F449462

General Info

Members Datasets Scaffolds Average Seq Length
465 225 930 313

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100246090|Ga0075429_1002460902
Length 317
Sequence MLIAFLAFLVVTGVVAGLGFGALRLPGTLADRRMERRLREVSHREDDDRPTSFIRDKKAGPLPALDRALGGSSSLSRLVEQSGVATTPSTIVLASLGLAVLLAAGTLIFVRQPFAWLVGGLVGLMLPYGFLRHRRNARMKRFEEQFPEALDLLSRAIRAGHAFQTAMGMCADELPAPVGIEFRKSFDQQNFGLPLKDALNELAERVPILDVKFFVTAVLIQRETGGNLAEILDNLAHVVRERFKILRQVRVHTAHGRFTGYVLLALPAALAVALMFINPEHMNLLFEEKIGQMMIVGCIVMQAVGFIWIKKIVKIEV

Samples

Sample ID Description Type Environment
1 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
140 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
152 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
155 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
205 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
206 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
223 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.37
Nodule 0
Rhizoplane 7.53
Rhizosphere 89.89
Stem 0
Stem Tuber 0
Unclassified 2.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075429_100246090 3300006880 Bacteria 1566
2 JGI24743J22301_10007288 3300001991 Bacteria 1913
3 Ga0065712_10071029 3300005290 Bacteria 5534
4 Ga0065712_10088696 3300005290 Bacteria 2504
5 Ga0065712_10089481 3300005290 Bacteria 2468
6 Ga0065712_10107319 3300005290 Bacteria 1897
7 Ga0065715_10001031 3300005293 Bacteria 7831
8 Ga0065715_10003607 3300005293 Bacteria 5628
9 Ga0065715_10007509 3300005293 Bacteria 4762
10 Ga0065715_10090946 3300005293 Bacteria 6290
11 Ga0065715_10095903 3300005293 Bacteria 3983
12 Ga0065707_10009804 3300005295 Bacteria 2265
13 Ga0070683_100009892 3300005329 Bacteria 8173
14 Ga0070683_100054942 3300005329 Bacteria 3694
15 Ga0070683_100232907 3300005329 Bacteria 1751
16 Ga0070683_100355951 3300005329 Bacteria 1394
17 Ga0070690_100091086 3300005330 Bacteria 2008
18 Ga0070670_100001015 3300005331 Bacteria 22158
19 Ga0070670_100001833 3300005331 Bacteria 17306
20 Ga0070670_100009927 3300005331 Bacteria 8127
21 Ga0070670_100012572 3300005331 Bacteria 7247
22 Ga0070670_100030157 3300005331 Bacteria 4670
23 Ga0070677_10026666 3300005333 Bacteria 2169
24 Ga0068869_100173109 3300005334 Bacteria 1688
25 Ga0070666_10096435 3300005335 Bacteria 2035
26 Ga0070666_10115242 3300005335 Bacteria 1861
27 Ga0070666_10279268 3300005335 Bacteria 1187
28 Ga0070682_100304441 3300005337 Bacteria 1171
29 Ga0070660_100062795 3300005339 Bacteria 2887
30 Ga0070660_100099940 3300005339 Bacteria 2297
31 Ga0070660_100228106 3300005339 Bacteria 1515
32 Ga0070689_100025281 3300005340 Bacteria 4460
33 Ga0070689_100029122 3300005340 Bacteria 4177
34 Ga0070687_100021144 3300005343 Bacteria 3053
35 Ga0070687_100070677 3300005343 Bacteria 1873
36 Ga0070661_100039017 3300005344 Bacteria 3459
37 Ga0070692_10009455 3300005345 Bacteria 4397
38 Ga0070668_100101100 3300005347 Bacteria 2284
39 Ga0070675_100093486 3300005354 Bacteria 2522
40 Ga0070675_100315784 3300005354 Bacteria 1379
41 Ga0070671_100012161 3300005355 Bacteria 6927
42 Ga0070674_100051004 3300005356 Bacteria 2849
43 Ga0070674_100156709 3300005356 Bacteria 1724
44 Ga0070673_100005413 3300005364 Bacteria 8167
45 Ga0070673_100013735 3300005364 Bacteria 5615
46 Ga0070673_100070227 3300005364 Bacteria 2810
47 Ga0070673_100258661 3300005364 Bacteria 1520
48 Ga0070688_100009095 3300005365 Bacteria 5417
49 Ga0070659_100060181 3300005366 Bacteria 3000
50 Ga0070659_100128794 3300005366 Bacteria 2054
51 Ga0070667_100049870 3300005367 Bacteria 3527
52 Ga0070667_100366528 3300005367 Bacteria 1306
53 Ga0070705_100072092 3300005440 Bacteria 2091
54 Ga0070700_100069079 3300005441 Bacteria 2248
55 Ga0070678_100169481 3300005456 Bacteria 1777
56 Ga0070681_10119956 3300005458 Bacteria 2565
57 Ga0070681_10123235 3300005458 Bacteria 2525
58 Ga0068867_100222763 3300005459 Bacteria 1521
59 Ga0070698_100408204 3300005471 Bacteria 1292
60 Ga0070699_100048923 3300005518 Bacteria 3659
61 Ga0070699_100185885 3300005518 Bacteria 1845
62 Ga0070679_100040719 3300005530 Bacteria 4622
63 Ga0070679_100389009 3300005530 Unclassified 1341
64 Ga0070679_100398071 3300005530 Bacteria 1323
65 Ga0070684_100039030 3300005535 Bacteria 4083
66 Ga0070684_100131830 3300005535 Bacteria 2255
67 Ga0070697_100378420 3300005536 Bacteria 1226
68 Ga0070672_100030719 3300005543 Bacteria 4039
69 Ga0070686_100051278 3300005544 Bacteria 2626
70 Ga0070686_100136331 3300005544 Bacteria 1703
71 Ga0070696_100227947 3300005546 Bacteria 1401
