F449343

General Info

Members Datasets Scaffolds Average Seq Length
464 219 928 153

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0033941|Ga0466967_0033941_89_556
Length 150
Sequence MARQTGEKLIVDNRRARHEYHLGDRVEAGLVLAGTEVKSLRDGEATLQQAYAEVWLLGLHVPEYSQGNVANHDPDRPRKLLLHRREIERLASGVAEKGFTLVPTRLYFKDGRVKVELALARGKELRDKRRDIADRDARRQIERELKSLRR

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
62 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
92 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
93 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
96 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
104 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
115 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
116 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
117 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
118 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
119 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 1.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.9
Rhizosphere 93.1
Stem 0
Stem Tuber 0
Unclassified 1.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0033941 3300045976 Bacteria 4324
2 JGI25407J50210_10019775 3300003373 Bacteria 1750
3 JGI25407J50210_10043636 3300003373 Bacteria 1146
4 Ga0070658_10032587 3300005327 Bacteria 4190
5 Ga0070658_10046223 3300005327 Bacteria 3523
6 Ga0070658_10213436 3300005327 Bacteria 1631
7 Ga0070683_101321265 3300005329 Bacteria 693
8 Ga0070680_100174085 3300005336 Bacteria 1812
9 Ga0070682_100014383 3300005337 Bacteria 4572
10 Ga0070682_100094162 3300005337 Bacteria 1965
11 Ga0070682_100158887 3300005337 Bacteria 1559
12 Ga0070660_100009622 3300005339 Bacteria 6808
13 Ga0070660_100027532 3300005339 Bacteria 4243
14 Ga0070660_100244549 3300005339 Bacteria 1462
15 Ga0070661_100116702 3300005344 Bacteria 1996
16 Ga0070661_100628849 3300005344 Bacteria 870
17 Ga0070671_100063051 3300005355 Bacteria 3086
18 Ga0070659_100363918 3300005366 Bacteria 1216
19 Ga0070659_100384164 3300005366 Bacteria 1183
20 Ga0070709_10811301 3300005434 Bacteria 735
21 Ga0070714_100002979 3300005435 Bacteria 12547
22 Ga0070714_100019455 3300005435 Bacteria 5533
23 Ga0070714_100168255 3300005435 Bacteria 1987
24 Ga0070714_100505678 3300005435 Bacteria 1153
25 Ga0070714_101234004 3300005435 Bacteria 729
26 Ga0070713_100011606 3300005436 Bacteria 6425
27 Ga0070713_100054997 3300005436 Bacteria 3305
28 Ga0070710_10043347 3300005437 Bacteria 2491
29 Ga0070711_100050255 3300005439 Bacteria 2858
30 Ga0070694_100033647 3300005444 Bacteria 3375
31 Ga0070681_10095974 3300005458 Bacteria 2913
32 Ga0070681_10137338 3300005458 Bacteria 2375
33 Ga0070681_10227932 3300005458 Bacteria 1778
34 Ga0070707_100122895 3300005468 Unclassified 2520
35 Ga0070707_100497613 3300005468 Bacteria 1180
36 Ga0070698_100248240 3300005471 Bacteria 1712
37 Ga0070679_100028071 3300005530 Bacteria 5545
38 Ga0070679_100029662 3300005530 Bacteria 5396
39 Ga0070679_100093186 3300005530 Bacteria 3000
40 Ga0070679_100150653 3300005530 Bacteria 2303
41 Ga0070684_100251485 3300005535 Bacteria 1615
42 Ga0068853_100584454 3300005539 Bacteria 1060
43 Ga0070696_100508752 3300005546 Bacteria 959
44 Ga0068855_100067821 3300005563 Bacteria 4154
45 Ga0068855_100306062 3300005563 Bacteria 1759
46 Ga0068856_100363415 3300005614 Bacteria 1466
47 Ga0068852_100085284 3300005616 Bacteria 2813
48 Ga0068859_101255521 3300005617 Bacteria 816
49 Ga0081455_10040418 3300005937 Bacteria 4112
50 Ga0081455_10043286 3300005937 Bacteria 3941
51 Ga0081455_10097147 3300005937 Bacteria 2374
52 Ga0081538_10000043 3300005981 Bacteria 115532
53 Ga0081538_10003176 3300005981 Bacteria 15626
54 Ga0081538_10008251 3300005981 Bacteria 8874
55 Ga0081538_10014658 3300005981 Bacteria 6126
56 Ga0081538_10022360 3300005981 Bacteria 4582
57 Ga0081538_10058135 3300005981 Bacteria 2246
58 Ga0081538_10059772 3300005981 Bacteria 2199
59 Ga0070717_10011023 3300006028 Bacteria 6846
60 Ga0070717_10016012 3300006028 Bacteria 5806
61 Ga0070715_10009602 3300006163 Bacteria 3416
62 Ga0070716_100037561 3300006173 Bacteria 2677
63 Ga0070712_100034028 3300006175 Bacteria 3452
64 Ga0097621_100185375 3300006237 Bacteria 1800
65 Ga0068871_100927447 3300006358 Bacteria 808
66 Ga0075428_100218303 3300006844 Bacteria 2059
67 Ga0075428_101145425 3300006844 Bacteria 821
68 Ga0075430_100041487 3300006846 Bacteria 3893
