Ga0268266_11384136	Ga0268266_113841362	133
374	3300028381	Ga0268264_10459112	Ga0268264_104591121	133
375	3300031901	Ga0307406_10211818	Ga0307406_102118183	133
376	3300031901	Ga0307406_10878135	Ga0307406_108781352	133
377	3300031995	Ga0307409_101411005	Ga0307409_1014110051	133
378	3300031995	Ga0307409_101688402	Ga0307409_1016884021	133
379	3300032004	Ga0307414_10756614	Ga0307414_107566142	133
380	3300035089	Ga0373944_0314843	Ga0373944_0314843_176_580	133
381	3300035116	Ga0373945_0030101	Ga0373945_0030101_566_967	133
382	3300035170	Ga0373943_0405174	Ga0373943_0405174_20_424	133
383	3300035398	Ga0316574_0043386	Ga0316574_0043386_252_656	133
384	3300035724	Ga0373933_0871325	Ga0373933_0871325_122_526	133
385	3300035725	Ga0373947_0836317	Ga0373947_0836317_86_487	133
386	3300037068	Ga0373925_0234372	Ga0373925_0234372_814_1215	133
387	3300038443	Ga0395901_0214783	Ga0395901_0214783_13_414	133
388	3300038443	Ga0395901_0467855	Ga0395901_0467855_630_1034	133
389	3300039062	Ga0400483_063203	Ga0400483_063203_275_676	133
390	3300039062	Ga0400483_259502	Ga0400483_259502_815_1216	133
391	3300039145	Ga0237816_09673	Ga0237816_09673_18_419	133
392	3300041453	Ga0451797_0307969	Ga0451797_0307969_388_789	133
393	3300045051	Ga0451576_0025080	Ga0451576_0025080_1554_1958	133
394	3300046499	Ga0495594_0718984	Ga0495594_0718984_44_445	133
395	3300046660	Ga0495625_0428784	Ga0495625_0428784_174_575	133
396	3300046674	Ga0495588_0599257	Ga0495588_0599257_108_509	133
397	3300047315	Ga0495581_0305222	Ga0495581_0305222_455_856	133
398	3300047317	Ga0495604_0476008	Ga0495604_0476008_327_728	133
399	3300047471	Ga0495684_0463692	Ga0495684_0463692_359_760	133
400	3300048090	Ga0495615_0045962	Ga0495615_0045962_494_904	133
401	3300048903	Ga0496100_0024469	Ga0496100_0024469_2460_2864	133
402	3300048904	Ga0496101_0057249	Ga0496101_0057249_881_1285	133
403	3300048904	Ga0496101_1153283	Ga0496101_1153283_191_595	133
404	3300048905	Ga0496102_0149606	Ga0496102_0149606_1444_1848	133
405	3300048906	Ga0496103_0151896	Ga0496103_0151896_210_614	133
406	3300048908	Ga0496105_0107789	Ga0496105_0107789_1781_2185	133
407	3300048909	Ga0496106_0017098	Ga0496106_0017098_4301_4705	133
408	3300048910	Ga0496107_0015705	Ga0496107_0015705_4309_4713	133
409	3300048912	Ga0496109_0832518	Ga0496109_0832518_331_735	133
410	3300048913	Ga0496110_0339758	Ga0496110_0339758_218_619	133
411	3300048913	Ga0496110_0580852	Ga0496110_0580852_101_502	133
412	3300048917	Ga0496114_0631149	Ga0496114_0631149_405_809	133
413	3300048918	Ga0496115_0016712	Ga0496115_0016712_858_1262	133
414	3300048919	Ga0496116_0308340	Ga0496116_0308340_251_652	133
415	3300048920	Ga0496117_0051214	Ga0496117_0051214_2240_2641	133
416	3300048921	Ga0496118_0248227	Ga0496118_0248227_48_449	133
417	3300048925	Ga0496122_0045785	Ga0496122_0045785_850_1251	133
418	3300048925	Ga0496122_0162608	Ga0496122_0162608_478_879	133
419	3300048927	Ga0496124_0243435	Ga0496124_0243435_889_1290	133
420	3300048929	Ga0496126_0531762	Ga0496126_0531762_60_461	133
421	3300049569	Ga0501032_0222761	Ga0501032_0222761_476_880	133
422	3300049571	Ga0501034_0043226	Ga0501034_0043226_2968_3372	133
423	3300049572	Ga0501036_0652519	Ga0501036_0652519_336_740	133
424	3300049573	Ga0501037_0386474	Ga0501037_0386474_305_709	133
425	3300049573	Ga0501037_0402450	Ga0501037_0402450_414_815	133
426	3300049574	Ga0501038_0850463	Ga0501038_0850463_84_485	133
427	3300049575	Ga0501039_0469829	Ga0501039_0469829_381_785	133
428	3300049575	Ga0501039_0671146	Ga0501039_0671146_219_623	133
429	3300049576	Ga0501040_0100919	Ga0501040_0100919_33_437	133
430	3300049578	Ga0501042_0372119	Ga0501042_0372119_298_702	133
431	3300049578	Ga0501042_1271200	Ga0501042_1271200_11_415	133
432	3300049580	Ga0501046_0004178	Ga0501046_0004178_3874_4278	133
433	3300049580	Ga0501046_0053479	Ga0501046_0053479_1811_2215	133
434	3300049581	Ga0501047_0023955	Ga0501047_0023955_3676_4080	133
435	3300049581	Ga0501047_0233284	Ga0501047_0233284_387_791	133
436	3300049582	Ga0501048_0000606	Ga0501048_0000606_15584_15988	133
437	3300049583	Ga0501067_0002553	Ga0501067_0002553_7732_8136	133
438	3300049583	Ga0501067_0049104	Ga0501067_0049104_825_1229	133
439	3300049583	Ga0501067_0060811	Ga0501067_0060811_1439_1843	133
440	3300049586	Ga0501070_1221585	Ga0501070_1221585_36_440	133
441	3300049587	Ga0501071_1074244	Ga0501071_1074244_92_496	133
442	3300049590	Ga0501074_0145558	Ga0501074_0145558_281_685	133
443	3300049591	Ga0501075_0259292	Ga0501075_0259292_34_438	133
444	3300049593	Ga0501077_0004496	Ga0501077_0004496_507_911	133
445	3300049741	Ga0501079_0335655	Ga0501079_0335655_118_522	133
446	3300049741	Ga0501079_1198375	Ga0501079_1198375_17_421	133
447	3300049741	Ga0501079_1569474	Ga0501079_1569474_52_453	133
448	3300049743	Ga0501081_1492862	Ga0501081_1492862_85_486	133
449	3300049822	Ga0501035_0277024	Ga0501035_0277024_77_481	133
450	3300049822	Ga0501035_0571801	Ga0501035_0571801_467_871	133
451	3300049823	Ga0501044_0115289	Ga0501044_0115289_532_936	133
452	3300049823	Ga0501044_0273313	Ga0501044_0273313_352_756	133
453	3300049824	Ga0501045_0032465	Ga0501045_0032465_2253_2657	133
454	3300049824	Ga0501045_0716378	Ga0501045_0716378_69_488	133
455	3300050511	nmdc:mga08y16_70910_c1	nmdc:mga08y16_70910_c1_2422_2823	133
456	3300050516	nmdc:mga0sz30_178823_c1	nmdc:mga0sz30_178823_c1_458_859	133
457	3300050516	nmdc:mga0sz30_383650_c1	nmdc:mga0sz30_383650_c1_125_526	133
458	3300053077	Ga0495601_0344911	Ga0495601_0344911_415_816	133
459	3300053119	Ga0500595_053822	Ga0500595_053822_482_886	133
460	3300053153	Ga0500616_0015679	Ga0500616_0015679_1067_1471	133
461	3300054114	Ga0501084_1478644	Ga0501084_1478644_68_469	133
462	3300060353	Ga0501082_0041798	Ga0501082_0041798_1019_1423	133
463	3300060353	Ga0501082_0354263	Ga0501082_0354263_631_1035	133
464	3300061734	Ga0530510_0171850	Ga0530510_0171850_1186_1590	133
465	3300061734	Ga0530510_0212399	Ga0530510_0212399_506_910	133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