72 Ga0070693_100037545 3300005547 Bacteria 2702
73 Ga0070693_100127525 3300005547 Bacteria 1586
74 Ga0070665_100008638 3300005548 Bacteria 10309
75 Ga0068855_100031521 3300005563 Bacteria 6330
76 Ga0070664_100018870 3300005564 Bacteria 5669
77 Ga0070664_100025568 3300005564 Bacteria 4896
78 Ga0070664_100062565 3300005564 Bacteria 3173
79 Ga0070664_100118403 3300005564 Bacteria 2317
80 Ga0070664_100163177 3300005564 Bacteria 1973
81 Ga0068857_100050923 3300005577 Bacteria 3673
82 Ga0068854_100114229 3300005578 Bacteria 2041
83 Ga0068854_100228856 3300005578 Bacteria 1475
84 Ga0068856_100065904 3300005614 Bacteria 3579
85 Ga0070702_100011976 3300005615 Bacteria 4330
86 Ga0068852_100034790 3300005616 Bacteria 4195
87 Ga0068852_100248119 3300005616 Bacteria 1704
88 Ga0068852_100330049 3300005616 Bacteria 1484
89 Ga0068859_100065424 3300005617 Bacteria 3670
90 Ga0068859_100066465 3300005617 Bacteria 3640
91 Ga0068859_100125479 3300005617 Bacteria 2636
92 Ga0068859_100189925 3300005617 Bacteria 2138
93 Ga0068864_100007441 3300005618 Bacteria 9016
94 Ga0068864_100037148 3300005618 Bacteria 4155
95 Ga0068870_10087402 3300005840 Bacteria 1736
96 Ga0068870_10164148 3300005840 Bacteria 1320
97 Ga0068863_100015152 3300005841 Bacteria 7406
98 Ga0068863_100152471 3300005841 Bacteria 2212
99 Ga0068858_100220438 3300005842 Bacteria 1796
100 Ga0068862_100038383 3300005844 Bacteria 4062
101 Ga0068862_100277027 3300005844 Unclassified 1536
102 Ga0068862_100571261 3300005844 Bacteria 1082
103 Ga0075365_10011444 3300006038 Bacteria 5216
104 Ga0075364_10059903 3300006051 Bacteria 2496
105 Ga0075364_10124420 3300006051 Bacteria 1728
106 Ga0075362_10014590 3300006177 Bacteria 3174
107 Ga0097621_100009175 3300006237 Bacteria 7170
108 Ga0075370_10001536 3300006353 Bacteria 10094
109 Ga0068871_100210886 3300006358 Bacteria 1680
110 Ga0068871_100484383 3300006358 Bacteria 1113
111 Ga0075428_100000856 3300006844 Bacteria 32001
112 Ga0075428_100015955 3300006844 Bacteria 8312
113 Ga0075428_100026781 3300006844 Bacteria 6385
114 Ga0075428_100035381 3300006844 Bacteria 5505
115 Ga0075428_100125684 3300006844 Bacteria 2791
116 Ga0075430_100000214 3300006846 Bacteria 39791
117 Ga0075430_100001294 3300006846 Bacteria 20188
118 Ga0075430_100010033 3300006846 Bacteria 8014
119 Ga0075430_100016731 3300006846 Bacteria 6246
120 Ga0075431_100015995 3300006847 Bacteria 7612
121 Ga0075431_100022945 3300006847 Bacteria 6379
122 Ga0075431_100037503 3300006847 Bacteria 4993
123 Ga0075431_100084417 3300006847 Bacteria 3278
124 Ga0075431_100097894 3300006847 Bacteria 3029
125 Ga0075433_10114498 3300006852 Bacteria 2392
126 Ga0075434_100002772 3300006871 Bacteria 15506
127 Ga0075434_100141281 3300006871 Bacteria 2428
128 Ga0075434_100241135 3300006871 Bacteria 1828
129 Ga0075434_100620680 3300006871 Bacteria 1100
130 Ga0075429_100017456 3300006880 Bacteria 6205
131 Ga0068865_100186310 3300006881 Bacteria 1601
132 Ga0075436_100037825 3300006914 Bacteria 3332
133 Ga0097620_100065424 3300006931 Bacteria 3670
134 Ga0097620_100066463 3300006931 Bacteria 3640
135 Ga0097620_100125471 3300006931 Bacteria 2636
136 Ga0097620_100189914 3300006931 Bacteria 2138
137 Ga0075435_100004425 3300007076 Bacteria 9646
138 Ga0075435_100110603 3300007076 Bacteria 2285
139 Ga0105240_10092439 3300009093 Bacteria 3694
140 Ga0111539_10003233 3300009094 Bacteria 21543
141 Ga0111539_10021013 3300009094 Bacteria 8039
142 Ga0111539_10038052 3300009094 Bacteria 5804
143 Ga0111539_10189122 3300009094 Bacteria 2403
144 Ga0111539_10297244 3300009094 Bacteria 1879
145 Ga0111539_10374203 3300009094 Bacteria 1658
146 Ga0105245_10039885 3300009098 Bacteria 4181
147 Ga0105245_10048265 3300009098 Bacteria 3808
148 Ga0114129_10000171 3300009147 Bacteria 70782
149 Ga0114129_10002879 3300009147 Bacteria 24086
150 Ga0114129_10009284 3300009147 Bacteria 14024
151 Ga0114129_10011026 3300009147 Bacteria 12877
152 Ga0114129_10033468 3300009147 Bacteria 7264
153 Ga0114129_10085315 3300009147 Bacteria 4381
154 Ga0114129_10087224 3300009147 Bacteria 4328
155 Ga0114129_10196624 3300009147 Bacteria 2734
156 Ga0114129_10313066 3300009147 Bacteria 2089
157 Ga0105243_10175257 3300009148 Bacteria 1861
158 Ga0105243_10179054 3300009148 Bacteria 1842
159 Ga0105241_10069632 3300009174 Bacteria 2728
160 Ga0105248_10003756 3300009177 Bacteria 16830
161 Ga0105248_10055427 3300009177 Bacteria 4446
162 Ga0105248_10068335 3300009177 Bacteria 3989
163 Ga0105248_10081011 3300009177 Bacteria 3649