69 Ga0075429_100137011 3300006880 Bacteria 2142
70 Ga0097620_101255547 3300006931 Bacteria 816
71 Ga0105251_10100170 3300009011 Bacteria 1324
72 Ga0105240_10110154 3300009093 Bacteria 3333
73 Ga0105240_10667708 3300009093 Bacteria 1137
74 Ga0105247_10497604 3300009101 Bacteria 888
75 Ga0114129_10005345 3300009147 Bacteria 18124
76 Ga0105241_10096462 3300009174 Bacteria 2342
77 Ga0105241_10283371 3300009174 Bacteria 1416
78 Ga0105237_10795308 3300009545 Bacteria 953
79 Ga0105238_10354487 3300009551 Bacteria 1456
80 Ga0105238_10898615 3300009551 Bacteria 904
81 Ga0157373_10162348 3300013100 Bacteria 1572
82 Ga0157373_10572786 3300013100 Bacteria 820
83 Ga0157371_10072094 3300013102 Bacteria 2446
84 Ga0157370_10029792 3300013104 Bacteria 5351
85 Ga0157370_10587161 3300013104 Bacteria 1020
86 Ga0157370_11251169 3300013104 Bacteria 669
87 Ga0157369_10034321 3300013105 Bacteria 5569
88 Ga0157369_10081681 3300013105 Bacteria 3459
89 Ga0157374_10023100 3300013296 Bacteria 5557
90 Ga0157372_12125899 3300013307 Bacteria 645
91 Ga0163163_11154400 3300014325 Bacteria 837
92 Ga0182008_10006843 3300014497 Bacteria 6344
93 Ga0182008_10676638 3300014497 Bacteria 587
94 Ga0157379_10287856 3300014968 Bacteria 1496
95 Ga0182006_1010744 3300015261 Bacteria 4055
96 Ga0182007_10007092 3300015262 Bacteria 4742
97 Ga0206356_11318110 3300020070 Bacteria 2036
98 Ga0206354_10516362 3300020081 Bacteria 773
99 Ga0206354_11248895 3300020081 Bacteria 2677
100 Ga0206353_10127145 3300020082 Bacteria 1134
101 Ga0206353_10829062 3300020082 Bacteria 1801
102 Ga0213871_10008275 3300021441 Bacteria 2286
103 Ga0213871_10017072 3300021441 Bacteria 1759
104 Ga0207685_10015949 3300025905 Bacteria 2393
105 Ga0207699_10040090 3300025906 Bacteria 2696
106 Ga0207699_10269031 3300025906 Bacteria 1180
107 Ga0207705_10122858 3300025909 Bacteria 1928
108 Ga0207705_10161142 3300025909 Bacteria 1685
109 Ga0207705_10169397 3300025909 Bacteria 1644
110 Ga0207654_10225113 3300025911 Bacteria 1246
111 Ga0207707_10047911 3300025912 Bacteria 3722
112 Ga0207707_10074774 3300025912 Bacteria 2955
113 Ga0207707_10178047 3300025912 Bacteria 1857
114 Ga0207707_10232791 3300025912 Bacteria 1603
115 Ga0207695_10302506 3300025913 Bacteria 1491
116 Ga0207671_10567436 3300025914 Bacteria 905
117 Ga0207693_10002992 3300025915 Bacteria 14627
118 Ga0207663_10017338 3300025916 Bacteria 4010
119 Ga0207663_10532085 3300025916 Bacteria 917
120 Ga0207660_10185621 3300025917 Bacteria 1617
121 Ga0207660_10597043 3300025917 Bacteria 899
122 Ga0207657_10009122 3300025919 Bacteria 10008
123 Ga0207657_10024058 3300025919 Bacteria 5654
124 Ga0207657_10087820 3300025919 Bacteria 2600
125 Ga0207657_10175451 3300025919 Bacteria 1735
126 Ga0207657_10428155 3300025919 Bacteria 1040
127 Ga0207649_10071062 3300025920 Bacteria 2222
128 Ga0207652_10006261 3300025921 Bacteria 9605
129 Ga0207652_10060270 3300025921 Bacteria 3274
130 Ga0207652_10089285 3300025921 Bacteria 2706
131 Ga0207652_10153587 3300025921 Bacteria 2062
132 Ga0207652_10229982 3300025921 Bacteria 1671
133 Ga0207652_10949584 3300025921 Bacteria 758
134 Ga0207646_10073448 3300025922 Bacteria 3055
135 Ga0207694_10734503 3300025924 Bacteria 833
136 Ga0207687_10186918 3300025927 Bacteria 1609
137 Ga0207700_10093252 3300025928 Bacteria 2382
138 Ga0207700_10439855 3300025928 Bacteria 1148
139 Ga0207664_10029811 3300025929 Bacteria 4160
140 Ga0207664_10091921 3300025929 Bacteria 2489
141 Ga0207664_10262062 3300025929 Bacteria 1512
142 Ga0207664_10343346 3300025929 Bacteria 1320
143 Ga0207664_10572933 3300025929 Bacteria 1013
144 Ga0207644_10053950 3300025931 Bacteria 2894
145 Ga0207690_10606471 3300025932 Bacteria 894
146 Ga0207690_11062141 3300025932 Bacteria 674
147 Ga0207665_10000070 3300025939 Bacteria 66142
148 Ga0207661_10165185 3300025944 Bacteria 1923
149 Ga0207661_11268329 3300025944 Bacteria 677
150 Ga0207679_10678371 3300025945 Bacteria 934
151 Ga0207667_10104427 3300025949 Bacteria 2923
152 Ga0207667_10152589 3300025949 Bacteria 2377
153 Ga0207667_10999912 3300025949 Bacteria 824
154 Ga0207640_10032513 3300025981 Bacteria 3236
155 Ga0207639_10504756 3300026041 Bacteria 1106
156 Ga0207639_10524777 3300026041 Bacteria 1085
157 Ga0207639_10775917 3300026041 Bacteria 892
158 Ga0207678_10439040 3300026067 Unclassified 1134
159 Ga0207702_10333012 3300026078 Bacteria 1448
160 Ga0207698_10089227 3300026142 Bacteria 2517
161 Ga0265319_1084080 3300028563 Bacteria 1008
