F449557

General Info

Members Datasets Scaffolds Average Seq Length
465 173 930 443

Family's Representative Sequence

Representative Sequence 3300049514|Ga0501291_009965|Ga0501291_009965_15_1175
Length 381
Sequence MHLPRALTEELLYHLYREKLIEMRLQSAVGATRYAMLDHGWERVGRLQQQSGYLGPAPVSLDDYAHMMRLQAVPSRSATMDSVRSAFKDLVLPESLLTTLGCVINSRSSLFLTGLPGTGKTAVSERMNAALSGTIWIPHSVEVDGQIIRVYDSHNHQAVPEHDDRRWIEIERPLVIVAGELTLDNTDLTWSEAAKFYEAPFQMKANGGTLVIDDFGRQRVSPTDLLNRWILPLEKRVDFLTLHSGKKIEVPFEELVVFSTNLDERDLVDDAFLRRMGYRARVEPPTASAFVEIFRRTATTRGIVINQECMDHILRKYDAEKRVMKGCEPRDLLNKVRDVCLFEGRPAQLTPELIDTAWGNYFGTSHGFAPDQTHFELAKTA

Samples

Sample ID Description Type Environment
1 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
137 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
138 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
142 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
143 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
146 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
154 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
157 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
158 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
159 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
160 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
161 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
162 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
163 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
164 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
165 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
166 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.08
Rhizosphere 98.92
Stem 0
Stem Tuber 0
Unclassified 20.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501291_009965 3300049514 Bacteria 1342
2 CNBas_1000031 3300000531 Bacteria 3246
3 CNAas_1000487 3300000532 Bacteria 3873
4 JGI24751J29686_10000016 3300002459 Bacteria 112162
5 JGI24751J29686_10000049 3300002459 Bacteria 69226
6 JGI24751J29686_10000083 3300002459 Bacteria 53109
7 JGI25406J46586_10001054 3300003203 Bacteria 12938
8 JGI25406J46586_10004343 3300003203 Bacteria 6613
9 JGI25406J46586_10011909 3300003203 Bacteria 3794
10 Ga0065714_10002184 3300005288 Bacteria 284511
11 Ga0065704_10004185 3300005289 Bacteria 4053
12 Ga0065704_10073832 3300005289 Bacteria 6753
13 Ga0065712_10005707 3300005290 Bacteria 5977
14 Ga0065712_10067743 3300005290 Bacteria 71369
15 Ga0065712_10123595 3300005290 Unclassified 1636
16 Ga0065715_10008303 3300005293 Bacteria 5207
17 Ga0065715_10089780 3300005293 Bacteria 8546
18 Ga0065715_10090895 3300005293 Bacteria 6333
19 Ga0065715_10094377 3300005293 Bacteria 4357
20 Ga0065715_10098361 3300005293 Bacteria 3559
21 Ga0065715_10100282 3300005293 Bacteria 3320
22 Ga0065715_10101224 3300005293 Bacteria 3211
23 Ga0065715_10122135 3300005293 Bacteria 2212
24 Ga0065715_10174154 3300005293 Bacteria 1520
25 Ga0065707_10001165 3300005295 Bacteria 8977
26 Ga0065707_10001943 3300005295 Bacteria 6014
27 Ga0065707_10018104 3300005295 Bacteria 1700
28 Ga0070676_10125126 3300005328 Unclassified 1619
29 Ga0070670_100000114 3300005331 Bacteria 75910
30 Ga0070670_100002456 3300005331 Bacteria 15283
31 Ga0070670_100055796 3300005331 Bacteria 3391
32 Ga0070670_100178441 3300005331 Bacteria 1843
33 Ga0068869_100025069 3300005334 Unclassified 4137
34 Ga0068869_100032366 3300005334 Bacteria 3684
35 Ga0068869_100035888 3300005334 Unclassified 3517
36 Ga0068869_100082185 3300005334 Bacteria 2407
37 Ga0070680_100002036 3300005336 Bacteria 14917
38 Ga0070680_100010390 3300005336 Bacteria 7176
39 Ga0070680_100058212 3300005336 Bacteria 3160
40 Ga0070682_100000088 3300005337 Bacteria 83442
41 Ga0070682_100010294 3300005337 Bacteria 5306
42 Ga0070682_100016807 3300005337 Unclassified 4258
43 Ga0070682_100126432 3300005337 Bacteria 1724
44 Ga0068868_100031687 3300005338 Unclassified 4064
45 Ga0068868_100132558 3300005338 Unclassified 2040
46 Ga0070689_100000707 3300005340 Bacteria 20291
47 Ga0070687_100006901 3300005343 Unclassified 4690
48 Ga0070687_100009452 3300005343 Bacteria 4179
49 Ga0070687_100038172 3300005343 Bacteria 2406
50 Ga0070687_100066384 3300005343 Bacteria 1922
51 Ga0070692_10001286 3300005345 Bacteria 8986
52 Ga0070692_10024209 3300005345 Unclassified 2982
53 Ga0070675_100140148 3300005354 Bacteria 2066
54 Ga0070673_100110921 3300005364 Unclassified 2275
55 Ga0070673_100217368 3300005364 Bacteria 1653
56 Ga0070701_10009828 3300005438 Bacteria 4205
57 Ga0070705_100017664 3300005440 Bacteria 3726
58 Ga0070705_100021685 3300005440 Bacteria 3420
59 Ga0070705_100068803 3300005440 Unclassified 2132