164 Ga0105248_10098232 3300009177 Bacteria 3299
165 Ga0105248_10626829 3300009177 Bacteria 1213
166 Ga0105249_10008788 3300009553 Bacteria 8817
167 Ga0157370_10085788 3300013104 Bacteria 2958
168 Ga0157374_10020958 3300013296 Bacteria 5808
169 Ga0157374_10101689 3300013296 Bacteria 2756
170 Ga0157374_10119850 3300013296 Bacteria 2538
171 Ga0157378_10412464 3300013297 Unclassified 1333
172 Ga0163162_10068560 3300013306 Bacteria 3599
173 Ga0163162_10089617 3300013306 Bacteria 3157
174 Ga0157375_10144701 3300013308 Bacteria 2507
175 Ga0157375_10180668 3300013308 Bacteria 2261
176 Ga0163163_10078897 3300014325 Bacteria 3290
177 Ga0163163_10144572 3300014325 Bacteria 2421
178 Ga0163163_10232439 3300014325 Bacteria 1893
179 Ga0163163_10237744 3300014325 Bacteria 1871
180 Ga0157380_10307918 3300014326 Bacteria 1462
181 Ga0157376_10212750 3300014969 Bacteria 1786
182 Ga0157376_10536035 3300014969 Bacteria 1156
183 Ga0163161_10144543 3300017792 Bacteria 1803
184 Ga0213876_10082561 3300021384 Bacteria 1700
185 Ga0207697_10001902 3300025315 Bacteria 11133
186 Ga0207697_10018192 3300025315 Bacteria 2882
187 Ga0207642_10070095 3300025899 Bacteria 1665
188 Ga0207688_10028090 3300025901 Bacteria 3096
189 Ga0207680_10052303 3300025903 Bacteria 2447
190 Ga0207645_10016616 3300025907 Bacteria 4868
191 Ga0207645_10196368 3300025907 Bacteria 1327
192 Ga0207684_10250139 3300025910 Bacteria 1529
193 Ga0207684_10316148 3300025910 Bacteria 1346
194 Ga0207707_10171452 3300025912 Bacteria 1896
195 Ga0207707_10207499 3300025912 Bacteria 1707
196 Ga0207695_10066043 3300025913 Bacteria 3717
197 Ga0207660_10277505 3300025917 Bacteria 1329
198 Ga0207662_10175640 3300025918 Bacteria 1376
199 Ga0207657_10011433 3300025919 Bacteria 8812
200 Ga0207649_10075207 3300025920 Bacteria 2170
201 Ga0207652_10018314 3300025921 Bacteria 5743
202 Ga0207694_10311061 3300025924 Bacteria 1299
203 Ga0207650_10002628 3300025925 Bacteria 12429
204 Ga0207650_10004690 3300025925 Bacteria 9340
205 Ga0207650_10015559 3300025925 Bacteria 5300
206 Ga0207650_10069579 3300025925 Bacteria 2644
207 Ga0207659_10086627 3300025926 Bacteria 2330
208 Ga0207659_10172023 3300025926 Bacteria 1709
209 Ga0207687_10027394 3300025927 Bacteria 3823
210 Ga0207644_10024141 3300025931 Bacteria 4171
211 Ga0207690_10088391 3300025932 Bacteria 2183
212 Ga0207690_10096190 3300025932 Bacteria 2105
213 Ga0207690_10108462 3300025932 Bacteria 1995
214 Ga0207706_10028642 3300025933 Bacteria 4974
215 Ga0207706_10172234 3300025933 Bacteria 1902
216 Ga0207686_10029065 3300025934 Bacteria 3257
217 Ga0207686_10127936 3300025934 Bacteria 1738
218 Ga0207709_10124223 3300025935 Bacteria 1748
219 Ga0207669_10064601 3300025937 Bacteria 2266
220 Ga0207669_10092757 3300025937 Bacteria 1971
221 Ga0207669_10416675 3300025937 Bacteria 1056
222 Ga0207691_10018285 3300025940 Bacteria 6639
223 Ga0207711_10008567 3300025941 Bacteria 8555
224 Ga0207711_10031590 3300025941 Bacteria 4471
225 Ga0207711_10062657 3300025941 Bacteria 3208
226 Ga0207711_10158128 3300025941 Bacteria 2049
227 Ga0207689_10132790 3300025942 Bacteria 2049
228 Ga0207661_10134312 3300025944 Bacteria 2124
229 Ga0207679_10093033 3300025945 Bacteria 2337
230 Ga0207679_10135718 3300025945 Bacteria 1981
231 Ga0207679_10240701 3300025945 Bacteria 1533
232 Ga0207651_10035443 3300025960 Bacteria 3245
233 Ga0207651_10057231 3300025960 Bacteria 2688
234 Ga0207651_10097479 3300025960 Bacteria 2171
235 Ga0207712_10026445 3300025961 Bacteria 3866
236 Ga0207712_10042456 3300025961 Bacteria 3131
237 Ga0207640_10094334 3300025981 Bacteria 2081
238 Ga0207640_10168235 3300025981 Bacteria 1630
239 Ga0207658_10283464 3300025986 Bacteria 1421
240 Ga0207703_10127851 3300026035 Bacteria 2190
241 Ga0207708_10148643 3300026075 Bacteria 1842
242 Ga0207641_10299378 3300026088 Bacteria 1519
243 Ga0207648_10000709 3300026089 Bacteria 37371
244 Ga0207648_10274940 3300026089 Bacteria 1505
245 Ga0207676_10009849 3300026095 Bacteria 6799
246 Ga0207676_10037756 3300026095 Bacteria 3683
247 Ga0207675_100012864 3300026118 Bacteria 7816
248 Ga0207683_10054319 3300026121 Bacteria 3513
249 Ga0207683_10068062 3300026121 Bacteria 3142
250 Ga0207683_10108733 3300026121 Bacteria 2481
251 Ga0207683_10133093 3300026121 Bacteria 2237
252 Ga0207683_10133178 3300026121 Bacteria 2236
253 Ga0207698_10030561 3300026142 Bacteria 3876
254 Ga0207428_10000864 3300027907 Bacteria 34135
255 Ga0207428_10002617 3300027907 Bacteria 17956
256 Ga0207428_10031001 3300027907 Bacteria 4417