162 Ga0265334_10009863 3300028573 Bacteria 4036
163 Ga0265334_10129567 3300028573 Bacteria 898
164 Ga0265323_10091445 3300028653 Bacteria 1016
165 Ga0265338_10011084 3300028800 Bacteria 10457
166 Ga0265338_10013886 3300028800 Bacteria 9040
167 Ga0265338_10086777 3300028800 Bacteria 2602
168 Ga0265338_10599854 3300028800 Bacteria 767
169 Ga0265338_10678874 3300028800 Bacteria 712
170 Ga0265338_10687470 3300028800 Bacteria 707
171 Ga0265330_10069502 3300031235 Bacteria 1524
172 Ga0265320_10057262 3300031240 Bacteria 1870
173 Ga0265325_10052206 3300031241 Bacteria 2099
174 Ga0265329_10001736 3300031242 Bacteria 10414
175 Ga0265327_10020427 3300031251 Bacteria 4034
176 Ga0265313_10033218 3300031595 Bacteria 2625
177 Ga0265342_10479291 3300031712 Bacteria 636
178 Ga0307406_10607448 3300031901 Bacteria 903
179 Ga0373940_0045866 3300035088 Bacteria 1215
180 Ga0373939_0395465 3300035114 Bacteria 572
181 Ga0373946_0328785 3300035171 Unclassified 761
182 Ga0373961_0269934 3300035241 Bacteria 621
183 Ga0373947_0249685 3300035725 Bacteria 1173
184 Ga0373925_1466402 3300037068 Bacteria 559
185 Ga0395899_0009475 3300037312 Bacteria 7475
186 Ga0395899_0013856 3300037312 Bacteria 6159
187 Ga0395899_0042176 3300037312 Bacteria 3407
188 Ga0395899_0103937 3300037312 Bacteria 2048
189 Ga0395900_0004419 3300037418 Bacteria 14907
190 Ga0395900_0909826 3300037418 Bacteria 803
191 Ga0395900_1443815 3300037418 Bacteria 601
192 Ga0395898_0056047 3300037466 Bacteria 3843
193 Ga0395898_0488403 3300037466 Bacteria 1171
194 Ga0395898_0635530 3300037466 Bacteria 1010
195 Ga0395898_0636229 3300037466 Bacteria 1009
196 Ga0395898_0829730 3300037466 Bacteria 864
197 Ga0395898_1245920 3300037466 Bacteria 674
198 Ga0395898_1593195 3300037466 Bacteria 577
199 Ga0395905_0017747 3300037471 Bacteria 6757
200 Ga0395905_0025436 3300037471 Bacteria 5583
201 Ga0395905_0109537 3300037471 Bacteria 2593
202 Ga0395901_0157219 3300038443 Bacteria 2387
203 Ga0395901_0492761 3300038443 Bacteria 1248
204 Ga0395901_1208796 3300038443 Bacteria 721
205 Ga0242420_013647 3300038996 Bacteria 1387
206 Ga0436360_0665838 3300039438 Bacteria 1890
207 Ga0436360_1011977 3300039438 Bacteria 6957
208 Ga0451795_1563686 3300041456 Bacteria 711
209 Ga0439456_075418 3300042013 Bacteria 750
210 Ga0439459_0025307 3300042438 Bacteria 1171
211 Ga0439460_0071482 3300042461 Bacteria 1076
212 Ga0451577_0508578 3300042876 Bacteria 1094
213 Ga0466969_0319956 3300044656 Bacteria 702
214 Ga0466972_0183753 3300044658 Bacteria 980
215 Ga0466965_0170480 3300044683 Bacteria 1145
216 Ga0466966_0007789 3300044684 Bacteria 7094
217 Ga0466966_0041313 3300044684 Bacteria 2963
218 Ga0466966_0041732 3300044684 Bacteria 2947
219 Ga0466961_0016634 3300044693 Bacteria 4729
220 Ga0466961_0165230 3300044693 Bacteria 1378
221 Ga0466963_0002598 3300044694 Bacteria 10133
222 Ga0466963_0093775 3300044694 Bacteria 2047
223 Ga0466963_0601952 3300044694 Bacteria 776
224 Ga0466963_0607569 3300044694 Bacteria 772
225 Ga0466963_1235789 3300044694 Bacteria 525
226 Ga0466964_0660878 3300044706 Bacteria 579
227 Ga0466971_0042345 3300044719 Bacteria 2046
228 Ga0466968_0053290 3300044735 Bacteria 1732
229 Ga0466968_0090748 3300044735 Bacteria 1353
230 Ga0466968_0211337 3300044735 Bacteria 912
231 Ga0466968_0558859 3300044735 Bacteria 575
232 Ga0466957_0151498 3300044842 Bacteria 1500
233 Ga0466957_0153252 3300044842 Bacteria 1492
234 Ga0466957_0178946 3300044842 Bacteria 1384
235 Ga0466957_0497689 3300044842 Bacteria 845
236 Ga0466957_0799620 3300044842 Bacteria 670
237 Ga0466959_0002669 3300045049 Bacteria 11447
238 Ga0466959_0087589 3300045049 Bacteria 2239
239 Ga0466959_0342589 3300045049 Bacteria 1020
240 Ga0451576_1132348 3300045051 Bacteria 818
241 Ga0466958_0021182 3300045836 Bacteria 3796
242 Ga0466958_0056558 3300045836 Bacteria 2383
243 Ga0466958_0094016 3300045836 Bacteria 1857
244 Ga0466958_0110417 3300045836 Bacteria 1716
245 Ga0466958_0149354 3300045836 Unclassified 1474
246 Ga0466958_0373591 3300045836 Bacteria 919
247 Ga0466967_0000153 3300045976 Bacteria 27291
248 Ga0466967_0054541 3300045976 Bacteria 3518
249 Ga0466967_0086295 3300045976 Bacteria 2843
250 Ga0466967_0161138 3300045976 Bacteria 2105
251 Ga0466967_0205843 3300045976 Bacteria 1865
252 Ga0466967_0911403 3300045976 Bacteria 874
253 Ga0466967_1508679 3300045976 Bacteria 669
254 Ga0466967_1565110 3300045976 Bacteria 656