60 Ga0070705_100099434 3300005440 Bacteria 1833
61 Ga0070700_100000246 3300005441 Bacteria 29595
62 Ga0070700_100017470 3300005441 Unclassified 4103
63 Ga0070700_100017926 3300005441 Unclassified 4060
64 Ga0070700_100046874 3300005441 Unclassified 2673
65 Ga0070700_100101337 3300005441 Bacteria 1897
66 Ga0070694_100025953 3300005444 Bacteria 3794
67 Ga0070694_100040089 3300005444 Bacteria 3121
68 Ga0070708_100000147 3300005445 Bacteria 48675
69 Ga0070708_100000201 3300005445 Bacteria 43621
70 Ga0070708_100251032 3300005445 Bacteria 1662
71 Ga0070681_10000110 3300005458 Bacteria 61542
72 Ga0070681_10013263 3300005458 Bacteria 8187
73 Ga0070681_10027063 3300005458 Bacteria 5766
74 Ga0070681_10090011 3300005458 Bacteria 3019
75 Ga0070681_10093917 3300005458 Bacteria 2948
76 Ga0070681_10150798 3300005458 Bacteria 2251
77 Ga0068867_100084958 3300005459 Bacteria 2392
78 Ga0070706_100002306 3300005467 Bacteria 19283
79 Ga0070706_100038890 3300005467 Bacteria 4391
80 Ga0070707_100009346 3300005468 Bacteria 9100
81 Ga0070707_100063570 3300005468 Unclassified 3542
82 Ga0070707_100097720 3300005468 Unclassified 2844
83 Ga0070698_100002390 3300005471 Bacteria 20678
84 Ga0070698_100008639 3300005471 Bacteria 10977
85 Ga0070698_100011920 3300005471 Bacteria 9224
86 Ga0070698_100015405 3300005471 Bacteria 8078
87 Ga0070698_100059924 3300005471 Bacteria 3842
88 Ga0070698_100103690 3300005471 Bacteria 2814
89 Ga0070698_100204598 3300005471 Bacteria 1909
90 Ga0070699_100000971 3300005518 Bacteria 26716
91 Ga0070699_100002774 3300005518 Bacteria 15628
92 Ga0070699_100003106 3300005518 Bacteria 14699
93 Ga0070699_100005204 3300005518 Bacteria 11434
94 Ga0070699_100257345 3300005518 Bacteria 1561
95 Ga0070679_100000060 3300005530 Bacteria 81237
96 Ga0070679_100000783 3300005530 Bacteria 27643
97 Ga0070679_100158219 3300005530 Bacteria 2240
98 Ga0070697_100000687 3300005536 Bacteria 25341
99 Ga0070697_100001795 3300005536 Bacteria 16382
100 Ga0070697_100026242 3300005536 Bacteria 4652
101 Ga0070697_100030571 3300005536 Unclassified 4327
102 Ga0070697_100135198 3300005536 Unclassified 2070
103 Ga0070697_100140764 3300005536 Bacteria 2029
104 Ga0070697_100153447 3300005536 Bacteria 1942
105 Ga0070672_100056671 3300005543 Bacteria 3074
106 Ga0070686_100007130 3300005544 Bacteria 6232
107 Ga0070686_100012179 3300005544 Bacteria 4893
108 Ga0070695_100026027 3300005545 Bacteria 3616
109 Ga0070695_100054748 3300005545 Bacteria 2569
110 Ga0070695_100086128 3300005545 Unclassified 2087
111 Ga0070695_100176165 3300005545 Unclassified 1512
112 Ga0070696_100041152 3300005546 Bacteria 3192
113 Ga0070696_100085881 3300005546 Unclassified 2233
114 Ga0070693_100011066 3300005547 Bacteria 4538
115 Ga0070693_100145013 3300005547 Bacteria 1498
116 Ga0070704_100006768 3300005549 Bacteria 6786
117 Ga0070704_100048945 3300005549 Bacteria 2962
118 Ga0070704_100066972 3300005549 Unclassified 2592
119 Ga0070704_100118454 3300005549 Bacteria 2029
120 Ga0070664_100020175 3300005564 Bacteria 5487
121 Ga0070664_100314820 3300005564 Unclassified 1417
122 Ga0068857_100048497 3300005577 Bacteria 3771
123 Ga0068857_100062765 3300005577 Unclassified 3303
124 Ga0070702_100005267 3300005615 Bacteria 6005
125 Ga0070702_100010158 3300005615 Bacteria 4627
126 Ga0070702_100015718 3300005615 Unclassified 3870
127 Ga0070702_100039443 3300005615 Bacteria 2635
128 Ga0070702_100106527 3300005615 Bacteria 1729
129 Ga0068859_100002572 3300005617 Bacteria 18441
130 Ga0068859_100035150 3300005617 Bacteria 5027
131 Ga0068859_100052017 3300005617 Bacteria 4119
132 Ga0068859_100053804 3300005617 Bacteria 4048
133 Ga0068859_100113082 3300005617 Bacteria 2779
134 Ga0068859_100121792 3300005617 Unclassified 2675
135 Ga0068859_100142128 3300005617 Bacteria 2474
136 Ga0068859_100168549 3300005617 Bacteria 2270
137 Ga0068864_100002042 3300005618 Bacteria 16667
138 Ga0068864_100008211 3300005618 Bacteria 8610
139 Ga0068864_100009537 3300005618 Bacteria 8011
140 Ga0068864_100010249 3300005618 Bacteria 7740
141 Ga0068864_100013603 3300005618 Bacteria 6747
142 Ga0068864_100031010 3300005618 Bacteria 4534
143 Ga0068864_100056141 3300005618 Unclassified 3402
144 Ga0068864_100116013 3300005618 Unclassified 2389
145 Ga0068861_100002231 3300005719 Bacteria 12572
146 Ga0068861_100014691 3300005719 Bacteria 5498
147 Ga0068870_10005814 3300005840 Bacteria 5409
148 Ga0068870_10020963 3300005840 Unclassified 3190
149 Ga0068863_100011832 3300005841 Bacteria 8433
150 Ga0068863_100060603 3300005841 Bacteria 3578
151 Ga0068863_100176952 3300005841 Bacteria 2048
152 Ga0068858_100030043 3300005842 Bacteria 5045