257 Ga0268265_10010415 3300028380 Bacteria 6280
258 Ga0268265_10305054 3300028380 Unclassified 1435
259 Ga0268265_10358387 3300028380 Bacteria 1334
260 Ga0307408_100010451 3300031548 Bacteria 6121
261 Ga0307408_100030037 3300031548 Bacteria 3771
262 Ga0307408_100083489 3300031548 Bacteria 2394
263 Ga0307405_10045035 3300031731 Bacteria 2701
264 Ga0307413_10006573 3300031824 Bacteria 5325
265 Ga0307413_10032703 3300031824 Bacteria 2952
266 Ga0307410_10033343 3300031852 Bacteria 3324
267 Ga0307410_10352910 3300031852 Bacteria 1176
268 Ga0307412_10206966 3300031911 Bacteria 1494
269 Ga0307412_10253323 3300031911 Unclassified 1368
270 Ga0307409_100046491 3300031995 Bacteria 3286
271 Ga0307409_100079246 3300031995 Bacteria 2646
272 Ga0307409_100086384 3300031995 Unclassified 2553
273 Ga0307416_100013492 3300032002 Bacteria 5557
274 Ga0307416_100027310 3300032002 Bacteria 4224
275 Ga0307414_10031673 3300032004 Bacteria 3472
276 Ga0307414_10269156 3300032004 Bacteria 1426
277 Ga0307414_10496772 3300032004 Bacteria 1079
278 Ga0307411_10007408 3300032005 Bacteria 5589
279 Ga0307411_10017823 3300032005 Bacteria 4059
280 Ga0307411_10297081 3300032005 Bacteria 1293
281 Ga0307411_10305523 3300032005 Unclassified 1278
282 Ga0307415_100023575 3300032126 Bacteria 3823
283 Ga0373938_0040291 3300034957 Bacteria 1036
284 Ga0373936_0015032 3300035113 Bacteria 2964
285 Ga0373945_0041903 3300035116 Bacteria 1657
286 Ga0373943_0023093 3300035170 Bacteria 2889
287 Ga0373955_0067486 3300035172 Bacteria 1991
288 Ga0373924_0013121 3300035410 Bacteria 3109
289 Ga0373935_0012540 3300035692 Bacteria 5099
290 Ga0373927_0092231 3300035695 Bacteria 1968
291 Ga0373947_0018984 3300035725 Bacteria 3962
292 Ga0373925_0004437 3300037068 Bacteria 10602
293 Ga0373925_0062348 3300037068 Bacteria 2803
294 Ga0439433_0038801 3300041999 Bacteria 1105
295 Ga0439449_0012867 3300042007 Bacteria 3146
296 Ga0450923_000398 3300042125 Bacteria 4638
297 Ga0450896_001512 3300042133 Bacteria 2879
298 Ga0439446_0007085 3300042156 Bacteria 2939
299 Ga0439446_0014104 3300042156 Bacteria 2202
300 Ga0439446_0039330 3300042156 Bacteria 1389
301 Ga0439435_0009561 3300042436 Bacteria 2278
302 Ga0439435_0075258 3300042436 Bacteria 1005
303 Ga0439464_0000652 3300042439 Bacteria 7413
304 Ga0495603_0088869 3300046455 Bacteria 1808
305 Ga0495629_0267800 3300046459 Bacteria 1174
306 Ga0495618_0363007 3300046514 Bacteria 891
307 Ga0495635_0132373 3300046663 Bacteria 1700
308 Ga0495659_0011642 3300046664 Bacteria 2834
309 Ga0495647_0081112 3300046681 Unclassified 1316
310 Ga0495674_0038802 3300047319 Bacteria 4273
311 Ga0495680_0061742 3300047322 Bacteria 2882
312 Ga0495684_0070794 3300047471 Bacteria 2651
313 Ga0496101_0073926 3300048904 Bacteria 2505
314 Ga0496101_0074961 3300048904 Bacteria 2490
315 Ga0496102_0057138 3300048905 Bacteria 3562
316 Ga0496102_0189768 3300048905 Bacteria 1936
317 Ga0496104_0002365 3300048907 Bacteria 16293
318 Ga0496104_0005233 3300048907 Bacteria 11342
319 Ga0496104_0015062 3300048907 Bacteria 6999
320 Ga0496104_0139227 3300048907 Bacteria 2332
321 Ga0496105_0006404 3300048908 Bacteria 9049
322 Ga0496105_0044674 3300048908 Bacteria 3655
323 Ga0496106_0027282 3300048909 Bacteria 4253
324 Ga0496106_0058634 3300048909 Bacteria 2915
325 Ga0496106_0079522 3300048909 Bacteria 2517
326 Ga0496106_0165080 3300048909 Bacteria 1752
327 Ga0496107_0170123 3300048910 Bacteria 1617
328 Ga0496108_0041855 3300048911 Bacteria 3825
329 Ga0496108_0044684 3300048911 Bacteria 3698
330 Ga0496109_0001246 3300048912 Bacteria 21103
331 Ga0496109_0009063 3300048912 Bacteria 8475
332 Ga0496109_0070963 3300048912 Bacteria 3197
333 Ga0496109_0174593 3300048912 Bacteria 2017
334 Ga0496110_0002416 3300048913 Bacteria 13982
335 Ga0496110_0049029 3300048913 Bacteria 3703
336 Ga0496110_0055936 3300048913 Bacteria 3472
337 Ga0496110_0235937 3300048913 Bacteria 1664
338 Ga0496111_0007202 3300048914 Bacteria 7273
339 Ga0496111_0033549 3300048914 Bacteria 3662
340 Ga0496112_0000287 3300048915 Bacteria 32756
341 Ga0496112_0023492 3300048915 Bacteria 5892
342 Ga0496112_0079806 3300048915 Bacteria 3237
343 Ga0496113_0011533 3300048916 Bacteria 5903
344 Ga0496113_0026926 3300048916 Bacteria 4116
345 Ga0496113_0092296 3300048916 Bacteria 2335
346 Ga0496114_0009075 3300048917 Bacteria 7887
347 Ga0496114_0013501 3300048917 Bacteria 6550
348 Ga0501299_002788 3300049522 Bacteria 2461
349 Ga0501031_0256350 3300049568 Unclassified 1137
350 Ga0501034_0019944 3300049571 Bacteria 6846