255 Ga0495592_0041625 3300046454 Bacteria 3442
256 Ga0495592_0439504 3300046454 Bacteria 819
257 Ga0495603_0263527 3300046455 Bacteria 992
258 Ga0495629_0159714 3300046459 Bacteria 1566
259 Ga0495641_0008429 3300046461 Bacteria 6286
260 Ga0495641_0392599 3300046461 Bacteria 629
261 Ga0495651_0099870 3300046462 Bacteria 2163
262 Ga0495653_0028915 3300046463 Bacteria 4431
263 Ga0495582_0624298 3300046473 Bacteria 624
264 Ga0495608_0176979 3300046511 Bacteria 1351
265 Ga0495608_0391242 3300046511 Bacteria 851
266 Ga0495618_0370454 3300046514 Bacteria 880
267 Ga0495628_0112456 3300046516 Bacteria 2093
268 Ga0495628_0433330 3300046516 Bacteria 957
269 Ga0495630_0201418 3300046517 Bacteria 1519
270 Ga0495630_1082224 3300046517 Bacteria 608
271 Ga0495652_0260226 3300046529 Bacteria 1281
272 Ga0495586_0006586 3300046535 Bacteria 6207
273 Ga0495645_0179706 3300046543 Bacteria 1450
274 Ga0495667_0353297 3300046559 Bacteria 928
275 Ga0495667_0444076 3300046559 Bacteria 815
276 Ga0495656_0153758 3300046615 Bacteria 1113
277 Ga0495634_0106384 3300046642 Bacteria 1808
278 Ga0495635_0517562 3300046663 Bacteria 784
279 Ga0495657_0136477 3300046675 Bacteria 1532
280 Ga0495599_0010726 3300046678 Bacteria 5611
281 Ga0495646_0088341 3300046680 Bacteria 1795
282 Ga0495646_0151267 3300046680 Bacteria 1291
283 Ga0495658_0189390 3300046683 Bacteria 1278
284 Ga0495658_0285870 3300046683 Bacteria 1041
285 Ga0495613_0087077 3300046689 Bacteria 2264
286 Ga0495624_0262851 3300046690 Bacteria 1043
287 Ga0495624_0401067 3300046690 Bacteria 823
288 Ga0495600_0062650 3300046809 Bacteria 2430
289 Ga0495600_0096324 3300046809 Bacteria 1929
290 Ga0495674_0107820 3300047319 Bacteria 2364
291 Ga0495674_0544244 3300047319 Bacteria 925
292 Ga0495676_0445087 3300047321 Unclassified 855
293 Ga0495602_0027786 3300048088 Bacteria 5429
294 Ga0495602_1086710 3300048088 Bacteria 525
295 Ga0496100_0085337 3300048903 Bacteria 2143
296 Ga0496101_0020033 3300048904 Bacteria 4573
297 Ga0496102_0076686 3300048905 Bacteria 3075
298 Ga0496102_0103001 3300048905 Bacteria 2654
299 Ga0496102_0112125 3300048905 Bacteria 2543
300 Ga0496103_0020716 3300048906 Bacteria 3953
301 Ga0496103_0040179 3300048906 Bacteria 2875
302 Ga0496104_0231060 3300048907 Bacteria 1761
303 Ga0496104_1310825 3300048907 Bacteria 627
304 Ga0496105_0093671 3300048908 Bacteria 2480
305 Ga0496105_1340420 3300048908 Bacteria 521
306 Ga0496106_0018533 3300048909 Bacteria 5148
307 Ga0496106_0037663 3300048909 Bacteria 3618
308 Ga0496107_0104224 3300048910 Bacteria 2081
309 Ga0496107_0156874 3300048910 Bacteria 1685
310 Ga0496109_0118681 3300048912 Bacteria 2462
311 Ga0496109_0298840 3300048912 Bacteria 1518
312 Ga0496110_0013745 3300048913 Bacteria 6708
313 Ga0496111_0112857 3300048914 Bacteria 2002
314 Ga0496111_0312252 3300048914 Bacteria 1165
315 Ga0496112_0011692 3300048915 Bacteria 8030
316 Ga0496112_0034303 3300048915 Bacteria 4938
317 Ga0496112_0044782 3300048915 Bacteria 4336
318 Ga0496112_0085062 3300048915 Bacteria 3129
319 Ga0496112_0105788 3300048915 Bacteria 2783
320 Ga0496112_0776579 3300048915 Bacteria 883
321 Ga0496113_0039372 3300048916 Bacteria 3479
322 Ga0496113_0047186 3300048916 Bacteria 3201
323 Ga0496113_0066684 3300048916 Bacteria 2727
324 Ga0496114_0006948 3300048917 Bacteria 8916
325 Ga0496114_0767382 3300048917 Bacteria 842
326 Ga0501031_0000214 3300049568 Bacteria 33045
327 Ga0501031_0000304 3300049568 Bacteria 28124
328 Ga0501031_0255185 3300049568 Bacteria 1139
329 Ga0501031_0779276 3300049568 Bacteria 613
330 Ga0501032_0018981 3300049569 Bacteria 4810
331 Ga0501033_0000428 3300049570 Bacteria 40234
332 Ga0501033_0020323 3300049570 Bacteria 5016
333 Ga0501033_0135975 3300049570 Bacteria 1778
334 Ga0501033_0290725 3300049570 Bacteria 1152
335 Ga0501034_0083327 3300049571 Bacteria 3199
336 Ga0501034_0328610 3300049571 Bacteria 1461
337 Ga0501036_0183734 3300049572 Bacteria 1760
338 Ga0501037_0051956 3300049573 Bacteria 2997
339 Ga0501037_0265804 3300049573 Bacteria 1198
340 Ga0501038_0000273 3300049574 Bacteria 43671
341 Ga0501038_0095671 3300049574 Bacteria 2480
342 Ga0501038_0115211 3300049574 Bacteria 2222
343 Ga0501039_0000436 3300049575 Bacteria 30160
344 Ga0501039_0054109 3300049575 Bacteria 3106
345 Ga0501039_0261797 3300049575 Bacteria 1359
346 Ga0501039_0907183 3300049575 Bacteria 686
347 Ga0501040_0000284 3300049576 Bacteria 29552
348 Ga0501040_0000350 3300049576 Bacteria 27112