153 Ga0068858_100057804 3300005842 Bacteria 3585
154 Ga0068858_100083918 3300005842 Bacteria 2963
155 Ga0068858_100131128 3300005842 Bacteria 2350
156 Ga0068858_100167355 3300005842 Bacteria 2072
157 Ga0068858_100205250 3300005842 Unclassified 1864
158 Ga0068858_100235657 3300005842 Bacteria 1735
159 Ga0068860_100071148 3300005843 Unclassified 3306
160 Ga0068860_100074027 3300005843 Bacteria 3238
161 Ga0068860_100151758 3300005843 Bacteria 2231
162 Ga0068860_100168233 3300005843 Bacteria 2117
163 Ga0068862_100017839 3300005844 Bacteria 5909
164 Ga0068862_100033867 3300005844 Unclassified 4320
165 Ga0068862_100057438 3300005844 Bacteria 3337
166 Ga0081539_10000490 3300005985 Bacteria 83577
167 Ga0081539_10001185 3300005985 Bacteria 47102
168 Ga0081539_10001697 3300005985 Bacteria 35528
169 Ga0081539_10002668 3300005985 Bacteria 24283
170 Ga0081539_10023165 3300005985 Unclassified 4076
171 Ga0081539_10036535 3300005985 Bacteria 2939
172 Ga0081539_10067769 3300005985 Bacteria 1929
173 Ga0070715_10000018 3300006163 Bacteria 124487
174 Ga0070716_100000007 3300006173 Bacteria 256300
175 Ga0097621_100001228 3300006237 Bacteria 17759
176 Ga0097621_100004909 3300006237 Bacteria 9382
177 Ga0097621_100050839 3300006237 Unclassified 3371
178 Ga0097621_100052109 3300006237 Unclassified 3333
179 Ga0097621_100076662 3300006237 Bacteria 2774
180 Ga0068871_100020620 3300006358 Bacteria 5053
181 Ga0068871_100111523 3300006358 Bacteria 2301
182 Ga0068871_100127556 3300006358 Bacteria 2155
183 Ga0075428_100019547 3300006844 Bacteria 7495
184 Ga0075430_100050531 3300006846 Bacteria 3505
185 Ga0075431_100026657 3300006847 Bacteria 5928
186 Ga0075433_10037244 3300006852 Bacteria 4195
187 Ga0075433_10052261 3300006852 Unclassified 3560
188 Ga0075433_10064976 3300006852 Bacteria 3200
189 Ga0075433_10129219 3300006852 Bacteria 2244
190 Ga0075434_100003211 3300006871 Bacteria 14574
191 Ga0075434_100052192 3300006871 Unclassified 4062
192 Ga0075434_100072333 3300006871 Unclassified 3440
193 Ga0075434_100094449 3300006871 Unclassified 2995
194 Ga0075429_100020104 3300006880 Bacteria 5790
195 Ga0075429_100096549 3300006880 Bacteria 2578
196 Ga0097620_100002571 3300006931 Bacteria 18441
197 Ga0097620_100035150 3300006931 Bacteria 5027
198 Ga0097620_100052022 3300006931 Bacteria 4119
199 Ga0097620_100053803 3300006931 Bacteria 4048
200 Ga0097620_100113085 3300006931 Bacteria 2779
201 Ga0097620_100121796 3300006931 Unclassified 2675
202 Ga0097620_100142129 3300006931 Bacteria 2474
203 Ga0097620_100168557 3300006931 Bacteria 2270
204 Ga0075435_100014989 3300007076 Bacteria 5815
205 Ga0075435_100045454 3300007076 Bacteria 3520
206 Ga0111539_10000363 3300009094 Bacteria 55793
207 Ga0111539_10005260 3300009094 Bacteria 16759
208 Ga0111539_10008997 3300009094 Bacteria 12641
209 Ga0111539_10009029 3300009094 Bacteria 12616
210 Ga0111539_10044617 3300009094 Bacteria 5310
211 Ga0111539_10195451 3300009094 Bacteria 2360
212 Ga0105245_10139382 3300009098 Bacteria 2282
213 Ga0105247_10008133 3300009101 Bacteria 6407
214 Ga0105247_10020991 3300009101 Bacteria 3930
215 Ga0114129_10003008 3300009147 Bacteria 23621
216 Ga0114129_10004096 3300009147 Bacteria 20597
217 Ga0114129_10004613 3300009147 Bacteria 19450
218 Ga0114129_10009665 3300009147 Bacteria 13764
219 Ga0114129_10014578 3300009147 Bacteria 11198
220 Ga0114129_10015160 3300009147 Bacteria 10972
221 Ga0114129_10022539 3300009147 Bacteria 8934
222 Ga0114129_10033394 3300009147 Bacteria 7271
223 Ga0114129_10049880 3300009147 Bacteria 5880
224 Ga0114129_10067681 3300009147 Bacteria 4980
225 Ga0114129_10085067 3300009147 Bacteria 4388
226 Ga0114129_10106465 3300009147 Bacteria 3874
227 Ga0114129_10119179 3300009147 Bacteria 3635
228 Ga0114129_10470966 3300009147 Unclassified 1645
229 Ga0105243_10010825 3300009148 Bacteria 6902
230 Ga0105243_10012124 3300009148 Bacteria 6517
231 Ga0105243_10057883 3300009148 Unclassified 3088
232 Ga0105243_10216436 3300009148 Unclassified 1690
233 Ga0105241_10012910 3300009174 Bacteria 6129
234 Ga0105241_10014344 3300009174 Bacteria 5802
235 Ga0105241_10050435 3300009174 Bacteria 3172
236 Ga0105241_10166913 3300009174 Bacteria 1815
237 Ga0105242_10001522 3300009176 Bacteria 18230
238 Ga0105242_10023206 3300009176 Unclassified 4890
239 Ga0105242_10092930 3300009176 Archaea 2542
240 Ga0105242_10222367 3300009176 Bacteria 1688
241 Ga0105248_10001196 3300009177 Bacteria 28995
242 Ga0105248_10001900 3300009177 Bacteria 23164
243 Ga0105248_10032844 3300009177 Bacteria 5798
244 Ga0105248_10212627 3300009177 Bacteria 2179
245 Ga0105237_10000527 3300009545 Bacteria 53805
