F449549

General Info

Members Datasets Scaffolds Average Seq Length
465 372 930 130

Family's Representative Sequence

Representative Sequence 3300047471|Ga0495684_0074166|Ga0495684_0074166_1988_2347
Length 119
Sequence MIDASTFLRRALLADTVFSGVAALGFTFGAGAFATLFNLPEALLRETGLFLIAYTALVGWLASRALVPKPLVLLVLLFSGAVSPNLAGELMVVAQAIATGVFAELQYMGLRKSGRVVAA

Samples

Sample ID Description Type Environment
1 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
60 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
61 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
62 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
69 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
93 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
94 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
95 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
98 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
99 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
100 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
111 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
112 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
113 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
114 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
135 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
148 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
180 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
183 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
192 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
193 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
194 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
195 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
196 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
197 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
198 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
199 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
200 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
201 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
202 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
203 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
204 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
205 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
206 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
207 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
208 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
209 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
210 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
211 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
212 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
213 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
214 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
215 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
216 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
217 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
218 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
219 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
220 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
221 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
222 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
223 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
224 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
225 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
226 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
227 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
228 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
229 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
230 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
231 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
232 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
233 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
234 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
235 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
236 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
237 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
238 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
239 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
240 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
241 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
242 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
243 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
244 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
245 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
246 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
247 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
248 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
249 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
250 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
251 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
252 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
253 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
254 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
255 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
256 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
257 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
258 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
259 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
260 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