349 Ga0501040_0007884 3300049576 Bacteria 6903
350 Ga0501040_0013075 3300049576 Bacteria 5458
351 Ga0501040_0071056 3300049576 Bacteria 2403
352 Ga0501040_1399640 3300049576 Bacteria 508
353 Ga0501041_0001099 3300049577 Bacteria 14814
354 Ga0501041_0001452 3300049577 Bacteria 13097
355 Ga0501041_0034777 3300049577 Bacteria 3051
356 Ga0501041_0091546 3300049577 Bacteria 1877
357 Ga0501041_0721221 3300049577 Bacteria 638
358 Ga0501041_0763334 3300049577 Bacteria 619
359 Ga0501042_0000498 3300049578 Bacteria 20401
360 Ga0501042_0000810 3300049578 Bacteria 17244
361 Ga0501042_0854372 3300049578 Bacteria 663
362 Ga0501042_0952109 3300049578 Bacteria 625
363 Ga0501043_0011225 3300049579 Bacteria 7016
364 Ga0501043_0717594 3300049579 Bacteria 729
365 Ga0501046_0001706 3300049580 Bacteria 20988
366 Ga0501046_0020198 3300049580 Bacteria 5513
367 Ga0501046_0269900 3300049580 Bacteria 1248
368 Ga0501046_0514281 3300049580 Bacteria 856
369 Ga0501047_0001281 3300049581 Bacteria 24843
370 Ga0501048_0003889 3300049582 Bacteria 11363
371 Ga0501048_0018266 3300049582 Bacteria 5158
372 Ga0501048_0023806 3300049582 Bacteria 4472
373 Ga0501048_0856288 3300049582 Bacteria 653
374 Ga0501067_0027526 3300049583 Bacteria 3150
375 Ga0501067_0160272 3300049583 Bacteria 1253
376 Ga0501067_0300130 3300049583 Bacteria 894
377 Ga0501068_0001331 3300049584 Bacteria 13096
378 Ga0501068_0005687 3300049584 Bacteria 6825
379 Ga0501068_0067593 3300049584 Bacteria 2178
380 Ga0501068_1007832 3300049584 Bacteria 550
381 Ga0501069_0006981 3300049585 Bacteria 5907
382 Ga0501069_0069535 3300049585 Bacteria 1971
383 Ga0501069_0115967 3300049585 Bacteria 1528
384 Ga0501069_0206133 3300049585 Bacteria 1140
385 Ga0501070_0004591 3300049586 Bacteria 11836
386 Ga0501070_0015606 3300049586 Bacteria 6387
387 Ga0501070_0415310 3300049586 Bacteria 1087
388 Ga0501070_0461158 3300049586 Bacteria 1024
389 Ga0501071_0000091 3300049587 Bacteria 33638
390 Ga0501071_0002769 3300049587 Bacteria 10770
391 Ga0501071_0084646 3300049587 Bacteria 2324
392 Ga0501071_0860758 3300049587 Bacteria 699
393 Ga0501072_0003281 3300049588 Bacteria 12161
394 Ga0501072_0280819 3300049588 Bacteria 1324
395 Ga0501072_0400781 3300049588 Bacteria 1088
396 Ga0501073_0070247 3300049589 Bacteria 2440
397 Ga0501074_0004681 3300049590 Bacteria 9795
398 Ga0501074_0134808 3300049590 Bacteria 1766
399 Ga0501075_0001784 3300049591 Bacteria 14160
400 Ga0501075_0008806 3300049591 Bacteria 7034
401 Ga0501075_0015237 3300049591 Bacteria 5513
402 Ga0501075_0103183 3300049591 Bacteria 2166
403 Ga0501076_0000296 3300049592 Bacteria 30968
404 Ga0501076_0001903 3300049592 Bacteria 14244
405 Ga0501076_0002239 3300049592 Bacteria 13245
406 Ga0501076_0310764 3300049592 Bacteria 1292
407 Ga0501076_0908548 3300049592 Bacteria 726
408 Ga0501077_0003088 3300049593 Bacteria 10012
409 Ga0501077_0010331 3300049593 Bacteria 5809
410 Ga0501077_0013136 3300049593 Bacteria 5189
411 Ga0501077_0106567 3300049593 Bacteria 1776
412 Ga0501077_0197047 3300049593 Bacteria 1279
413 Ga0501079_0000904 3300049741 Bacteria 20340
414 Ga0501079_0001871 3300049741 Bacteria 15095
415 Ga0501079_0018440 3300049741 Bacteria 5332
416 Ga0501079_0103129 3300049741 Bacteria 2212
417 Ga0501079_0250447 3300049741 Bacteria 1384
418 Ga0501079_0253015 3300049741 Bacteria 1377
419 Ga0501080_0039004 3300049742 Bacteria 4432
420 Ga0501080_0056534 3300049742 Bacteria 3653
421 Ga0501080_0543505 3300049742 Bacteria 1035
422 Ga0501080_1408734 3300049742 Bacteria 594
423 Ga0501081_0000099 3300049743 Bacteria 36039
424 Ga0501081_0007971 3300049743 Bacteria 6872
425 Ga0501081_0030852 3300049743 Bacteria 3631
426 Ga0501081_0432546 3300049743 Bacteria 976
427 Ga0501083_0001273 3300049744 Bacteria 17067
428 Ga0501083_0130904 3300049744 Bacteria 1644
429 Ga0501035_0004160 3300049822 Bacteria 13754
430 Ga0501035_0022334 3300049822 Bacteria 5809
431 Ga0501035_0406956 3300049822 Bacteria 1131
432 Ga0501044_0007728 3300049823 Bacteria 11823
433 Ga0501044_0067724 3300049823 Bacteria 3637
434 Ga0501045_0000770 3300049824 Bacteria 20566
435 Ga0501045_0003529 3300049824 Bacteria 10721
436 Ga0501045_0010199 3300049824 Bacteria 6576
437 Ga0501045_0543929 3300049824 Bacteria 861
438 nmdc:mga05p37_2024_c1 3300050507 Bacteria 23640
439 nmdc:mga09592_9117_c1 3300050508 Bacteria 8069
440 nmdc:mga0qj67_145734_c1 3300050509 Bacteria 1920
441 nmdc:mga0qj67_186279_c1 3300050509 Bacteria 1686