351 Ga0501034_0072072 3300049571 Bacteria 3464
352 Ga0501036_0016991 3300049572 Bacteria 6080
353 Ga0501036_0036356 3300049572 Bacteria 4168
354 Ga0501036_0043565 3300049572 Bacteria 3801
355 Ga0501037_0066530 3300049573 Bacteria 2625
356 Ga0501038_0074269 3300049574 Bacteria 2877
357 Ga0501038_0137251 3300049574 Bacteria 2003
358 Ga0501038_0221625 3300049574 Bacteria 1509
359 Ga0501039_0013386 3300049575 Bacteria 6270
360 Ga0501039_0049098 3300049575 Bacteria 3262
361 Ga0501039_0067415 3300049575 Bacteria 2779
362 Ga0501040_0000870 3300049576 Bacteria 18929
363 Ga0501040_0005160 3300049576 Bacteria 8450
364 Ga0501041_0024312 3300049577 Bacteria 3636
365 Ga0501042_0000759 3300049578 Bacteria 17550
366 Ga0501042_0032469 3300049578 Bacteria 3697
367 Ga0501046_0034462 3300049580 Bacteria 4085
368 Ga0501046_0053950 3300049580 Bacteria 3164
369 Ga0501046_0064925 3300049580 Bacteria 2848
370 Ga0501048_0003993 3300049582 Bacteria 11202
371 Ga0501048_0214012 3300049582 Bacteria 1366
372 Ga0501068_0003912 3300049584 Bacteria 8096
373 Ga0501069_0061638 3300049585 Bacteria 2095
374 Ga0501069_0136093 3300049585 Bacteria 1408
375 Ga0501071_0012747 3300049587 Bacteria 5715
376 Ga0501071_0042973 3300049587 Bacteria 3239
377 Ga0501071_0190432 3300049587 Unclassified 1538
378 Ga0501071_0298905 3300049587 Bacteria 1220
379 Ga0501072_0018514 3300049588 Bacteria 5365
380 Ga0501072_0027587 3300049588 Bacteria 4429
381 Ga0501072_0063718 3300049588 Bacteria 2908
382 Ga0501072_0076042 3300049588 Bacteria 2656
383 Ga0501072_0086038 3300049588 Bacteria 2494
384 Ga0501072_0529769 3300049588 Bacteria 931
385 Ga0501073_0056444 3300049589 Bacteria 2747
386 Ga0501073_0131459 3300049589 Bacteria 1735
387 Ga0501075_0002493 3300049591 Bacteria 12271
388 Ga0501075_0011089 3300049591 Bacteria 6364
389 Ga0501075_0013285 3300049591 Bacteria 5875
390 Ga0501075_0022383 3300049591 Bacteria 4616
391 Ga0501076_0009546 3300049592 Bacteria 7162
392 Ga0501076_0010762 3300049592 Bacteria 6799
393 Ga0501076_0025345 3300049592 Bacteria 4589
394 Ga0501076_0101501 3300049592 Bacteria 2319
395 Ga0501076_0142528 3300049592 Bacteria 1947
396 Ga0501077_0006259 3300049593 Bacteria 7279
397 Ga0501079_0011355 3300049741 Bacteria 6796
398 Ga0501079_0031213 3300049741 Bacteria 4095
399 Ga0501079_0064524 3300049741 Bacteria 2825
400 Ga0501079_0068216 3300049741 Bacteria 2745
401 Ga0501079_0110155 3300049741 Bacteria 2139
402 Ga0501079_0304509 3300049741 Bacteria 1247
403 Ga0501080_0172796 3300049742 Bacteria 1992
404 Ga0501081_0001431 3300049743 Bacteria 14594
405 Ga0501081_0012838 3300049743 Bacteria 5507
406 Ga0501081_0173360 3300049743 Bacteria 1558
407 Ga0501045_0000552 3300049824 Bacteria 23478
408 Ga0501045_0017969 3300049824 Bacteria 5022
409 Ga0501045_0021429 3300049824 Bacteria 4623
410 Ga0501045_0052968 3300049824 Bacteria 2964
411 Ga0501045_0069858 3300049824 Bacteria 2583
412 Ga0501045_0281676 3300049824 Unclassified 1238
413 nmdc:mga03683_367_c1 3300050489 Bacteria 13025
414 nmdc:mga00v17_3748_c1 3300050491 Bacteria 7847
415 nmdc:mga0yw44_84534_c1 3300050492 Bacteria 1995
416 nmdc:mga06z11_5106_c1 3300050494 Bacteria 5233
417 nmdc:mga04h51_1638_c1 3300050495 Bacteria 5224
418 nmdc:mga07m45_3284_c1 3300050496 Bacteria 7780
419 nmdc:mga05p37_1009_c1 3300050507 Bacteria 32067
420 nmdc:mga05p37_103885_c1 3300050507 Bacteria 3496
421 nmdc:mga05p37_192186_c1 3300050507 Bacteria 2477
422 nmdc:mga05p37_278565_c1 3300050507 Bacteria 1995
423 nmdc:mga05p37_2979_c1 3300050507 Bacteria 19674
424 nmdc:mga05p37_425749_c1 3300050507 Unclassified 1544
425 nmdc:mga05p37_48294_c1 3300050507 Bacteria 5235
426 nmdc:mga05p37_9128_c1 3300050507 Bacteria 11722
427 nmdc:mga09592_318046_c1 3300050508 Unclassified 1349
428 nmdc:mga0qj67_103594_c1 3300050509 Bacteria 2296
429 nmdc:mga0qj67_11113_c1 3300050509 Bacteria 6743
430 nmdc:mga0qj67_1218_c1 3300050509 Bacteria 17904
431 nmdc:mga0qj67_24631_c1 3300050509 Bacteria 4642
432 nmdc:mga0qj67_5439_c1 3300050509 Bacteria 9304
433 nmdc:mga06r32_20077_c1 3300050510 Bacteria 6145
434 nmdc:mga06r32_28239_c1 3300050510 Bacteria 5246
435 nmdc:mga06r32_3672_c1 3300050510 Bacteria 13707
436 nmdc:mga06r32_516602_c1 3300050510 Bacteria 1170
437 nmdc:mga06r32_616353_c1 3300050510 Bacteria 1055
438 nmdc:mga06r32_63360_c1 3300050510 Bacteria 3563
439 nmdc:mga08y16_19705_c1 3300050511 Bacteria 7112
440 nmdc:mga08y16_240554_c1 3300050511 Bacteria 1871
441 nmdc:mga08y16_24508_c1 3300050511 Bacteria 6367
442 nmdc:mga08y16_28403_c1 3300050511 Bacteria 5898