261 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
262 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
263 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
264 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
265 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
266 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
267 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
268 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
269 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
270 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
271 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
272 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
273 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
274 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
275 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
276 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
277 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
278 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
279 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
280 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
281 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
282 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
283 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
284 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
285 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
286 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
287 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
288 2904699407
289 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
290 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
291 2906610324
292 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
293 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
294 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
295 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
296 2922425934
297 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
298 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
299 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
300 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
301 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
302 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
303 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
304 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
305 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
306 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
307 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
308 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
309 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
310 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
311 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
312 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
313 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
314 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
315 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
316 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
317 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
318 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
319 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
320 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
321 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
322 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
323 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
324 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
325 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
326 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
327 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
328 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
329 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
330 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
331 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
332 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
333 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
334 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
335 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
336 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
337 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
338 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
339 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
340 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
341 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
342 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
343 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
344 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
345 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
346 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
347 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
348 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
349 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
350 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
351 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
352 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
353 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
354 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
355 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
356 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
357 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
358 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
359 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
360 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
361 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
362 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
363 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
364 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
365 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
366 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
367 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
368 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
369 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
370 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
371 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
372 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 66.23
Metatranscriptomes 0
Isolates 33.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.9
Nodule 27.31
Rhizoplane 4.95
Rhizosphere 39.78
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495684_0074166 3300047471 Bacteria 2585
2 JGI24735J21928_10174065 3300002067 Bacteria 623
3 JGI25406J46586_10002803 3300003203 Bacteria 8198
4 JGI25165J46597_1007185 3300003214 Bacteria 1877
5 JGI25153J46596_10000942 3300003215 Bacteria 17692
6 JGI25153J46596_10003952 3300003215 Bacteria 8119
7 JGI25160J50197_1021373 3300003354 Bacteria 1925
8 JGI25404J52841_10017965 3300003659 Bacteria 1533
9 JGI25404J52841_10033347 3300003659 Bacteria 1097
10 Ga0055539_1003704 3300003752 Bacteria 2094
11 Ga0055525_1023824 3300003759 Bacteria 521
12 Ga0055542_1005588 3300003762 Bacteria 2812
13 Ga0055529_1015364 3300003763 Bacteria 966
14 Ga0055524_1039661 3300003775 Bacteria 1213
15 Ga0055531_10028328 3300003794 Bacteria 1935
16 JGI25405J52794_10105209 3300003911 Bacteria 631
17 Ga0055543_1028523 3300004625 Bacteria 983
18 Ga0065165_1000626 3300005262 Bacteria 51320
19 Ga0065165_1090545 3300005262 Bacteria 779
20 Ga0065165_1111053 3300005262 Bacteria 675
21 Ga0070666_10556068 3300005335 Bacteria 835
22 Ga0068868_100461891 3300005338 Bacteria 1106
23 Ga0070660_100336488 3300005339 Bacteria 1242
24 Ga0070661_100525325 3300005344 Bacteria 950
25 Ga0070659_100331978 3300005366 Bacteria 1273
26 Ga0070659_101312502 3300005366 Bacteria 642
27 Ga0070709_11330024 3300005434 Bacteria 580
28 Ga0070714_100946609 3300005435 Bacteria 837
29 Ga0070714_101213870 3300005435 Bacteria 736
30 Ga0070663_101842377 3300005455 Bacteria 543
31 Ga0070706_100753729 3300005467 Bacteria 902
32 Ga0070707_100359661 3300005468 Bacteria 1414
33 Ga0070698_100031559 3300005471 Bacteria 5491
34 Ga0070684_100217934 3300005535 Bacteria 1741
35 Ga0070697_100062770 3300005536 Bacteria 3033
36 Ga0070665_100053221 3300005548 Bacteria 4060
37 Ga0070665_100385760 3300005548 Bacteria 1408
38 Ga0070665_101503302 3300005548 Bacteria 682
39 Ga0068855_100781831 3300005563 Bacteria 1016
40 Ga0068856_100586091 3300005614 Bacteria 1136
41 Ga0068852_100181282 3300005616 Bacteria 1980
42 Ga0068851_10678326 3300005834 Bacteria 633
43 Ga0081455_10004428 3300005937 Bacteria 15766
44 Ga0081455_10221539 3300005937 Bacteria 1402
45 Ga0081540_1010797 3300005983 Bacteria 6140
46 Ga0081540_1016612 3300005983 Bacteria 4596
47 Ga0081540_1020675 3300005983 Bacteria 3949
48 Ga0081540_1062882 3300005983 Bacteria 1760
49 Ga0081540_1091249 3300005983 Bacteria 1339
50 Ga0081539_10000008 3300005985 Bacteria 525071
51 Ga0081539_10000319 3300005985 Bacteria 106944
52 Ga0081539_10382427 3300005985 Bacteria 587
53 Ga0075365_10257557 3300006038 Bacteria 1226
54 Ga0075369_10339650 3300006186 Bacteria 704
55 Ga0075366_10848391 3300006195 Bacteria 569
56 Ga0075434_100996345 3300006871 Bacteria 852
57 Ga0099824_1004477 3300006942 Bacteria 20117
58 Ga0099794_10117220 3300007265 Bacteria 1337
59 Ga0099794_10156943 3300007265 Bacteria 1156
60 Ga0105240_12270315 3300009093 Bacteria 562
61 Ga0105245_10797576 3300009098 Bacteria 982
62 Ga0105242_11780336 3300009176 Bacteria 654
63 Ga0105248_10605860 3300009177 Bacteria 1236
64 Ga0105248_10688699 3300009177 Bacteria 1153
65 Ga0105237_10881260 3300009545 Bacteria 902
66 Ga0105237_11395066 3300009545 Bacteria 707
67 Ga0105237_11624835 3300009545 Bacteria 653
68 Ga0105238_11681662 3300009551 Bacteria 665
69 Ga0105239_10049581 3300010375 Bacteria 4604
70 Ga0105239_12397816 3300010375 Bacteria 614
71 Ga0157316_1075603 3300012510 Bacteria 517
72 Ga0157370_10229248 3300013104 Bacteria 1719
73 Ga0157370_10253406 3300013104 Bacteria 1628
74 Ga0157374_10330431 3300013296 Bacteria 1512
75 Ga0163162_10791335 3300013306 Bacteria 1066
76 Ga0163162_11489516 3300013306 Bacteria 771
77 Ga0157375_10157737 3300013308 Bacteria 2409
78 Ga0163163_10743009 3300014325 Bacteria 1044
79 Ga0157380_11310008 3300014326 Bacteria 772
80 Ga0157379_12026495 3300014968 Bacteria 569
81 Ga0214544_1000020 3300021320 Bacteria 178560
82 Ga0214544_1029249 3300021320 Bacteria 2053
83 Ga0214542_1000024 3300021321 Bacteria 191218
84 Ga0214542_1032278 3300021321 Bacteria 1864
85 Ga0214545_1000011 3300021324 Bacteria 190550
86 Ga0214545_1018398 3300021324 Bacteria 6375
87 Ga0214543_1000033 3300021327 Bacteria 190419
88 Ga0214543_1032870 3300021327 Bacteria 1919
89 Ga0214543_1055539 3300021327 Bacteria 704
90 Ga0214543_1056318 3300021327 Bacteria 687
91 Ga0213876_10123488 3300021384 Bacteria 1375
92 Ga0213876_10313431 3300021384 Bacteria 834
93 Ga0207425_1029407 3300025245 Bacteria 1107