442 nmdc:mga0qj67_40372_c1 3300050509 Bacteria 3668
443 nmdc:mga06r32_231221_c1 3300050510 Bacteria 1837
444 nmdc:mga0a205_1143665_c1 3300050515 Bacteria 626
445 Ga0495601_0026886 3300053077 Bacteria 3555
446 Ga0495595_0087143 3300053084 Bacteria 1494
447 Ga0495619_0015432 3300053085 Bacteria 4833
448 Ga0501084_0001310 3300054114 Bacteria 19574
449 Ga0501084_0005992 3300054114 Bacteria 10000
450 Ga0501084_0086426 3300054114 Bacteria 2633
451 Ga0501084_0117368 3300054114 Bacteria 2237
452 Ga0501084_0205080 3300054114 Bacteria 1664
453 Ga0501084_0223956 3300054114 Bacteria 1587
454 Ga0501082_0001487 3300060353 Bacteria 20624
455 Ga0501082_0005780 3300060353 Bacteria 10736
456 Ga0501082_0083630 3300060353 Bacteria 2753
457 Ga0501082_0164688 3300060353 Bacteria 1927
458 Ga0501082_0301571 3300060353 Bacteria 1395
459 Ga0530510_0000824 3300061734 Bacteria 20340
460 Ga0530510_0003958 3300061734 Bacteria 10217
461 Ga0530510_0012147 3300061734 Bacteria 6045
462 Ga0530510_0059603 3300061734 Bacteria 2761
463 Ga0530510_0652986 3300061734 Bacteria 801
464 Ga0530510_0847215 3300061734 Bacteria 698
465 Ga0466967_0033941
466 JGI25407J50210_10019775
467 JGI25407J50210_10043636
468 Ga0070658_10032587
469 Ga0070658_10046223
470 Ga0070658_10213436
471 Ga0070683_101321265
472 Ga0070680_100174085
473 Ga0070682_100014383
474 Ga0070682_100094162
475 Ga0070682_100158887
476 Ga0070660_100009622
477 Ga0070660_100027532
478 Ga0070660_100244549
479 Ga0070661_100116702
480 Ga0070661_100628849
481 Ga0070671_100063051
482 Ga0070659_100363918
483 Ga0070659_100384164
484 Ga0070709_10811301
485 Ga0070714_100002979
486 Ga0070714_100019455
487 Ga0070714_100168255
488 Ga0070714_100505678
489 Ga0070714_101234004
490 Ga0070713_100011606
491 Ga0070713_100054997
492 Ga0070710_10043347
493 Ga0070711_100050255
494 Ga0070694_100033647
495 Ga0070681_10095974
496 Ga0070681_10137338
497 Ga0070681_10227932
498 Ga0070707_100122895
499 Ga0070707_100497613
500 Ga0070698_100248240
501 Ga0070679_100028071
502 Ga0070679_100029662
503 Ga0070679_100093186
504 Ga0070679_100150653
505 Ga0070684_100251485
506 Ga0068853_100584454
507 Ga0070696_100508752
508 Ga0068855_100067821
509 Ga0068855_100306062
510 Ga0068856_100363415
511 Ga0068852_100085284
512 Ga0068859_101255521
513 Ga0081455_10040418
514 Ga0081455_10043286
515 Ga0081455_10097147
516 Ga0081538_10000043
517 Ga0081538_10003176
518 Ga0081538_10008251
519 Ga0081538_10014658
520 Ga0081538_10022360
521 Ga0081538_10058135
522 Ga0081538_10059772
523 Ga0070717_10011023
524 Ga0070717_10016012
525 Ga0070715_10009602
526 Ga0070716_100037561
527 Ga0070712_100034028
528 Ga0097621_100185375
529 Ga0068871_100927447
530 Ga0075428_100218303
531 Ga0075428_101145425
532 Ga0075430_100041487
533 Ga0075429_100137011
534 Ga0097620_101255547
535 Ga0105251_10100170
536 Ga0105240_10110154
537 Ga0105240_10667708
538 Ga0105247_10497604
539 Ga0114129_10005345
540 Ga0105241_10096462
541 Ga0105241_10283371
542 Ga0105237_10795308
543 Ga0105238_10354487
544 Ga0105238_10898615
545 Ga0157373_10162348
546 Ga0157373_10572786
547 Ga0157371_10072094
548 Ga0157370_10029792
549 Ga0157370_10587161
550 Ga0157370_11251169
551 Ga0157369_10034321
552 Ga0157369_10081681
553 Ga0157374_10023100
554 Ga0157372_12125899
555 Ga0163163_11154400
556 Ga0182008_10006843
557 Ga0182008_10676638
558 Ga0157379_10287856
559 Ga0182006_1010744
560 Ga0182007_10007092
561 Ga0206356_11318110
562 Ga0206354_10516362
563 Ga0206354_11248895
564 Ga0206353_10127145
565 Ga0206353_10829062
566 Ga0213871_10008275
567 Ga0213871_10017072
568 Ga0207685_10015949
569 Ga0207699_10040090
570 Ga0207699_10269031
571 Ga0207705_10122858
572 Ga0207705_10161142
573 Ga0207705_10169397
574 Ga0207654_10225113
575 Ga0207707_10047911
576 Ga0207707_10074774
577 Ga0207707_10178047
578 Ga0207707_10232791
579 Ga0207695_10302506
580 Ga0207671_10567436
581 Ga0207693_10002992
582 Ga0207663_10017338
583 Ga0207663_10532085
584 Ga0207660_10185621
585 Ga0207660_10597043
586 Ga0207657_10009122
587 Ga0207657_10024058
588 Ga0207657_10087820
589 Ga0207657_10175451
590 Ga0207657_10428155
591 Ga0207649_10071062
592 Ga0207652_10006261
593 Ga0207652_10060270
594 Ga0207652_10089285
595 Ga0207652_10153587
596 Ga0207652_10229982
597 Ga0207652_10949584
598 Ga0207646_10073448
599 Ga0207694_10734503
600 Ga0207687_10186918
601 Ga0207700_10093252
602 Ga0207700_10439855
603 Ga0207664_10029811