443 nmdc:mga08y16_462421_c1 3300050511 Bacteria 1293
444 nmdc:mga0n895_30920_c1 3300050512 Bacteria 5121
445 nmdc:mga0rr50_1277_c1 3300050513 Bacteria 13717
446 nmdc:mga0rr50_131919_c1 3300050513 Bacteria 2001
447 nmdc:mga0rr50_186234_c1 3300050513 Bacteria 1699
448 nmdc:mga08x19_109614_c1 3300050514 Bacteria 1840
449 nmdc:mga0a205_104667_c1 3300050515 Bacteria 2729
450 nmdc:mga0a205_62718_c1 3300050515 Bacteria 3591
451 Ga0495601_0068452 3300053077 Bacteria 2263
452 Ga0495612_0051311 3300053078 Bacteria 1695
453 Ga0495619_0046720 3300053085 Bacteria 2848
454 Ga0501084_0006790 3300054114 Bacteria 9411
455 Ga0501084_0029334 3300054114 Bacteria 4602
456 Ga0501084_0061119 3300054114 Bacteria 3154
457 Ga0501084_0064925 3300054114 Bacteria 3054
458 Ga0501084_0070132 3300054114 Bacteria 2935
459 Ga0590071_000149 3300059421 Bacteria 20050
460 Ga0590075_000328 3300059424 Bacteria 13181
461 Ga0590077_000260 3300059426 Bacteria 15106
462 Ga0501082_0001320 3300060353 Bacteria 21709
463 Ga0530510_0004538 3300061734 Bacteria 9611
464 Ga0530510_0030275 3300061734 Bacteria 3887
465 Ga0530510_0036543 3300061734 Bacteria 3540
466 Ga0075429_100246090
467 JGI24743J22301_10007288
468 Ga0065712_10071029
469 Ga0065712_10088696
470 Ga0065712_10089481
471 Ga0065712_10107319
472 Ga0065715_10001031
473 Ga0065715_10003607
474 Ga0065715_10007509
475 Ga0065715_10090946
476 Ga0065715_10095903
477 Ga0065707_10009804
478 Ga0070683_100009892
479 Ga0070683_100054942
480 Ga0070683_100232907
481 Ga0070683_100355951
482 Ga0070690_100091086
483 Ga0070670_100001015
484 Ga0070670_100001833
485 Ga0070670_100009927
486 Ga0070670_100012572
487 Ga0070670_100030157
488 Ga0070677_10026666
489 Ga0068869_100173109
490 Ga0070666_10096435
491 Ga0070666_10115242
492 Ga0070666_10279268
493 Ga0070682_100304441
494 Ga0070660_100062795
495 Ga0070660_100099940
496 Ga0070660_100228106
497 Ga0070689_100025281
498 Ga0070689_100029122
499 Ga0070687_100021144
500 Ga0070687_100070677
501 Ga0070661_100039017
502 Ga0070692_10009455
503 Ga0070668_100101100
504 Ga0070675_100093486
505 Ga0070675_100315784
506 Ga0070671_100012161
507 Ga0070674_100051004
508 Ga0070674_100156709
509 Ga0070673_100005413
510 Ga0070673_100013735
511 Ga0070673_100070227
512 Ga0070673_100258661
513 Ga0070688_100009095
514 Ga0070659_100060181
515 Ga0070659_100128794
516 Ga0070667_100049870
517 Ga0070667_100366528
518 Ga0070705_100072092
519 Ga0070700_100069079
520 Ga0070678_100169481
521 Ga0070681_10119956
522 Ga0070681_10123235
523 Ga0068867_100222763
524 Ga0070698_100408204
525 Ga0070699_100048923
526 Ga0070699_100185885
527 Ga0070679_100040719
528 Ga0070679_100389009
529 Ga0070679_100398071
530 Ga0070684_100039030
531 Ga0070684_100131830
532 Ga0070697_100378420
533 Ga0070672_100030719
534 Ga0070686_100051278
535 Ga0070686_100136331
536 Ga0070696_100227947
537 Ga0070693_100037545
538 Ga0070693_100127525
539 Ga0070665_100008638
540 Ga0068855_100031521
541 Ga0070664_100018870
542 Ga0070664_100025568
543 Ga0070664_100062565
544 Ga0070664_100118403
545 Ga0070664_100163177
546 Ga0068857_100050923
547 Ga0068854_100114229
548 Ga0068854_100228856
549 Ga0068856_100065904
550 Ga0070702_100011976
551 Ga0068852_100034790
552 Ga0068852_100248119
553 Ga0068852_100330049
554 Ga0068859_100065424
555 Ga0068859_100066465
556 Ga0068859_100125479
557 Ga0068859_100189925
558 Ga0068864_100007441
559 Ga0068864_100037148
560 Ga0068870_10087402
561 Ga0068870_10164148
562 Ga0068863_100015152
563 Ga0068863_100152471
564 Ga0068858_100220438
565 Ga0068862_100038383
566 Ga0068862_100277027
567 Ga0068862_100571261
568 Ga0075365_10011444
569 Ga0075364_10059903
570 Ga0075364_10124420
571 Ga0075362_10014590
572 Ga0097621_100009175
573 Ga0075370_10001536
574 Ga0068871_100210886
575 Ga0068871_100484383
576 Ga0075428_100000856
577 Ga0075428_100015955
578 Ga0075428_100026781
579 Ga0075428_100035381
580 Ga0075428_100125684
581 Ga0075430_100000214
582 Ga0075430_100001294
583 Ga0075430_100010033
584 Ga0075430_100016731
585 Ga0075431_100015995
586 Ga0075431_100022945
587 Ga0075431_100037503
588 Ga0075431_100084417
589 Ga0075431_100097894
590 Ga0075433_10114498
591 Ga0075434_100002772
592 Ga0075434_100141281
593 Ga0075434_100241135
594 Ga0075434_100620680
595 Ga0075429_100017456
596 Ga0068865_100186310
597 Ga0075436_100037825
598 Ga0097620_100065424
599 Ga0097620_100066463
600 Ga0097620_100125471
601 Ga0097620_100189914
602 Ga0075435_100004425
603 Ga0075435_100110603
604 Ga0105240_10092439
605 Ga0111539_10003233