94 Ga0209026_1042177 3300025250 Unclassified 660
95 Ga0209677_101724 3300025253 Bacteria 9098
96 Ga0209148_1000382 3300025254 Bacteria 53278
97 Ga0209233_1005509 3300025261 Bacteria 4191
98 Ga0209233_1006926 3300025261 Bacteria 3625
99 Ga0209233_1060528 3300025261 Bacteria 732
100 Ga0209455_1002055 3300025272 Bacteria 8135
101 Ga0209564_1057898 3300025295 Bacteria 889
102 Ga0209758_1000171 3300025297 Bacteria 148854
103 Ga0209758_1000484 3300025297 Bacteria 65301
104 Ga0209256_1014285 3300025299 Bacteria 2868
105 Ga0207426_1009123 3300025302 Bacteria 3945
106 Ga0207426_1016635 3300025302 Bacteria 2634
107 Ga0207426_1043507 3300025302 Bacteria 1379
108 Ga0209257_1000708 3300025304 Bacteria 51573
109 Ga0207656_10171819 3300025321 Bacteria 1036
110 Ga0207680_10499746 3300025903 Bacteria 866
111 Ga0207705_10287177 3300025909 Bacteria 1260
112 Ga0207684_10601165 3300025910 Bacteria 939
113 Ga0207654_10988354 3300025911 Bacteria 612
114 Ga0207671_11235555 3300025914 Bacteria 583
115 Ga0207657_10200194 3300025919 Bacteria 1607
116 Ga0207646_11184351 3300025922 Bacteria 670
117 Ga0207694_10379138 3300025924 Bacteria 1174
118 Ga0207709_10529068 3300025935 Bacteria 924
119 Ga0207665_10240568 3300025939 Bacteria 1333
120 Ga0207667_11492162 3300025949 Bacteria 647
121 Ga0207640_11513575 3300025981 Bacteria 603
122 Ga0207678_10428301 3300026067 Bacteria 1148
123 Ga0207702_10635918 3300026078 Bacteria 1049
124 Ga0207683_10196753 3300026121 Bacteria 1831
125 Ga0207698_10302942 3300026142 Bacteria 1488
126 Ga0207698_11684414 3300026142 Bacteria 649
127 Ga0209389_1000127 3300027296 Bacteria 67209
128 Ga0209589_1000243 3300027357 Bacteria 67209
129 Ga0209489_102084 3300027361 Bacteria 41097
130 Ga0209179_1033493 3300027512 Bacteria 1062
131 Ga0268266_11208049 3300028379 Bacteria 731
132 Ga0268266_11694640 3300028379 Bacteria 607
133 Ga0307508_10450164 3300031616 Bacteria 880
134 Ga0315911_1000011 3300033442 Bacteria 264678
135 Ga0373932_0058908 3300035112 Bacteria 1162
136 Ga0373932_0154017 3300035112 Bacteria 791
137 Ga0373931_0556525 3300035691 Bacteria 746
138 Ga0373933_0106759 3300035724 Bacteria 1742
139 Ga0373937_0328509 3300036401 Bacteria 1447
140 Ga0373925_0777731 3300037068 Bacteria 789
141 Ga0395900_0053447 3300037418 Bacteria 4157
142 Ga0395900_0672285 3300037418 Bacteria 971
143 Ga0395898_0107605 3300037466 Bacteria 2674
144 Ga0395905_0165130 3300037471 Bacteria 2080
145 Ga0436364_0489803 3300037853 Bacteria 2588
146 Ga0395901_0069235 3300038443 Bacteria 3675
147 Ga0395901_0398687 3300038443 Bacteria 1414
148 Ga0395901_0830174 3300038443 Bacteria 911
149 Ga0436365_1113156 3300039437 Bacteria 1212
150 Ga0436360_0230428 3300039438 Bacteria 721
151 Ga0436363_0229795 3300039450 Bacteria 893
152 Ga0436363_0689700 3300039450 Bacteria 687
153 Ga0451793_1382484 3300041452 Bacteria 543
154 Ga0451797_0275269 3300041453 Bacteria 913
155 Ga0451833_0360950 3300041491 Bacteria 1212
156 Ga0451853_1517339 3300041512 Bacteria 1175
157 Ga0451853_2905296 3300041512 Bacteria 689
158 Ga0451853_3239765 3300041512 Bacteria 529
159 Ga0466972_0001004 3300044658 Bacteria 13550
160 Ga0466972_0015844 3300044658 Bacteria 3769
161 Ga0466972_0061482 3300044658 Bacteria 1801
162 Ga0466972_0230433 3300044658 Bacteria 867
163 Ga0466972_0398572 3300044658 Bacteria 645
164 Ga0466966_0218851 3300044684 Bacteria 1150
165 Ga0466961_0240546 3300044693 Bacteria 1113
166 Ga0466968_0001062 3300044735 Bacteria 9712
167 Ga0466970_0245804 3300044765 Bacteria 1002
168 Ga0466960_0046193 3300044901 Bacteria 2084
169 Ga0466960_0226496 3300044901 Bacteria 1030
170 Ga0466960_0681403 3300044901 Bacteria 615
171 Ga0466959_0602552 3300045049 Bacteria 739
172 Ga0466959_0731106 3300045049 Bacteria 663
173 Ga0466958_0235485 3300045836 Bacteria 1170
174 Ga0495592_0057556 3300046454 Bacteria 2869
175 Ga0495592_0176124 3300046454 Bacteria 1460
176 Ga0495629_0002828 3300046459 Bacteria 13259
177 Ga0495629_0624725 3300046459 Bacteria 719
178 Ga0495629_0746800 3300046459 Bacteria 648
179 Ga0495651_0008596 3300046462 Bacteria 7826
180 Ga0495651_0090771 3300046462 Bacteria 2291
181 Ga0495653_0011458 3300046463 Bacteria 7248
182 Ga0495653_0185221 3300046463 Bacteria 1425
183 Ga0495582_0236340 3300046473 Bacteria 1047
184 Ga0495582_0319054 3300046473 Bacteria 894
185 Ga0495662_0162971 3300046476 Bacteria 1099
186 Ga0495664_0012477 3300046477 Bacteria 4813
187 Ga0495664_0398615 3300046477 Bacteria 826
188 Ga0495606_0005836 3300046507 Bacteria 11609
189 Ga0495606_0301174 3300046507 Bacteria 869
190 Ga0495606_0327643 3300046507 Bacteria 820
191 Ga0495608_0053059 3300046511 Bacteria 2682
192 Ga0495608_0215848 3300046511 Bacteria 1205
193 Ga0495628_0028732 3300046516 Bacteria 4516
194 Ga0495628_0371465 3300046516 Bacteria 1049
195 Ga0495628_0469269 3300046516 Bacteria 912
196 Ga0495631_0356534 3300046518 Bacteria 622
197 Ga0495643_0264194 3300046522 Bacteria 798
198 Ga0495652_0017612 3300046529 Bacteria 6373
199 Ga0495652_0047213 3300046529 Bacteria 3693
200 Ga0495640_0042188 3300046533 Bacteria 3185
201 Ga0495640_0049288 3300046533 Bacteria 2905
202 Ga0495587_0012371 3300046536 Bacteria 5374
203 Ga0495645_0010840 3300046543 Bacteria 6404
204 Ga0495667_0182591 3300046559 Bacteria 1346
205 Ga0495668_0252326 3300046616 Bacteria 966
206 Ga0495634_0032773 3300046642 Bacteria 3571
207 Ga0495634_0168770 3300046642 Bacteria 1376
208 Ga0495635_0006205 3300046663 Bacteria 8327
209 Ga0495635_0057731 3300046663 Bacteria 2670
210 Ga0495588_0571392 3300046674 Bacteria 592