246 Ga0105237_10000767 3300009545 Bacteria 43919
247 Ga0105237_10128155 3300009545 Unclassified 2532
248 Ga0105238_10010842 3300009551 Bacteria 9160
249 Ga0105238_10011684 3300009551 Bacteria 8851
250 Ga0105238_10151526 3300009551 Unclassified 2294
251 Ga0105249_10030850 3300009553 Bacteria 4846
252 Ga0105249_10344313 3300009553 Bacteria 1508
253 Ga0105239_10004675 3300010375 Bacteria 16265
254 Ga0105239_10198594 3300010375 Bacteria 2247
255 Ga0105239_10387033 3300010375 Bacteria 1581
256 Ga0105246_10059397 3300011119 Bacteria 2652
257 Ga0105246_10129380 3300011119 Bacteria 1883
258 Ga0157373_10008525 3300013100 Bacteria 7615
259 Ga0157373_10012993 3300013100 Bacteria 6111
260 Ga0157373_10100291 3300013100 Bacteria 2038
261 Ga0157374_10098891 3300013296 Bacteria 2794
262 Ga0157378_10000113 3300013297 Bacteria 77834
263 Ga0157378_10003037 3300013297 Bacteria 14919
264 Ga0157378_10049278 3300013297 Bacteria 3747
265 Ga0157378_10052159 3300013297 Unclassified 3639
266 Ga0157378_10094677 3300013297 Bacteria 2720
267 Ga0157378_10130869 3300013297 Bacteria 2322
268 Ga0163162_10003901 3300013306 Bacteria 14319
269 Ga0163162_10008413 3300013306 Bacteria 10063
270 Ga0163162_10027154 3300013306 Bacteria 5660
271 Ga0163162_10387992 3300013306 Bacteria 1529
272 Ga0157372_10026941 3300013307 Bacteria 6258
273 Ga0157372_10042291 3300013307 Bacteria 5039
274 Ga0157375_10007521 3300013308 Bacteria 9525
275 Ga0157375_10020751 3300013308 Bacteria 6011
276 Ga0157375_10025845 3300013308 Bacteria 5463
277 Ga0163163_10000207 3300014325 Bacteria 60848
278 Ga0163163_10000527 3300014325 Bacteria 34143
279 Ga0163163_10002364 3300014325 Bacteria 15966
280 Ga0163163_10002861 3300014325 Bacteria 14597
281 Ga0163163_10039727 3300014325 Bacteria 4593
282 Ga0163163_10198817 3300014325 Bacteria 2053
283 Ga0163163_10200651 3300014325 Bacteria 2043
284 Ga0157380_10037691 3300014326 Bacteria 3747
285 Ga0157380_10055818 3300014326 Unclassified 3139
286 Ga0157380_10079842 3300014326 Unclassified 2673
287 Ga0157380_10113537 3300014326 Bacteria 2281
288 Ga0157380_10141599 3300014326 Bacteria 2067
289 Ga0157377_10025900 3300014745 Bacteria 3132
290 Ga0157379_10019865 3300014968 Bacteria 5935
291 Ga0157379_10201257 3300014968 Unclassified 1801
292 Ga0157379_10274364 3300014968 Bacteria 1534
293 Ga0157376_10022003 3300014969 Bacteria 4961
294 Ga0207653_10002090 3300025885 Bacteria 6365
295 Ga0207642_10073342 3300025899 Unclassified 1637
296 Ga0207710_10001827 3300025900 Bacteria 10258
297 Ga0207710_10039033 3300025900 Bacteria 2100
298 Ga0207688_10086314 3300025901 Bacteria 1798
299 Ga0207647_10004110 3300025904 Bacteria 10803
300 Ga0207647_10006715 3300025904 Bacteria 8357
301 Ga0207647_10058769 3300025904 Bacteria 2354
302 Ga0207685_10000022 3300025905 Bacteria 125184
303 Ga0207645_10073817 3300025907 Bacteria 2184
304 Ga0207643_10007677 3300025908 Bacteria 5793
305 Ga0207643_10050060 3300025908 Unclassified 2368
306 Ga0207684_10000091 3300025910 Bacteria 170468
307 Ga0207684_10000172 3300025910 Bacteria 106888
308 Ga0207684_10017552 3300025910 Bacteria 6137
309 Ga0207684_10021657 3300025910 Bacteria 5488
310 Ga0207684_10052190 3300025910 Bacteria 3470
311 Ga0207684_10055074 3300025910 Bacteria 3374
312 Ga0207684_10094273 3300025910 Bacteria 2553
313 Ga0207684_10120528 3300025910 Bacteria 2249
314 Ga0207707_10000015 3300025912 Bacteria 259670
315 Ga0207707_10000022 3300025912 Bacteria 198808
316 Ga0207707_10006777 3300025912 Bacteria 9995
317 Ga0207707_10016207 3300025912 Bacteria 6502
318 Ga0207707_10090539 3300025912 Bacteria 2674
319 Ga0207671_10001070 3300025914 Bacteria 33237
320 Ga0207671_10003690 3300025914 Bacteria 15096
321 Ga0207671_10216345 3300025914 Bacteria 1500
322 Ga0207660_10001657 3300025917 Bacteria 14925
323 Ga0207660_10038175 3300025917 Bacteria 3352
324 Ga0207662_10003631 3300025918 Bacteria 7982
325 Ga0207662_10021230 3300025918 Unclassified 3709
326 Ga0207662_10061416 3300025918 Bacteria 2256
327 Ga0207652_10000253 3300025921 Bacteria 55673
328 Ga0207652_10000342 3300025921 Bacteria 48463
329 Ga0207652_10187453 3300025921 Bacteria 1860
330 Ga0207646_10034910 3300025922 Unclassified 4546
331 Ga0207646_10040422 3300025922 Unclassified 4193
332 Ga0207646_10050722 3300025922 Unclassified 3713
333 Ga0207646_10084227 3300025922 Unclassified 2845
334 Ga0207681_10044646 3300025923 Unclassified 2971
335 Ga0207694_10002853 3300025924 Bacteria 13936
336 Ga0207694_10023891 3300025924 Unclassified 4642
337 Ga0207650_10000009 3300025925 Bacteria 483583
338 Ga0207650_10000022 3300025925 Bacteria 318878
339 Ga0207690_10047688 3300025932 Bacteria 2844