604 Ga0207664_10091921
605 Ga0207664_10262062
606 Ga0207664_10343346
607 Ga0207664_10572933
608 Ga0207644_10053950
609 Ga0207690_10606471
610 Ga0207690_11062141
611 Ga0207665_10000070
612 Ga0207661_10165185
613 Ga0207661_11268329
614 Ga0207679_10678371
615 Ga0207667_10104427
616 Ga0207667_10152589
617 Ga0207667_10999912
618 Ga0207640_10032513
619 Ga0207639_10504756
620 Ga0207639_10524777
621 Ga0207639_10775917
622 Ga0207678_10439040
623 Ga0207702_10333012
624 Ga0207698_10089227
625 Ga0265319_1084080
626 Ga0265334_10009863
627 Ga0265334_10129567
628 Ga0265323_10091445
629 Ga0265338_10011084
630 Ga0265338_10013886
631 Ga0265338_10086777
632 Ga0265338_10599854
633 Ga0265338_10678874
634 Ga0265338_10687470
635 Ga0265330_10069502
636 Ga0265320_10057262
637 Ga0265325_10052206
638 Ga0265329_10001736
639 Ga0265327_10020427
640 Ga0265313_10033218
641 Ga0265342_10479291
642 Ga0307406_10607448
643 Ga0373940_0045866
644 Ga0373939_0395465
645 Ga0373946_0328785
646 Ga0373961_0269934
647 Ga0373947_0249685
648 Ga0373925_1466402
649 Ga0395899_0009475
650 Ga0395899_0013856
651 Ga0395899_0042176
652 Ga0395899_0103937
653 Ga0395900_0004419
654 Ga0395900_0909826
655 Ga0395900_1443815
656 Ga0395898_0056047
657 Ga0395898_0488403
658 Ga0395898_0635530
659 Ga0395898_0636229
660 Ga0395898_0829730
661 Ga0395898_1245920
662 Ga0395898_1593195
663 Ga0395905_0017747
664 Ga0395905_0025436
665 Ga0395905_0109537
666 Ga0395901_0157219
667 Ga0395901_0492761
668 Ga0395901_1208796
669 Ga0242420_013647
670 Ga0436360_0665838
671 Ga0436360_1011977
672 Ga0451795_1563686
673 Ga0439456_075418
674 Ga0439459_0025307
675 Ga0439460_0071482
676 Ga0451577_0508578
677 Ga0466969_0319956
678 Ga0466972_0183753
679 Ga0466965_0170480
680 Ga0466966_0007789
681 Ga0466966_0041313
682 Ga0466966_0041732
683 Ga0466961_0016634
684 Ga0466961_0165230
685 Ga0466963_0002598
686 Ga0466963_0093775
687 Ga0466963_0601952
688 Ga0466963_0607569
689 Ga0466963_1235789
690 Ga0466964_0660878
691 Ga0466971_0042345
692 Ga0466968_0053290
693 Ga0466968_0090748
694 Ga0466968_0211337
695 Ga0466968_0558859
696 Ga0466957_0151498
697 Ga0466957_0153252
698 Ga0466957_0178946
699 Ga0466957_0497689
700 Ga0466957_0799620
701 Ga0466959_0002669
702 Ga0466959_0087589
703 Ga0466959_0342589
704 Ga0451576_1132348
705 Ga0466958_0021182
706 Ga0466958_0056558
707 Ga0466958_0094016
708 Ga0466958_0110417
709 Ga0466958_0149354
710 Ga0466958_0373591
711 Ga0466967_0000153
712 Ga0466967_0054541
713 Ga0466967_0086295
714 Ga0466967_0161138
715 Ga0466967_0205843
716 Ga0466967_0911403
717 Ga0466967_1508679
718 Ga0466967_1565110
719 Ga0495592_0041625
720 Ga0495592_0439504
721 Ga0495603_0263527
722 Ga0495629_0159714
723 Ga0495641_0008429
724 Ga0495641_0392599
725 Ga0495651_0099870
726 Ga0495653_0028915
727 Ga0495582_0624298
728 Ga0495608_0176979
729 Ga0495608_0391242
730 Ga0495618_0370454
731 Ga0495628_0112456
732 Ga0495628_0433330
733 Ga0495630_0201418
734 Ga0495630_1082224
735 Ga0495652_0260226
736 Ga0495586_0006586
737 Ga0495645_0179706
738 Ga0495667_0353297
739 Ga0495667_0444076
740 Ga0495656_0153758
741 Ga0495634_0106384
742 Ga0495635_0517562
743 Ga0495657_0136477
744 Ga0495599_0010726
745 Ga0495646_0088341
746 Ga0495646_0151267
747 Ga0495658_0189390
748 Ga0495658_0285870
749 Ga0495613_0087077
750 Ga0495624_0262851
751 Ga0495624_0401067
752 Ga0495600_0062650
753 Ga0495600_0096324
754 Ga0495674_0107820
755 Ga0495674_0544244
756 Ga0495676_0445087
757 Ga0495602_0027786
758 Ga0495602_1086710
759 Ga0496100_0085337
760 Ga0496101_0020033
761 Ga0496102_0076686
762 Ga0496102_0103001
763 Ga0496102_0112125
764 Ga0496103_0020716
765 Ga0496103_0040179
766 Ga0496104_0231060
767 Ga0496104_1310825
768 Ga0496105_0093671
769 Ga0496105_1340420
770 Ga0496106_0018533
771 Ga0496106_0037663
772 Ga0496107_0104224
773 Ga0496107_0156874
774 Ga0496109_0118681
775 Ga0496109_0298840
776 Ga0496110_0013745
777 Ga0496111_0112857
778 Ga0496111_0312252
779 Ga0496112_0011692
780 Ga0496112_0034303
781 Ga0496112_0044782
782 Ga0496112_0085062
783 Ga0496112_0105788
784 Ga0496112_0776579
785 Ga0496113_0039372
786 Ga0496113_0047186
787 Ga0496113_0066684
788 Ga0496114_0006948
789 Ga0496114_0767382
790 Ga0501031_0000214
791 Ga0501031_0000304
792 Ga0501031_0255185
793 Ga0501031_0779276
794 Ga0501032_0018981
795 Ga0501033_0000428
796 Ga0501033_0020323
797 Ga0501033_0135975
798 Ga0501033_0290725
799 Ga0501034_0083327
800 Ga0501034_0328610
801 Ga0501036_0183734