211 Ga0495657_0007252 3300046675 Bacteria 8588
212 Ga0495657_0122016 3300046675 Bacteria 1640
213 Ga0495599_0002825 3300046678 Bacteria 10116
214 Ga0495623_0015241 3300046679 Bacteria 4968
215 Ga0495623_0120798 3300046679 Bacteria 1577
216 Ga0495646_0033961 3300046680 Bacteria 3171
217 Ga0495658_0412922 3300046683 Bacteria 861
218 Ga0495658_0901156 3300046683 Bacteria 565
219 Ga0495613_0307526 3300046689 Bacteria 1096
220 Ga0495613_0966428 3300046689 Bacteria 548
221 Ga0495624_0006049 3300046690 Bacteria 8630
222 Ga0495624_0135780 3300046690 Bacteria 1508
223 Ga0495600_0003921 3300046809 Bacteria 8839
224 Ga0495600_0009380 3300046809 Bacteria 6046
225 Ga0495581_0488171 3300047315 Bacteria 716
226 Ga0495604_0001798 3300047317 Bacteria 17470
227 Ga0495604_0005861 3300047317 Bacteria 9740
228 Ga0495604_0565500 3300047317 Bacteria 732
229 Ga0495604_0891005 3300047317 Bacteria 556
230 Ga0495674_0075485 3300047319 Bacteria 2901
231 Ga0495676_0115970 3300047321 Bacteria 1957
232 Ga0495680_0001522 3300047322 Bacteria 24794
233 Ga0495687_256498 3300047443 Bacteria 519
234 Ga0495675_0006723 3300047444 Bacteria 7049
235 Ga0495675_0096001 3300047444 Bacteria 1858
236 Ga0495673_0204856 3300047469 Bacteria 736
237 Ga0495686_0269560 3300047472 Bacteria 950
238 Ga0495686_0270212 3300047472 Bacteria 949
239 Ga0495593_0343804 3300047673 Bacteria 746
240 Ga0495602_0001750 3300048088 Bacteria 21663
241 Ga0496100_0130004 3300048903 Bacteria 1773
242 Ga0496100_0458312 3300048903 Bacteria 978
243 Ga0496100_1351394 3300048903 Bacteria 562
244 Ga0496101_0998222 3300048904 Bacteria 658
245 Ga0496102_0350735 3300048905 Bacteria 1389
246 Ga0496102_1496975 3300048905 Bacteria 593
247 Ga0496103_0279659 3300048906 Bacteria 1073
248 Ga0496104_0070985 3300048907 Bacteria 3311
249 Ga0496105_0003799 3300048908 Bacteria 11266
250 Ga0496106_1022346 3300048909 Bacteria 649
251 Ga0496107_0060688 3300048910 Bacteria 2737
252 Ga0496107_0328977 3300048910 Bacteria 1137
253 Ga0496107_1081724 3300048910 Bacteria 580
254 Ga0496107_1196687 3300048910 Bacteria 546
255 Ga0496110_0902303 3300048913 Bacteria 790
256 Ga0496112_1186227 3300048915 Bacteria 680
257 Ga0496113_0126578 3300048916 Bacteria 2001
258 Ga0496113_0820226 3300048916 Bacteria 738
259 Ga0496114_0184471 3300048917 Bacteria 1823
260 Ga0496115_0035687 3300048918 Bacteria 3935
261 Ga0496116_0273289 3300048919 Bacteria 824
262 Ga0496118_0075301 3300048921 Bacteria 2408
263 Ga0496118_0480786 3300048921 Bacteria 623
264 Ga0496119_0040474 3300048922 Bacteria 2980
265 Ga0496120_0006847 3300048923 Bacteria 8624
266 Ga0496121_0015329 3300048924 Bacteria 8044
267 Ga0496121_0042723 3300048924 Bacteria 3938
268 Ga0496123_0320857 3300048926 Bacteria 731
269 Ga0496124_0110098 3300048927 Bacteria 2218
270 Ga0496125_0090769 3300048928 Bacteria 2291
271 Ga0496125_0115578 3300048928 Bacteria 1929
272 Ga0496126_0035377 3300048929 Bacteria 4682
273 Ga0496126_0047160 3300048929 Bacteria 3945
274 Ga0495682_0251293 3300049460 Bacteria 625
275 nmdc:mga0yw44_1574_c1 3300050492 Bacteria 9151
276 Ga0495601_0156175 3300053077 Bacteria 1490
277 Ga0495601_0724036 3300053077 Bacteria 634
278 Ga0495595_0534216 3300053084 Bacteria 598
279 Ga0495619_0094058 3300053085 Bacteria 2033
280 Ga0500578_0583604 3300053086 Bacteria 617
281 Ga0500647_0131523 3300053091 Bacteria 1179
282 Ga0500651_0297807 3300053093 Bacteria 926
283 Ga0500651_0663737 3300053093 Bacteria 560
284 Ga0500566_0216271 3300053094 Bacteria 956
285 Ga0500557_000039 3300053105 Bacteria 66862
286 Ga0500569_024014 3300053109 Bacteria 1645
287 Ga0500595_071203 3300053119 Bacteria 1031
288 Ga0500607_216300 3300053121 Bacteria 804
289 Ga0500614_010764 3300053123 Bacteria 1968
290 Ga0500626_106357 3300053128 Bacteria 1217
291 Ga0500559_0103706 3300053136 Bacteria 1312
292 Ga0500564_389225 3300053138 Bacteria 508
293 Ga0500568_0031865 3300053139 Bacteria 2171
294 Ga0500568_0139330 3300053139 Bacteria 900
295 Ga0500590_239414 3300053148 Bacteria 732
296 Ga0500619_117876 3300053154 Bacteria 904
297 Ga0500620_030811 3300053155 Bacteria 1696
298 Ga0500638_012325 3300053162 Bacteria 3829
299 Ga0500638_180100 3300053162 Bacteria 913
300 Ga0500639_254469 3300053163 Bacteria 700
301 Ga0500639_257607 3300053163 Bacteria 693
302 Ga0500637_0054211 3300053178 Bacteria 2289
303 Ga0500570_085590 3300053724 Bacteria 1398
304 Ga0500625_191622 3300053729 Bacteria 699
305 Ga0500601_001204 3300053737 Bacteria 2884
306 Ga0500661_008351 3300055283 Bacteria 1905
307 2507510148 2507262055 Bacteria 8048963
308 2508544150 2508501009 Bacteria 7784016
309 2508697910 2508501042 Bacteria 8719808
310 2511398809 2511231028 Bacteria 8046582
311 2513643864 2513237094 Bacteria 8789602
312 2513660469 2513237096 Bacteria 8722461
313 2513704991 2513237102 Bacteria 7703324
314 2513721795 2513237104 Bacteria 10034502
315 2513858150 2513237137 Bacteria 9558895
316 2513877994 2513237139 Bacteria 8737671
317 2513922261 2513237145 Bacteria 8979722
318 2514017178 2513237161 Bacteria 8871253
319 2515629933 2515154112 Bacteria 8294334
320 2517105208 2517093001 Bacteria 9002274
321 2517893964 2517572143 Bacteria 9484767
322 2524439170 2524023205 Bacteria 8918781
323 2524536230 2524023228 Bacteria 10118060
324 2617352517 2617270735 Bacteria 9163226
325 2617379072 2617270741 Bacteria 8201522
326 2671122947 2667528175 Bacteria 7532676
327 2745078720 2744054633 Bacteria 8678936
328 2793059867 2791355196 Bacteria 7323613
329 2793072788 2791355197 Bacteria 8420563
330 2805919954 2802429603 Bacteria 8777136