606 Ga0111539_10021013
607 Ga0111539_10038052
608 Ga0111539_10189122
609 Ga0111539_10297244
610 Ga0111539_10374203
611 Ga0105245_10039885
612 Ga0105245_10048265
613 Ga0114129_10000171
614 Ga0114129_10002879
615 Ga0114129_10009284
616 Ga0114129_10011026
617 Ga0114129_10033468
618 Ga0114129_10085315
619 Ga0114129_10087224
620 Ga0114129_10196624
621 Ga0114129_10313066
622 Ga0105243_10175257
623 Ga0105243_10179054
624 Ga0105241_10069632
625 Ga0105248_10003756
626 Ga0105248_10055427
627 Ga0105248_10068335
628 Ga0105248_10081011
629 Ga0105248_10098232
630 Ga0105248_10626829
631 Ga0105249_10008788
632 Ga0157370_10085788
633 Ga0157374_10020958
634 Ga0157374_10101689
635 Ga0157374_10119850
636 Ga0157378_10412464
637 Ga0163162_10068560
638 Ga0163162_10089617
639 Ga0157375_10144701
640 Ga0157375_10180668
641 Ga0163163_10078897
642 Ga0163163_10144572
643 Ga0163163_10232439
644 Ga0163163_10237744
645 Ga0157380_10307918
646 Ga0157376_10212750
647 Ga0157376_10536035
648 Ga0163161_10144543
649 Ga0213876_10082561
650 Ga0207697_10001902
651 Ga0207697_10018192
652 Ga0207642_10070095
653 Ga0207688_10028090
654 Ga0207680_10052303
655 Ga0207645_10016616
656 Ga0207645_10196368
657 Ga0207684_10250139
658 Ga0207684_10316148
659 Ga0207707_10171452
660 Ga0207707_10207499
661 Ga0207695_10066043
662 Ga0207660_10277505
663 Ga0207662_10175640
664 Ga0207657_10011433
665 Ga0207649_10075207
666 Ga0207652_10018314
667 Ga0207694_10311061
668 Ga0207650_10002628
669 Ga0207650_10004690
670 Ga0207650_10015559
671 Ga0207650_10069579
672 Ga0207659_10086627
673 Ga0207659_10172023
674 Ga0207687_10027394
675 Ga0207644_10024141
676 Ga0207690_10088391
677 Ga0207690_10096190
678 Ga0207690_10108462
679 Ga0207706_10028642
680 Ga0207706_10172234
681 Ga0207686_10029065
682 Ga0207686_10127936
683 Ga0207709_10124223
684 Ga0207669_10064601
685 Ga0207669_10092757
686 Ga0207669_10416675
687 Ga0207691_10018285
688 Ga0207711_10008567
689 Ga0207711_10031590
690 Ga0207711_10062657
691 Ga0207711_10158128
692 Ga0207689_10132790
693 Ga0207661_10134312
694 Ga0207679_10093033
695 Ga0207679_10135718
696 Ga0207679_10240701
697 Ga0207651_10035443
698 Ga0207651_10057231
699 Ga0207651_10097479
700 Ga0207712_10026445
701 Ga0207712_10042456
702 Ga0207640_10094334
703 Ga0207640_10168235
704 Ga0207658_10283464
705 Ga0207703_10127851
706 Ga0207708_10148643
707 Ga0207641_10299378
708 Ga0207648_10000709
709 Ga0207648_10274940
710 Ga0207676_10009849
711 Ga0207676_10037756
712 Ga0207675_100012864
713 Ga0207683_10054319
714 Ga0207683_10068062
715 Ga0207683_10108733
716 Ga0207683_10133093
717 Ga0207683_10133178
718 Ga0207698_10030561
719 Ga0207428_10000864
720 Ga0207428_10002617
721 Ga0207428_10031001
722 Ga0268265_10010415
723 Ga0268265_10305054
724 Ga0268265_10358387
725 Ga0307408_100010451
726 Ga0307408_100030037
727 Ga0307408_100083489
728 Ga0307405_10045035
729 Ga0307413_10006573
730 Ga0307413_10032703
731 Ga0307410_10033343
732 Ga0307410_10352910
733 Ga0307412_10206966
734 Ga0307412_10253323
735 Ga0307409_100046491
736 Ga0307409_100079246
737 Ga0307409_100086384
738 Ga0307416_100013492
739 Ga0307416_100027310
740 Ga0307414_10031673
741 Ga0307414_10269156
742 Ga0307414_10496772
743 Ga0307411_10007408
744 Ga0307411_10017823
745 Ga0307411_10297081
746 Ga0307411_10305523
747 Ga0307415_100023575
748 Ga0373938_0040291
749 Ga0373936_0015032
750 Ga0373945_0041903
751 Ga0373943_0023093
752 Ga0373955_0067486
753 Ga0373924_0013121
754 Ga0373935_0012540
755 Ga0373927_0092231
756 Ga0373947_0018984
757 Ga0373925_0004437
758 Ga0373925_0062348
759 Ga0439433_0038801
760 Ga0439449_0012867
761 Ga0450923_000398
762 Ga0450896_001512
763 Ga0439446_0007085
764 Ga0439446_0014104
765 Ga0439446_0039330
766 Ga0439435_0009561
767 Ga0439435_0075258
768 Ga0439464_0000652
769 Ga0495603_0088869
770 Ga0495629_0267800
771 Ga0495618_0363007
772 Ga0495635_0132373
773 Ga0495659_0011642
774 Ga0495647_0081112
775 Ga0495674_0038802
776 Ga0495680_0061742
777 Ga0495684_0070794
778 Ga0496101_0073926
779 Ga0496101_0074961
780 Ga0496102_0057138
781 Ga0496102_0189768
782 Ga0496104_0002365
783 Ga0496104_0005233
784 Ga0496104_0015062
785 Ga0496104_0139227
786 Ga0496105_0006404
787 Ga0496105_0044674
788 Ga0496106_0027282
789 Ga0496106_0058634
790 Ga0496106_0079522
791 Ga0496106_0165080
792 Ga0496107_0170123
793 Ga0496108_0041855
794 Ga0496108_0044684
795 Ga0496109_0001246
796 Ga0496109_0009063
797 Ga0496109_0070963
798 Ga0496109_0174593
799 Ga0496110_0002416
800 Ga0496110_0049029
801 Ga0496110_0055936