802 Ga0501037_0051956
803 Ga0501037_0265804
804 Ga0501038_0000273
805 Ga0501038_0095671
806 Ga0501038_0115211
807 Ga0501039_0000436
808 Ga0501039_0054109
809 Ga0501039_0261797
810 Ga0501039_0907183
811 Ga0501040_0000284
812 Ga0501040_0000350
813 Ga0501040_0007884
814 Ga0501040_0013075
815 Ga0501040_0071056
816 Ga0501040_1399640
817 Ga0501041_0001099
818 Ga0501041_0001452
819 Ga0501041_0034777
820 Ga0501041_0091546
821 Ga0501041_0721221
822 Ga0501041_0763334
823 Ga0501042_0000498
824 Ga0501042_0000810
825 Ga0501042_0854372
826 Ga0501042_0952109
827 Ga0501043_0011225
828 Ga0501043_0717594
829 Ga0501046_0001706
830 Ga0501046_0020198
831 Ga0501046_0269900
832 Ga0501046_0514281
833 Ga0501047_0001281
834 Ga0501048_0003889
835 Ga0501048_0018266
836 Ga0501048_0023806
837 Ga0501048_0856288
838 Ga0501067_0027526
839 Ga0501067_0160272
840 Ga0501067_0300130
841 Ga0501068_0001331
842 Ga0501068_0005687
843 Ga0501068_0067593
844 Ga0501068_1007832
845 Ga0501069_0006981
846 Ga0501069_0069535
847 Ga0501069_0115967
848 Ga0501069_0206133
849 Ga0501070_0004591
850 Ga0501070_0015606
851 Ga0501070_0415310
852 Ga0501070_0461158
853 Ga0501071_0000091
854 Ga0501071_0002769
855 Ga0501071_0084646
856 Ga0501071_0860758
857 Ga0501072_0003281
858 Ga0501072_0280819
859 Ga0501072_0400781
860 Ga0501073_0070247
861 Ga0501074_0004681
862 Ga0501074_0134808
863 Ga0501075_0001784
864 Ga0501075_0008806
865 Ga0501075_0015237
866 Ga0501075_0103183
867 Ga0501076_0000296
868 Ga0501076_0001903
869 Ga0501076_0002239
870 Ga0501076_0310764
871 Ga0501076_0908548
872 Ga0501077_0003088
873 Ga0501077_0010331
874 Ga0501077_0013136
875 Ga0501077_0106567
876 Ga0501077_0197047
877 Ga0501079_0000904
878 Ga0501079_0001871
879 Ga0501079_0018440
880 Ga0501079_0103129
881 Ga0501079_0250447
882 Ga0501079_0253015
883 Ga0501080_0039004
884 Ga0501080_0056534
885 Ga0501080_0543505
886 Ga0501080_1408734
887 Ga0501081_0000099
888 Ga0501081_0007971
889 Ga0501081_0030852
890 Ga0501081_0432546
891 Ga0501083_0001273
892 Ga0501083_0130904
893 Ga0501035_0004160
894 Ga0501035_0022334
895 Ga0501035_0406956
896 Ga0501044_0007728
897 Ga0501044_0067724
898 Ga0501045_0000770
899 Ga0501045_0003529
900 Ga0501045_0010199
901 Ga0501045_0543929
902 nmdc:mga05p37_2024_c1
903 nmdc:mga09592_9117_c1
904 nmdc:mga0qj67_145734_c1
905 nmdc:mga0qj67_186279_c1
906 nmdc:mga0qj67_40372_c1
907 nmdc:mga06r32_231221_c1
908 nmdc:mga0a205_1143665_c1
909 Ga0495601_0026886
910 Ga0495595_0087143
911 Ga0495619_0015432
912 Ga0501084_0001310
913 Ga0501084_0005992
914 Ga0501084_0086426
915 Ga0501084_0117368
916 Ga0501084_0205080
917 Ga0501084_0223956
918 Ga0501082_0001487
919 Ga0501082_0005780
920 Ga0501082_0083630
921 Ga0501082_0164688
922 Ga0501082_0301571
923 Ga0530510_0000824
924 Ga0530510_0003958
925 Ga0530510_0012147
926 Ga0530510_0059603
927 Ga0530510_0652986
928 Ga0530510_0847215

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01668

SmpB

SmpB protein

10

147

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ob7-assembly1.cif.gz_B structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.9599 8 131
1p6v-assembly2.cif.gz_C crystal structure of the trna domain of transfer-messenger rna in complex with smpb 0.9525 8 129
2ob7-assembly1.cif.gz_C structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.9504 8 125
7ljp-assembly2.cif.gz_B structure of thermotoga maritima smpb 0.95 8 129
2ob7-assembly1.cif.gz_B structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.9295 8 131
ID Description Score Start End Superfamily
af_P0A832_7_135_2.40.280.10 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.9608 5 129 2.40.280.10
2czjC00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.9301 13 129 2.40.280.10
af_P0A832_7_135_2.40.280.10 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.9244 5 129 2.40.280.10
2czjC00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.893 13 129 2.40.280.10
1j1hA00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.7139 9 129 2.40.280.10
ID Description Score Start End GO Terms
AF-A7L9H9-F1-model_v4 SmpB 0.9763 23 125 GO:0003723
GO:0005829
AF-A0A3C2C3N6-F1-model_v4 SsrA-binding protein 0.9737 8 120 GO:0003723
GO:0005829
AF-A0A660ZPQ7-F1-model_v4 SsrA-binding protein 0.9701 7 129 GO:0003723
GO:0005829
AF-A0A382PES5-F1-model_v4 SsrA-binding protein 0.9698 9 112 GO:0003723
GO:0005829
AF-A0A381Z638-F1-model_v4 SsrA-binding protein 0.969 5 129 GO:0003723
GO:0005829

Map