331 2824606720 2824600985 Bacteria 8488197
332 2824616391 2824609381 Bacteria 8672835
333 2824624594 2824617872 Bacteria 8814715
334 2824633554 2824626560 Bacteria 8813858
335 2824640482 2824635225 Bacteria 8785348
336 2824648379 2824644064 Bacteria 8743947
337 2824659230 2824653114 Bacteria 8493680
338 2824674481 2824671348 Bacteria 8369588
339 2824683363 2824679649 Bacteria 8248951
340 2824694312 2824687955 Bacteria 8360029
341 2824699569 2824696289 Bacteria 8335049
342 2824712016 2824704595 Bacteria 9667483
343 2824722837 2824714736 Bacteria 8717648
344 2824727698 2824723954 Bacteria 8758240
345 2824740286 2824732956 Bacteria 7810675
346 2824752483 2824746037 Bacteria 7911610
347 2824761345 2824753945 Bacteria 9787441
348 2824771574 2824763712 Bacteria 9792355
349 2824778150 2824773399 Bacteria 8360218
350 2838125690 2838122688 Bacteria 8803140
351 2841941648 2841941048 Bacteria 8688029
352 2841951077 2841949485 Bacteria 8680857
353 2841959349 2841957949 Bacteria 8652217
354 2841974204 2841966195 Bacteria 8673214
355 2841975872 2841974524 Bacteria 8931498
356 2841989270 2841983080 Bacteria 8395090
357 2842038111 2842038055 Bacteria 8002051
358 2842048943 2842045827 Bacteria 8006841
359 2844317611 2844315083 Bacteria 8138177
360 2847944997 2847939898 Bacteria 8606328
361 2849080814 2849076700 Bacteria 7039503
362 2857509828 2857509624 Bacteria 7472071
363 2874593345 2874590934 Bacteria 8299676
364 2874623071 2874620515 Bacteria 8290088
365 2874636172 2874628541 Bacteria 8630250
366 2874652879 2874645413 Bacteria 8214782
367 2876762761 2876761206 Bacteria 10111113
368 2876773385 2876771140 Bacteria 8287509
369 2876821338 2876818435 Bacteria 8274608
370 2879077301 2879074833 Bacteria 8279565
371 2879130141 2879127579 Bacteria 8294491
372 2879146656 2879142872 Bacteria 8267021
373 2881367627 2881364244 Bacteria 7710352
374 2881670732 2881665667 Bacteria 8175609
375 2885368793 2885366525 Bacteria 8326213
376 2885377709 2885374607 Bacteria 8927485
377 2885417471 2885409591 Bacteria 9235467
378 2888422907 2888419890 Bacteria 7857137
379 2903735295 2903727486 Bacteria 8281579
380 2904669890 2904666416 Bacteria 8226587
381 2904705150
382 2904718602 2904711408 Bacteria 9771557
383 2906608791 2906602504 Bacteria 8295279
384 2906610860
385 2906650042 2906643746 Bacteria 8722424
386 2908744369 2908739725 Bacteria 8628932
387 2908778589 2908775508 Bacteria 8092255
388 2922394857 2922393267 Bacteria 8285685
389 2922428467
390 2929616395 2929615660 Bacteria 9193770
391 2929625139 2929624759 Bacteria 9339455
392 2932797211 2932794094 Bacteria 7915132
393 2932804904 2932801729 Bacteria 7987968
394 2933578322 2933577622 Bacteria 9116884
395 2935610950 2935608549 Bacteria 8203142
396 2935634458 2935630451 Bacteria 8169952
397 2935648376 2935648319 Bacteria 8801166
398 2935657636 2935656913 Bacteria 8965014
399 2935691804 2935684952 Bacteria 9590419
400 2935695242 2935694250 Bacteria 9291695
401 2935719872 2935713505 Bacteria 9608509
402 2935729361 2935722832 Bacteria 9608746
403 2935738779 2935732158 Bacteria 9706831
404 2935748036 2935741537 Bacteria 9707219
405 2935756620 2935750917 Bacteria 9590372
406 2935771370 2935769743 Bacteria 7878163
407 2935779058 2935777560 Bacteria 8077691
408 2935788264 2935785616 Bacteria 7962367
409 2935796971 2935793552 Bacteria 8012592
410 2935820435 2935819856 Bacteria 8261050
411 2935849556 2935847175 Bacteria 8228321
412 2935884858 2935883170 Bacteria 7964738
413 2935911671 2935908558 Bacteria 8568796
414 2935919325 2935916978 Bacteria 9113783
415 2935928700 2935926038 Bacteria 8601059
416 2935938345 2935934488 Bacteria 8602579
417 2935945763 2935942939 Bacteria 8599779
418 2935954630 2935951376 Bacteria 8602333
419 2935970517 2935967501 Bacteria 8603075
420 2935979245 2935975950 Bacteria 8347125
421 2935987737 2935984226 Bacteria 8302647
422 2936011286 2936011229 Bacteria 8801034
423 2936019881 2936019824 Bacteria 8804134
424 2936028477 2936028420 Bacteria 8965941
425 2936046604 2936046547 Bacteria 8903709
426 2936062299 2936055302 Bacteria 8785755
427 2940562534 2940556831 Bacteria 9590747
428 2941508944 2941507105 Bacteria 8166816
429 2941516773 2941515067 Bacteria 8166720
430 2941525132 2941523033 Bacteria 8169134
431 2941536270 2941531003 Bacteria 7653939
432 3005478588 3005474847 Bacteria 9259049
433 3005487820 3005483717 Bacteria 7877331
434 3005508868 3005506211 Bacteria 6943378
435 3005589322 3005587118 Bacteria 7794411
436 8006930796 8006926726 Bacteria 6749210
437 8006942773 8006933436 Bacteria 10410654
438 8006982495 8006973647 Bacteria 10679141
439 8016523019 8016522445 Bacteria 8156687
440 8016536481 8016530956 Bacteria 8155261
441 8016540762 8016539877 Bacteria 8155419
442 8016552480 8016548790 Bacteria 8155074
443 8016560862 8016557553 Bacteria 8154380
444 8016574842 8016566248 Bacteria 8158151
445 8016578916 8016575299 Bacteria 8154085
446 8016598734 8016595262 Bacteria 8149947
447 8016612351 8016603502 Bacteria 8731218
448 8016621456 8016613128 Bacteria 8794220
449 8016628502 8016622563 Bacteria 7999408
450 8019536199 8019530166 Bacteria 8155624
451 8019543265 8019538911 Bacteria 7872763
452 8019555585 8019547302 Bacteria 7996444
453 8019558529 8019555841 Bacteria 9642137
454 8019566773 8019565922 Bacteria 9639779
455 8019626389 8019619141 Bacteria 9218857
456 8019636103 8019629233 Bacteria 8687553
457 8019643563 8019638758 Bacteria 9062356
458 8019656359 8019648815 Bacteria 10014479
459 8019663872 8019659431 Bacteria 8577854