802 Ga0496110_0235937
803 Ga0496111_0007202
804 Ga0496111_0033549
805 Ga0496112_0000287
806 Ga0496112_0023492
807 Ga0496112_0079806
808 Ga0496113_0011533
809 Ga0496113_0026926
810 Ga0496113_0092296
811 Ga0496114_0009075
812 Ga0496114_0013501
813 Ga0501299_002788
814 Ga0501031_0256350
815 Ga0501034_0019944
816 Ga0501034_0072072
817 Ga0501036_0016991
818 Ga0501036_0036356
819 Ga0501036_0043565
820 Ga0501037_0066530
821 Ga0501038_0074269
822 Ga0501038_0137251
823 Ga0501038_0221625
824 Ga0501039_0013386
825 Ga0501039_0049098
826 Ga0501039_0067415
827 Ga0501040_0000870
828 Ga0501040_0005160
829 Ga0501041_0024312
830 Ga0501042_0000759
831 Ga0501042_0032469
832 Ga0501046_0034462
833 Ga0501046_0053950
834 Ga0501046_0064925
835 Ga0501048_0003993
836 Ga0501048_0214012
837 Ga0501068_0003912
838 Ga0501069_0061638
839 Ga0501069_0136093
840 Ga0501071_0012747
841 Ga0501071_0042973
842 Ga0501071_0190432
843 Ga0501071_0298905
844 Ga0501072_0018514
845 Ga0501072_0027587
846 Ga0501072_0063718
847 Ga0501072_0076042
848 Ga0501072_0086038
849 Ga0501072_0529769
850 Ga0501073_0056444
851 Ga0501073_0131459
852 Ga0501075_0002493
853 Ga0501075_0011089
854 Ga0501075_0013285
855 Ga0501075_0022383
856 Ga0501076_0009546
857 Ga0501076_0010762
858 Ga0501076_0025345
859 Ga0501076_0101501
860 Ga0501076_0142528
861 Ga0501077_0006259
862 Ga0501079_0011355
863 Ga0501079_0031213
864 Ga0501079_0064524
865 Ga0501079_0068216
866 Ga0501079_0110155
867 Ga0501079_0304509
868 Ga0501080_0172796
869 Ga0501081_0001431
870 Ga0501081_0012838
871 Ga0501081_0173360
872 Ga0501045_0000552
873 Ga0501045_0017969
874 Ga0501045_0021429
875 Ga0501045_0052968
876 Ga0501045_0069858
877 Ga0501045_0281676
878 nmdc:mga03683_367_c1
879 nmdc:mga00v17_3748_c1
880 nmdc:mga0yw44_84534_c1
881 nmdc:mga06z11_5106_c1
882 nmdc:mga04h51_1638_c1
883 nmdc:mga07m45_3284_c1
884 nmdc:mga05p37_1009_c1
885 nmdc:mga05p37_103885_c1
886 nmdc:mga05p37_192186_c1
887 nmdc:mga05p37_278565_c1
888 nmdc:mga05p37_2979_c1
889 nmdc:mga05p37_425749_c1
890 nmdc:mga05p37_48294_c1
891 nmdc:mga05p37_9128_c1
892 nmdc:mga09592_318046_c1
893 nmdc:mga0qj67_103594_c1
894 nmdc:mga0qj67_11113_c1
895 nmdc:mga0qj67_1218_c1
896 nmdc:mga0qj67_24631_c1
897 nmdc:mga0qj67_5439_c1
898 nmdc:mga06r32_20077_c1
899 nmdc:mga06r32_28239_c1
900 nmdc:mga06r32_3672_c1
901 nmdc:mga06r32_516602_c1
902 nmdc:mga06r32_616353_c1
903 nmdc:mga06r32_63360_c1
904 nmdc:mga08y16_19705_c1
905 nmdc:mga08y16_240554_c1
906 nmdc:mga08y16_24508_c1
907 nmdc:mga08y16_28403_c1
908 nmdc:mga08y16_462421_c1
909 nmdc:mga0n895_30920_c1
910 nmdc:mga0rr50_1277_c1
911 nmdc:mga0rr50_131919_c1
912 nmdc:mga0rr50_186234_c1
913 nmdc:mga08x19_109614_c1
914 nmdc:mga0a205_104667_c1
915 nmdc:mga0a205_62718_c1
916 Ga0495601_0068452
917 Ga0495612_0051311
918 Ga0495619_0046720
919 Ga0501084_0006790
920 Ga0501084_0029334
921 Ga0501084_0061119
922 Ga0501084_0064925
923 Ga0501084_0070132
924 Ga0590071_000149
925 Ga0590075_000328
926 Ga0590077_000260
927 Ga0501082_0001320
928 Ga0530510_0004538
929 Ga0530510_0030275
930 Ga0530510_0036543

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

149

276

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2whn-assembly1.cif.gz_A n-terminal domain from the pilc type iv pilus biogenesis protein 0.8467 92 194
3c1q-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8381 92 197
2vma-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8375 92 204
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.8355 92 199
2vmb-assembly2.cif.gz_B the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8329 92 204
ID Description Score Start End Superfamily
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8393 99 222 1.20.81.30
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8155 99 222 1.20.81.30
af_P36646_52_165_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7933 92 201 1.20.81.30
af_P36646_249_359_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.791 77 195 1.20.81.30
3c1qB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7904 92 200 1.20.81.30
ID Description Score Start End GO Terms
AF-H0QPT3-F1-model_v4 Putative type II secretion system protein 0.95 85 262 GO:0005886
AF-A0A0P9C524-F1-model_v4 Tight adherence protein B 0.9467 80 266 GO:0005886
AF-A0A831TXJ3-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9404 80 266 GO:0005886
AF-A0A7V0XEU4-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9395 80 266 GO:0005886
AF-A0A317JDK0-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9358 81 266 GO:0005886

Map