340 Ga0207706_10090152 3300025933 Unclassified 2696
341 Ga0207686_10015352 3300025934 Unclassified 4282
342 Ga0207686_10023441 3300025934 Unclassified 3566
343 Ga0207709_10004289 3300025935 Bacteria 8261
344 Ga0207709_10006238 3300025935 Bacteria 6702
345 Ga0207709_10006592 3300025935 Bacteria 6517
346 Ga0207670_10002719 3300025936 Bacteria 9304
347 Ga0207665_10000018 3300025939 Bacteria 122653
348 Ga0207711_10036325 3300025941 Unclassified 4181
349 Ga0207711_10100840 3300025941 Bacteria 2554
350 Ga0207689_10004787 3300025942 Bacteria 12205
351 Ga0207689_10047429 3300025942 Unclassified 3547
352 Ga0207689_10064513 3300025942 Bacteria 3013
353 Ga0207651_10013813 3300025960 Unclassified 4637
354 Ga0207651_10069565 3300025960 Unclassified 2486
355 Ga0207651_10080145 3300025960 Unclassified 2349
356 Ga0207712_10016706 3300025961 Bacteria 4757
357 Ga0207712_10020929 3300025961 Bacteria 4291
358 Ga0207712_10105884 3300025961 Bacteria 2100
359 Ga0207677_10044886 3300026023 Unclassified 2948
360 Ga0207677_10172309 3300026023 Unclassified 1693
361 Ga0207639_10061638 3300026041 Bacteria 2898
362 Ga0207708_10000528 3300026075 Bacteria 29471
363 Ga0207708_10013139 3300026075 Bacteria 6180
364 Ga0207708_10032535 3300026075 Unclassified 3960
365 Ga0207708_10034710 3300026075 Unclassified 3837
366 Ga0207708_10089632 3300026075 Unclassified 2370
367 Ga0207702_10002405 3300026078 Bacteria 17824
368 Ga0207702_10264839 3300026078 Bacteria 1619
369 Ga0207641_10014008 3300026088 Bacteria 6574
370 Ga0207641_10102382 3300026088 Bacteria 2525
371 Ga0207641_10130372 3300026088 Bacteria 2257
372 Ga0207641_10233159 3300026088 Bacteria 1712
373 Ga0207641_10264928 3300026088 Unclassified 1610
374 Ga0207648_10044026 3300026089 Unclassified 3917
375 Ga0207648_10081918 3300026089 Bacteria 2814
376 Ga0207676_10002795 3300026095 Bacteria 12401
377 Ga0207676_10006688 3300026095 Bacteria 8157
378 Ga0207676_10226796 3300026095 Unclassified 1667
379 Ga0207676_10268559 3300026095 Bacteria 1544
380 Ga0207676_10304368 3300026095 Bacteria 1457
381 Ga0207674_10014958 3300026116 Bacteria 8549
382 Ga0207674_10040655 3300026116 Unclassified 4816
383 Ga0207674_10088762 3300026116 Bacteria 3084
384 Ga0207674_10206032 3300026116 Unclassified 1916
385 Ga0207675_100002807 3300026118 Bacteria 17121
386 Ga0207675_100004925 3300026118 Bacteria 12866
387 Ga0207675_100040943 3300026118 Bacteria 4328
388 Ga0207698_10299864 3300026142 Bacteria 1495
389 Ga0207428_10009114 3300027907 Bacteria 8918
390 Ga0268266_10206983 3300028379 Bacteria 1798
391 Ga0268264_10051946 3300028381 Bacteria 3417
392 Ga0268264_10053848 3300028381 Bacteria 3358
393 Ga0268264_10056858 3300028381 Unclassified 3270
394 Ga0268264_10106434 3300028381 Bacteria 2448
395 Ga0268264_10107274 3300028381 Bacteria 2439
396 Ga0268264_10119803 3300028381 Bacteria 2318
397 Ga0268264_10201491 3300028381 Unclassified 1821
398 Ga0307405_10078607 3300031731 Unclassified 2148
399 Ga0307406_10008228 3300031901 Bacteria 5814
400 Ga0307406_10028052 3300031901 Bacteria 3399
401 Ga0307407_10025506 3300031903 Bacteria 3117
402 Ga0307416_100319018 3300032002 Bacteria 1555
403 Ga0307414_10083405 3300032004 Bacteria 2347
404 Ga0307411_10044313 3300032005 Bacteria 2853
405 Ga0373951_0002399 3300035091 Bacteria 4734
406 Ga0373951_0008134 3300035091 Bacteria 2377
407 Ga0373941_0011734 3300035115 Bacteria 2272
408 Ga0373942_0027010 3300035207 Bacteria 1490
409 Ga0395898_0158096 3300037466 Bacteria 2168
410 Ga0395901_0018155 3300038443 Bacteria 7180
411 Ga0242422_00564 3300038699 Bacteria 2400
412 Ga0242422_00642 3300038699 Bacteria 2280
413 Ga0242420_000519 3300038996 Bacteria 4420
414 Ga0439458_0000783 3300042157 Bacteria 8153
415 Ga0439458_0004279 3300042157 Unclassified 3292
416 Ga0451576_0122429 3300045051 Bacteria 2709
417 Ga0495663_0000789 3300046525 Bacteria 10824
418 Ga0495598_0000220 3300046537 Bacteria 10112
419 Ga0495621_0000030 3300046539 Bacteria 27481
420 Ga0496102_0206801 3300048905 Unclassified 1850
421 Ga0496104_0047504 3300048907 Bacteria 4046
422 Ga0496106_0111153 3300048909 Bacteria 2133
423 Ga0496112_0352584 3300048915 Bacteria 1414
424 Ga0496113_0146634 3300048916 Bacteria 1860
425 Ga0501296_003562 3300049519 Unclassified 1665
426 Ga0501303_001221 3300049526 Unclassified 1919
427 Ga0501038_0006435 3300049574 Bacteria 10871
428 Ga0501038_0073160 3300049574 Bacteria 2903
429 Ga0501202_010896 3300049652 Bacteria 1694
430 Ga0501217_002537 3300049661 Unclassified 3607
431 Ga0501217_012531 3300049661 Bacteria 1890
432 Ga0501224_005066 3300049664 Unclassified 1879
433 Ga0501227_017622 3300049665 Unclassified 1615