460 8019673501 8019668869 Bacteria 8791617
461 8019682629 8019678201 Bacteria 8863603
462 8019688313 8019687851 Bacteria 8712826
463 8055748041 8055742211 Bacteria 9226248
464 8056685222 8056681323 Bacteria 8472857
465 8056969415 8056967851 Bacteria 9038162
466 Ga0495684_0074166
467 JGI24735J21928_10174065
468 JGI25406J46586_10002803
469 JGI25165J46597_1007185
470 JGI25153J46596_10000942
471 JGI25153J46596_10003952
472 JGI25160J50197_1021373
473 JGI25404J52841_10017965
474 JGI25404J52841_10033347
475 Ga0055539_1003704
476 Ga0055525_1023824
477 Ga0055542_1005588
478 Ga0055529_1015364
479 Ga0055524_1039661
480 Ga0055531_10028328
481 JGI25405J52794_10105209
482 Ga0055543_1028523
483 Ga0065165_1000626
484 Ga0065165_1090545
485 Ga0065165_1111053
486 Ga0070666_10556068
487 Ga0068868_100461891
488 Ga0070660_100336488
489 Ga0070661_100525325
490 Ga0070659_100331978
491 Ga0070659_101312502
492 Ga0070709_11330024
493 Ga0070714_100946609
494 Ga0070714_101213870
495 Ga0070663_101842377
496 Ga0070706_100753729
497 Ga0070707_100359661
498 Ga0070698_100031559
499 Ga0070684_100217934
500 Ga0070697_100062770
501 Ga0070665_100053221
502 Ga0070665_100385760
503 Ga0070665_101503302
504 Ga0068855_100781831
505 Ga0068856_100586091
506 Ga0068852_100181282
507 Ga0068851_10678326
508 Ga0081455_10004428
509 Ga0081455_10221539
510 Ga0081540_1010797
511 Ga0081540_1016612
512 Ga0081540_1020675
513 Ga0081540_1062882
514 Ga0081540_1091249
515 Ga0081539_10000008
516 Ga0081539_10000319
517 Ga0081539_10382427
518 Ga0075365_10257557
519 Ga0075369_10339650
520 Ga0075366_10848391
521 Ga0075434_100996345
522 Ga0099824_1004477
523 Ga0099794_10117220
524 Ga0099794_10156943
525 Ga0105240_12270315
526 Ga0105245_10797576
527 Ga0105242_11780336
528 Ga0105248_10605860
529 Ga0105248_10688699
530 Ga0105237_10881260
531 Ga0105237_11395066
532 Ga0105237_11624835
533 Ga0105238_11681662
534 Ga0105239_10049581
535 Ga0105239_12397816
536 Ga0157316_1075603
537 Ga0157370_10229248
538 Ga0157370_10253406
539 Ga0157374_10330431
540 Ga0163162_10791335
541 Ga0163162_11489516
542 Ga0157375_10157737
543 Ga0163163_10743009
544 Ga0157380_11310008
545 Ga0157379_12026495
546 Ga0214544_1000020
547 Ga0214544_1029249
548 Ga0214542_1000024
549 Ga0214542_1032278
550 Ga0214545_1000011
551 Ga0214545_1018398
552 Ga0214543_1000033
553 Ga0214543_1032870
554 Ga0214543_1055539
555 Ga0214543_1056318
556 Ga0213876_10123488
557 Ga0213876_10313431
558 Ga0207425_1029407
559 Ga0209026_1042177
560 Ga0209677_101724
561 Ga0209148_1000382
562 Ga0209233_1005509
563 Ga0209233_1006926
564 Ga0209233_1060528
565 Ga0209455_1002055
566 Ga0209564_1057898
567 Ga0209758_1000171
568 Ga0209758_1000484
569 Ga0209256_1014285
570 Ga0207426_1009123
571 Ga0207426_1016635
572 Ga0207426_1043507
573 Ga0209257_1000708
574 Ga0207656_10171819
575 Ga0207680_10499746
576 Ga0207705_10287177
577 Ga0207684_10601165
578 Ga0207654_10988354
579 Ga0207671_11235555
580 Ga0207657_10200194
581 Ga0207646_11184351
582 Ga0207694_10379138
583 Ga0207709_10529068
584 Ga0207665_10240568
585 Ga0207667_11492162
586 Ga0207640_11513575
587 Ga0207678_10428301
588 Ga0207702_10635918
589 Ga0207683_10196753
590 Ga0207698_10302942
591 Ga0207698_11684414
592 Ga0209389_1000127
593 Ga0209589_1000243
594 Ga0209489_102084
595 Ga0209179_1033493
596 Ga0268266_11208049
597 Ga0268266_11694640
598 Ga0307508_10450164
599 Ga0315911_1000011
600 Ga0373932_0058908
601 Ga0373932_0154017
602 Ga0373931_0556525
603 Ga0373933_0106759
604 Ga0373937_0328509
605 Ga0373925_0777731
606 Ga0395900_0053447
607 Ga0395900_0672285
608 Ga0395898_0107605
609 Ga0395905_0165130
610 Ga0436364_0489803
611 Ga0395901_0069235
612 Ga0395901_0398687
613 Ga0395901_0830174
614 Ga0436365_1113156
615 Ga0436360_0230428
616 Ga0436363_0229795
617 Ga0436363_0689700
618 Ga0451793_1382484
619 Ga0451797_0275269
620 Ga0451833_0360950
621 Ga0451853_1517339
622 Ga0451853_2905296
623 Ga0451853_3239765
624 Ga0466972_0001004
625 Ga0466972_0015844
626 Ga0466972_0061482
627 Ga0466972_0230433
628 Ga0466972_0398572
629 Ga0466966_0218851
630 Ga0466961_0240546
631 Ga0466968_0001062
632 Ga0466970_0245804
633 Ga0466960_0046193
634 Ga0466960_0226496
635 Ga0466960_0681403
636 Ga0466959_0602552
637 Ga0466959_0731106
638 Ga0466958_0235485
639 Ga0495592_0057556
640 Ga0495592_0176124
641 Ga0495629_0002828
642 Ga0495629_0624725
643 Ga0495629_0746800
644 Ga0495651_0008596
645 Ga0495651_0090771
646 Ga0495653_0011458
647 Ga0495653_0185221
648 Ga0495582_0236340
649 Ga0495582_0319054
650 Ga0495662_0162971
651 Ga0495664_0012477
652 Ga0495664_0398615
653 Ga0495606_0005836
654 Ga0495606_0301174
655 Ga0495606_0327643
656 Ga0495608_0053059
657 Ga0495608_0215848
658 Ga0495628_0028732
659 Ga0495628_0371465
660 Ga0495628_0469269
661 Ga0495631_0356534
662 Ga0495643_0264194
663 Ga0495652_0017612
664 Ga0495652_0047213
665 Ga0495640_0042188
666 Ga0495640_0049288
667 Ga0495587_0012371
668 Ga0495645_0010840
669 Ga0495667_0182591
670 Ga0495668_0252326
671 Ga0495634_0032773
672 Ga0495634_0168770
673 Ga0495635_0006205
674 Ga0495635_0057731
675 Ga0495588_0571392
676 Ga0495657_0007252
677 Ga0495657_0122016
678 Ga0495599_0002825
679 Ga0495623_0015241
680 Ga0495623_0120798
681 Ga0495646_0033961
682 Ga0495658_0412922
683 Ga0495658_0901156
684 Ga0495613_0307526
685 Ga0495613_0966428
686 Ga0495624_0006049
687 Ga0495624_0135780
688 Ga0495600_0003921
689 Ga0495600_0009380
690 Ga0495581_0488171
691 Ga0495604_0001798
692 Ga0495604_0005861
693 Ga0495604_0565500
694 Ga0495604_0891005
695 Ga0495674_0075485