16

144

0.94 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3d7j-assembly1.cif.gz_D	sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor	0.9853	2	131
3d7j-assembly1.cif.gz_D	sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor	0.9563	2	131
2dtt-assembly1.cif.gz_A	crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin	0.8592	2	130
2dtt-assembly1.cif.gz_A	crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin	0.8367	2	130
4ntm-assembly1.cif.gz_C	qued soaked with sepiapterin (selenomethionine substituted protein)	0.8318	1	128

ID	Description	Score	Start	End	Superfamily
3d7jC00	Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD	0.9816	2	131	3.30.479.10
4ntmA00	Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD	0.8511	1	130	3.30.479.10
4ntmA00	Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD	0.8442	1	130	3.30.479.10
af_Q2G1X5_11_135_3.30.479.10	Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD	0.8165	2	130	3.30.479.10
2g64A00	Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD	0.8025	2	131	3.30.479.10

ID	Description	Score	Start	End	GO Terms
AF-A0A136PI54-F1-model_v4	6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD)	0.9891	1	105	GO:0046872 GO:0070497
AF-A0A255XXJ8-F1-model_v4	6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD)	0.9876	1	133	GO:0046872 GO:0070497
AF-A0A1H1SLV2-F1-model_v4	6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD)	0.9865	2	131	GO:0046872 GO:0070497
AF-A0A6B3QBN8-F1-model_v4	6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD)	0.9857	1	131	GO:0046872 GO:0070497
AF-A0A1Q9SV15-F1-model_v4	deleted	0.9853	1	131

Feature Viewer

pLDDT	pTM	Quality
96.74	0.91	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F449572

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

16

144

0.94

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map