434 Ga0501233_002607 3300049668 Bacteria 3188
435 Ga0501249_010655 3300049679 Bacteria 1926
436 Ga0501221_009994 3300049704 Bacteria 1676
437 Ga0501234_008996 3300049707 Bacteria 1558
438 Ga0501245_003857 3300049708 Bacteria 2050
439 Ga0501273_001149 3300049770 Unclassified 2435
440 Ga0501283_000392 3300049779 Bacteria 5828
441 nmdc:mga05p37_129905_c1 3300050507 Unclassified 3091
442 nmdc:mga05p37_134722_c1 3300050507 Bacteria 3030
443 nmdc:mga05p37_334328_c1 3300050507 Unclassified 1788
444 nmdc:mga05p37_61773_c1 3300050507 Bacteria 4611
445 nmdc:mga05p37_65100_c1 3300050507 Bacteria 4485
446 nmdc:mga05p37_78006_c1 3300050507 Bacteria 4078
447 nmdc:mga0qj67_31288_c1 3300050509 Bacteria 4145
448 nmdc:mga0qj67_53418_c1 3300050509 Bacteria 3199
449 nmdc:mga08y16_1742_c1 3300050511 Bacteria 22070
450 nmdc:mga08y16_27029_c1 3300050511 Bacteria 6047
451 nmdc:mga08y16_43380_c1 3300050511 Bacteria 4713
452 nmdc:mga08y16_6584_c1 3300050511 Bacteria 12181
453 nmdc:mga0n895_219583_c1 3300050512 Bacteria 1930
454 nmdc:mga0n895_53716_c1 3300050512 Unclassified 3959
455 nmdc:mga0rr50_101755_c1 3300050513 Unclassified 2259
456 nmdc:mga0rr50_126851_c1 3300050513 Bacteria 2039
457 nmdc:mga0a205_103035_c1 3300050515 Bacteria 2752
458 nmdc:mga0a205_232163_c1 3300050515 Unclassified 1728
459 nmdc:mga0a205_26352_c1 3300050515 Bacteria 5543
460 nmdc:mga0a205_42824_c2 3300050515 Bacteria 3287
461 nmdc:mga0a205_47700_c1 3300050515 Bacteria 4133
462 nmdc:mga0a205_52227_c1 3300050515 Bacteria 3945
463 nmdc:mga0a205_67042_c1 3300050515 Unclassified 3467
464 nmdc:mga0a205_90492_c1 3300050515 Unclassified 2957
465 Ga0530510_0228266 3300061734 Bacteria 1385
466 Ga0501291_009965
467 CNBas_1000031
468 CNAas_1000487
469 JGI24751J29686_10000016
470 JGI24751J29686_10000049
471 JGI24751J29686_10000083
472 JGI25406J46586_10001054
473 JGI25406J46586_10004343
474 JGI25406J46586_10011909
475 Ga0065714_10002184
476 Ga0065704_10004185
477 Ga0065704_10073832
478 Ga0065712_10005707
479 Ga0065712_10067743
480 Ga0065712_10123595
481 Ga0065715_10008303
482 Ga0065715_10089780
483 Ga0065715_10090895
484 Ga0065715_10094377
485 Ga0065715_10098361
486 Ga0065715_10100282
487 Ga0065715_10101224
488 Ga0065715_10122135
489 Ga0065715_10174154
490 Ga0065707_10001165
491 Ga0065707_10001943
492 Ga0065707_10018104
493 Ga0070676_10125126
494 Ga0070670_100000114
495 Ga0070670_100002456
496 Ga0070670_100055796
497 Ga0070670_100178441
498 Ga0068869_100025069
499 Ga0068869_100032366
500 Ga0068869_100035888
501 Ga0068869_100082185
502 Ga0070680_100002036
503 Ga0070680_100010390
504 Ga0070680_100058212
505 Ga0070682_100000088
506 Ga0070682_100010294
507 Ga0070682_100016807
508 Ga0070682_100126432
509 Ga0068868_100031687
510 Ga0068868_100132558
511 Ga0070689_100000707
512 Ga0070687_100006901
513 Ga0070687_100009452
514 Ga0070687_100038172
515 Ga0070687_100066384
516 Ga0070692_10001286
517 Ga0070692_10024209
518 Ga0070675_100140148
519 Ga0070673_100110921
520 Ga0070673_100217368
521 Ga0070701_10009828
522 Ga0070705_100017664
523 Ga0070705_100021685
524 Ga0070705_100068803
525 Ga0070705_100099434
526 Ga0070700_100000246
527 Ga0070700_100017470
528 Ga0070700_100017926
529 Ga0070700_100046874
530 Ga0070700_100101337
531 Ga0070694_100025953
532 Ga0070694_100040089
533 Ga0070708_100000147
534 Ga0070708_100000201
535 Ga0070708_100251032
536 Ga0070681_10000110
537 Ga0070681_10013263
538 Ga0070681_10027063
539 Ga0070681_10090011
540 Ga0070681_10093917
541 Ga0070681_10150798
542 Ga0068867_100084958
543 Ga0070706_100002306
544 Ga0070706_100038890
545 Ga0070707_100009346
546 Ga0070707_100063570
547 Ga0070707_100097720
548 Ga0070698_100002390
549 Ga0070698_100008639
550 Ga0070698_100011920
551 Ga0070698_100015405
552 Ga0070698_100059924
553 Ga0070698_100103690
554 Ga0070698_100204598
555 Ga0070699_100000971
556 Ga0070699_100002774
557 Ga0070699_100003106
558 Ga0070699_100005204
559 Ga0070699_100257345
560 Ga0070679_100000060
561 Ga0070679_100000783
562 Ga0070679_100158219
563 Ga0070697_100000687
564 Ga0070697_100001795
565 Ga0070697_100026242
566 Ga0070697_100030571
567 Ga0070697_100135198
568 Ga0070697_100140764
569 Ga0070697_100153447
570 Ga0070672_100056671
571 Ga0070686_100007130
572 Ga0070686_100012179
573 Ga0070695_100026027
574 Ga0070695_100054748
575 Ga0070695_100086128
576 Ga0070695_100176165
577 Ga0070696_100041152
578 Ga0070696_100085881
579 Ga0070693_100011066
580 Ga0070693_100145013
581 Ga0070704_100006768
582 Ga0070704_100048945
583 Ga0070704_100066972
584 Ga0070704_100118454
585 Ga0070664_100020175
586 Ga0070664_100314820
587 Ga0068857_100048497
588 Ga0068857_100062765
589 Ga0070702_100005267