696 Ga0495676_0115970
697 Ga0495680_0001522
698 Ga0495687_256498
699 Ga0495675_0006723
700 Ga0495675_0096001
701 Ga0495673_0204856
702 Ga0495686_0269560
703 Ga0495686_0270212
704 Ga0495593_0343804
705 Ga0495602_0001750
706 Ga0496100_0130004
707 Ga0496100_0458312
708 Ga0496100_1351394
709 Ga0496101_0998222
710 Ga0496102_0350735
711 Ga0496102_1496975
712 Ga0496103_0279659
713 Ga0496104_0070985
714 Ga0496105_0003799
715 Ga0496106_1022346
716 Ga0496107_0060688
717 Ga0496107_0328977
718 Ga0496107_1081724
719 Ga0496107_1196687
720 Ga0496110_0902303
721 Ga0496112_1186227
722 Ga0496113_0126578
723 Ga0496113_0820226
724 Ga0496114_0184471
725 Ga0496115_0035687
726 Ga0496116_0273289
727 Ga0496118_0075301
728 Ga0496118_0480786
729 Ga0496119_0040474
730 Ga0496120_0006847
731 Ga0496121_0015329
732 Ga0496121_0042723
733 Ga0496123_0320857
734 Ga0496124_0110098
735 Ga0496125_0090769
736 Ga0496125_0115578
737 Ga0496126_0035377
738 Ga0496126_0047160
739 Ga0495682_0251293
740 nmdc:mga0yw44_1574_c1
741 Ga0495601_0156175
742 Ga0495601_0724036
743 Ga0495595_0534216
744 Ga0495619_0094058
745 Ga0500578_0583604
746 Ga0500647_0131523
747 Ga0500651_0297807
748 Ga0500651_0663737
749 Ga0500566_0216271
750 Ga0500557_000039
751 Ga0500569_024014
752 Ga0500595_071203
753 Ga0500607_216300
754 Ga0500614_010764
755 Ga0500626_106357
756 Ga0500559_0103706
757 Ga0500564_389225
758 Ga0500568_0031865
759 Ga0500568_0139330
760 Ga0500590_239414
761 Ga0500619_117876
762 Ga0500620_030811
763 Ga0500638_012325
764 Ga0500638_180100
765 Ga0500639_254469
766 Ga0500639_257607
767 Ga0500637_0054211
768 Ga0500570_085590
769 Ga0500625_191622
770 Ga0500601_001204
771 Ga0500661_008351
772 2507510148
773 2508544150
774 2508697910
775 2511398809
776 2513643864
777 2513660469
778 2513704991
779 2513721795
780 2513858150
781 2513877994
782 2513922261
783 2514017178
784 2515629933
785 2517105208
786 2517893964
787 2524439170
788 2524536230
789 2617352517
790 2617379072
791 2671122947
792 2745078720
793 2793059867
794 2793072788
795 2805919954
796 2824606720
797 2824616391
798 2824624594
799 2824633554
800 2824640482
801 2824648379
802 2824659230
803 2824674481
804 2824683363
805 2824694312
806 2824699569
807 2824712016
808 2824722837
809 2824727698
810 2824740286
811 2824752483
812 2824761345
813 2824771574
814 2824778150
815 2838125690
816 2841941648
817 2841951077
818 2841959349
819 2841974204
820 2841975872
821 2841989270
822 2842038111
823 2842048943
824 2844317611
825 2847944997
826 2849080814
827 2857509828
828 2874593345
829 2874623071
830 2874636172
831 2874652879
832 2876762761
833 2876773385
834 2876821338
835 2879077301
836 2879130141
837 2879146656
838 2881367627
839 2881670732
840 2885368793
841 2885377709
842 2885417471
843 2888422907
844 2903735295
845 2904669890
846 2904705150
847 2904718602
848 2906608791
849 2906610860
850 2906650042
851 2908744369
852 2908778589
853 2922394857
854 2922428467
855 2929616395
856 2929625139
857 2932797211
858 2932804904
859 2933578322
860 2935610950
861 2935634458
862 2935648376
863 2935657636
864 2935691804
865 2935695242
866 2935719872
867 2935729361
868 2935738779
869 2935748036
870 2935756620
871 2935771370
872 2935779058
873 2935788264
874 2935796971
875 2935820435
876 2935849556
877 2935884858
878 2935911671
879 2935919325
880 2935928700
881 2935938345
882 2935945763
883 2935954630
884 2935970517
885 2935979245
886 2935987737
887 2936011286
888 2936019881
889 2936028477
890 2936046604
891 2936062299
892 2940562534
893 2941508944
894 2941516773
895 2941525132
896 2941536270
897 3005478588
898 3005487820
899 3005508868
900 3005589322
901 8006930796
902 8006942773
903 8006982495
904 8016523019
905 8016536481
906 8016540762
907 8016552480
908 8016560862
909 8016574842
910 8016578916
911 8016598734
912 8016612351
913 8016621456
914 8016628502
915 8019536199
916 8019543265
917 8019555585
918 8019558529
919 8019566773
920 8019626389
921 8019636103
922 8019643563
923 8019656359
924 8019663872
925 8019673501
926 8019682629
927 8019688313
928 8055748041
929 8056685222
930 8056969415

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f47-assembly1.cif.gz_A cryo-em structure of rhizobium etli mprf 0.6741 7 70
3hug-assembly6.cif.gz_M crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.6435 7 58
3hug-assembly2.cif.gz_E crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.642 7 58
1l6t-assembly1.cif.gz_A structure of ala24/asp61 to asp24/asn61 substituted subunit c of escherichia coli atp synthase 0.6408 7 63
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.6262 10 56
ID Description Score Start End Superfamily
af_Q2FUR7_14_86_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.794 9 59 1.10.287.3510
af_P41732_1_110_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.6891 7 93 1.20.5.110
af_Q1MTA6_1_104_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.6694 5 95 1.20.120.350
af_O74820_11_117_3.40.50.11000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Fe-S cluster assembly protein Dre2, N-terminal domain 0.6456 6 90 3.40.50.11000
3hugI00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.6437 7 58 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7K2QJX1-F1-model_v4 MFS transporter 0.9185 7 77 GO:0016020
AF-A0A3L8Q3S9-F1-model_v4 Uncharacterized protein 0.9045 5 79 GO:0016020
AF-A0A3L8Q3S9-F1-model_v4 Uncharacterized protein 0.883 5 79 GO:0016020
AF-A0A3B9ATH0-F1-model_v4 Uncharacterized protein 0.8817 7 83 GO:0016020
AF-A0A059W0K0-F1-model_v4 deleted 0.881 8 89

Map