590 Ga0070702_100010158
591 Ga0070702_100015718
592 Ga0070702_100039443
593 Ga0070702_100106527
594 Ga0068859_100002572
595 Ga0068859_100035150
596 Ga0068859_100052017
597 Ga0068859_100053804
598 Ga0068859_100113082
599 Ga0068859_100121792
600 Ga0068859_100142128
601 Ga0068859_100168549
602 Ga0068864_100002042
603 Ga0068864_100008211
604 Ga0068864_100009537
605 Ga0068864_100010249
606 Ga0068864_100013603
607 Ga0068864_100031010
608 Ga0068864_100056141
609 Ga0068864_100116013
610 Ga0068861_100002231
611 Ga0068861_100014691
612 Ga0068870_10005814
613 Ga0068870_10020963
614 Ga0068863_100011832
615 Ga0068863_100060603
616 Ga0068863_100176952
617 Ga0068858_100030043
618 Ga0068858_100057804
619 Ga0068858_100083918
620 Ga0068858_100131128
621 Ga0068858_100167355
622 Ga0068858_100205250
623 Ga0068858_100235657
624 Ga0068860_100071148
625 Ga0068860_100074027
626 Ga0068860_100151758
627 Ga0068860_100168233
628 Ga0068862_100017839
629 Ga0068862_100033867
630 Ga0068862_100057438
631 Ga0081539_10000490
632 Ga0081539_10001185
633 Ga0081539_10001697
634 Ga0081539_10002668
635 Ga0081539_10023165
636 Ga0081539_10036535
637 Ga0081539_10067769
638 Ga0070715_10000018
639 Ga0070716_100000007
640 Ga0097621_100001228
641 Ga0097621_100004909
642 Ga0097621_100050839
643 Ga0097621_100052109
644 Ga0097621_100076662
645 Ga0068871_100020620
646 Ga0068871_100111523
647 Ga0068871_100127556
648 Ga0075428_100019547
649 Ga0075430_100050531
650 Ga0075431_100026657
651 Ga0075433_10037244
652 Ga0075433_10052261
653 Ga0075433_10064976
654 Ga0075433_10129219
655 Ga0075434_100003211
656 Ga0075434_100052192
657 Ga0075434_100072333
658 Ga0075434_100094449
659 Ga0075429_100020104
660 Ga0075429_100096549
661 Ga0097620_100002571
662 Ga0097620_100035150
663 Ga0097620_100052022
664 Ga0097620_100053803
665 Ga0097620_100113085
666 Ga0097620_100121796
667 Ga0097620_100142129
668 Ga0097620_100168557
669 Ga0075435_100014989
670 Ga0075435_100045454
671 Ga0111539_10000363
672 Ga0111539_10005260
673 Ga0111539_10008997
674 Ga0111539_10009029
675 Ga0111539_10044617
676 Ga0111539_10195451
677 Ga0105245_10139382
678 Ga0105247_10008133
679 Ga0105247_10020991
680 Ga0114129_10003008
681 Ga0114129_10004096
682 Ga0114129_10004613
683 Ga0114129_10009665
684 Ga0114129_10014578
685 Ga0114129_10015160
686 Ga0114129_10022539
687 Ga0114129_10033394
688 Ga0114129_10049880
689 Ga0114129_10067681
690 Ga0114129_10085067
691 Ga0114129_10106465
692 Ga0114129_10119179
693 Ga0114129_10470966
694 Ga0105243_10010825
695 Ga0105243_10012124
696 Ga0105243_10057883
697 Ga0105243_10216436
698 Ga0105241_10012910
699 Ga0105241_10014344
700 Ga0105241_10050435
701 Ga0105241_10166913
702 Ga0105242_10001522
703 Ga0105242_10023206
704 Ga0105242_10092930
705 Ga0105242_10222367
706 Ga0105248_10001196
707 Ga0105248_10001900
708 Ga0105248_10032844
709 Ga0105248_10212627
710 Ga0105237_10000527
711 Ga0105237_10000767
712 Ga0105237_10128155
713 Ga0105238_10010842
714 Ga0105238_10011684
715 Ga0105238_10151526
716 Ga0105249_10030850
717 Ga0105249_10344313
718 Ga0105239_10004675
719 Ga0105239_10198594
720 Ga0105239_10387033
721 Ga0105246_10059397
722 Ga0105246_10129380
723 Ga0157373_10008525
724 Ga0157373_10012993
725 Ga0157373_10100291
726 Ga0157374_10098891
727 Ga0157378_10000113
728 Ga0157378_10003037
729 Ga0157378_10049278
730 Ga0157378_10052159
731 Ga0157378_10094677
732 Ga0157378_10130869
733 Ga0163162_10003901
734 Ga0163162_10008413
735 Ga0163162_10027154
736 Ga0163162_10387992
737 Ga0157372_10026941
738 Ga0157372_10042291
739 Ga0157375_10007521
740 Ga0157375_10020751
741 Ga0157375_10025845
742 Ga0163163_10000207
743 Ga0163163_10000527
744 Ga0163163_10002364
745 Ga0163163_10002861
746 Ga0163163_10039727
747 Ga0163163_10198817
748 Ga0163163_10200651
749 Ga0157380_10037691
750 Ga0157380_10055818
751 Ga0157380_10079842
752 Ga0157380_10113537
753 Ga0157380_10141599
754 Ga0157377_10025900
755 Ga0157379_10019865
756 Ga0157379_10201257
757 Ga0157379_10274364
758 Ga0157376_10022003
759 Ga0207653_10002090
760 Ga0207642_10073342
761 Ga0207710_10001827
762 Ga0207710_10039033
763 Ga0207688_10086314
764 Ga0207647_10004110
765 Ga0207647_10006715
766 Ga0207647_10058769
767 Ga0207685_10000022
768 Ga0207645_10073817
769 Ga0207643_10007677
770 Ga0207643_10050060
771 Ga0207684_10000091
772 Ga0207684_10000172
773 Ga0207684_10017552
774 Ga0207684_10021657
775 Ga0207684_10052190
776 Ga0207684_10055074
777 Ga0207684_10094273
778 Ga0207684_10120528
779 Ga0207707_10000015
780 Ga0207707_10000022
781 Ga0207707_10006777
782 Ga0207707_10016207
783 Ga0207707_10090539
784 Ga0207671_10001070
785 Ga0207671_10003690
786 Ga0207671_10216345
787 Ga0207660_10001657
788 Ga0207660_10038175
789 Ga0207662_10003631
790 Ga0207662_10021230
791 Ga0207662_10061416
792 Ga0207652_10000253
793 Ga0207652_10000342
794 Ga0207652_10187453
795 Ga0207646_10034910
796 Ga0207646_10040422
797 Ga0207646_10050722
798 Ga0207646_10084227
799 Ga0207681_10044646
800 Ga0207694_10002853
801 Ga0207694_10023891
802 Ga0207650_10000009
803 Ga0207650_10000022
804 Ga0207690_10047688
805 Ga0207706_10090152
806 Ga0207686_10015352
807 Ga0207686_10023441
808 Ga0207709_10004289
809 Ga0207709_10006238
810 Ga0207709_10006592
811 Ga0207670_10002719
812 Ga0207665_10000018
813 Ga0207711_10036325
814 Ga0207711_10100840
815 Ga0207689_10004787
816 Ga0207689_10047429
817 Ga0207689_10064513
818 Ga0207651_10013813
819 Ga0207651_10069565
820 Ga0207651_10080145
821 Ga0207712_10016706
822 Ga0207712_10020929
823 Ga0207712_10105884
824 Ga0207677_10044886
825 Ga0207677_10172309
826 Ga0207639_10061638
827 Ga0207708_10000528
828 Ga0207708_10013139
829 Ga0207708_10032535
830 Ga0207708_10034710
831 Ga0207708_10089632
832 Ga0207702_10002405
833 Ga0207702_10264839
834 Ga0207641_10014008
835 Ga0207641_10102382
836 Ga0207641_10130372
837 Ga0207641_10233159
838 Ga0207641_10264928
839 Ga0207648_10044026
840 Ga0207648_10081918
841 Ga0207676_10002795
842 Ga0207676_10006688
843 Ga0207676_10226796
844 Ga0207676_10268559
845 Ga0207676_10304368
846 Ga0207674_10014958
847 Ga0207674_10040655
848 Ga0207674_10088762
849 Ga0207674_10206032
850 Ga0207675_100002807
851 Ga0207675_100004925
852 Ga0207675_100040943
853 Ga0207698_10299864
854 Ga0207428_10009114
855 Ga0268266_10206983
856 Ga0268264_10051946
857 Ga0268264_10053848
858 Ga0268264_10056858
859 Ga0268264_10106434
860 Ga0268264_10107274
861 Ga0268264_10119803
862 Ga0268264_10201491
863 Ga0307405_10078607
864 Ga0307406_10008228
865 Ga0307406_10028052
866 Ga0307407_10025506
867 Ga0307416_100319018
868 Ga0307414_10083405
869 Ga0307411_10044313
870 Ga0373951_0002399
871 Ga0373951_0008134
872 Ga0373941_0011734
873 Ga0373942_0027010
874 Ga0395898_0158096
875 Ga0395901_0018155
876 Ga0242422_00564
877 Ga0242422_00642
878 Ga0242420_000519
879 Ga0439458_0000783
880 Ga0439458_0004279
881 Ga0451576_0122429
882 Ga0495663_0000789
883 Ga0495598_0000220
884 Ga0495621_0000030
885 Ga0496102_0206801
886 Ga0496104_0047504
887 Ga0496106_0111153
888 Ga0496112_0352584
889 Ga0496113_0146634
890 Ga0501296_003562
891 Ga0501303_001221
892 Ga0501038_0006435
893 Ga0501038_0073160
894 Ga0501202_010896
895 Ga0501217_002537
896 Ga0501217_012531
897 Ga0501224_005066
898 Ga0501227_017622
899 Ga0501233_002607
900 Ga0501249_010655
901 Ga0501221_009994
902 Ga0501234_008996
903 Ga0501245_003857
904 Ga0501273_001149
905 Ga0501283_000392
906 nmdc:mga05p37_129905_c1
907 nmdc:mga05p37_134722_c1
908 nmdc:mga05p37_334328_c1
909 nmdc:mga05p37_61773_c1
910 nmdc:mga05p37_65100_c1
911 nmdc:mga05p37_78006_c1
912 nmdc:mga0qj67_31288_c1
913 nmdc:mga0qj67_53418_c1
914 nmdc:mga08y16_1742_c1
915 nmdc:mga08y16_27029_c1
916 nmdc:mga08y16_43380_c1
917 nmdc:mga08y16_6584_c1
918 nmdc:mga0n895_219583_c1
919 nmdc:mga0n895_53716_c1
920 nmdc:mga0rr50_101755_c1
921 nmdc:mga0rr50_126851_c1
922 nmdc:mga0a205_103035_c1
923 nmdc:mga0a205_232163_c1
924 nmdc:mga0a205_26352_c1
925 nmdc:mga0a205_42824_c2
926 nmdc:mga0a205_47700_c1
927 nmdc:mga0a205_52227_c1
928 nmdc:mga0a205_67042_c1
929 nmdc:mga0a205_90492_c1
930 Ga0530510_0228266

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lnw-assembly1.cif.gz_B crystal structure of the mexr repressor of the mexab-oprm multidrug efflux operon of pseudomonas aeruginosa 0.9169 35 101
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9163 28 92
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9028 28 92
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9024 33 92
2pex-assembly1.cif.gz_A structure of reduced c22s ohrr from xanthamonas campestris 0.8931 32 102
ID Description Score Start End Superfamily
4kmfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9163 28 92 1.10.10.10
3ecoB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9085 33 101 1.10.10.10
4kmfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9028 28 92 1.10.10.10
1lnwG01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9025 35 101 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9024 33 92 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7Y4XA03-F1-model_v4 ATP-binding protein 0.9637 17 427 GO:0005524
AF-A0A838N4E0-F1-model_v4 Uncharacterized protein 0.9614 344 425
AF-A0A7X5WSB6-F1-model_v4 AAA family ATPase 0.959 18 311
AF-A0A2V8QPK6-F1-model_v4 AAA family ATPase 0.9586 1 281
AF-A0A2G2KMA8-F1-model_v4 deleted 0.9571 17 424

Map