F449327
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 464 | 273 | 464 | 125 |
Family's Representative Sequence
| Representative Sequence | 3300035170|Ga0373943_0236321|Ga0373943_0236321_23_430 |
| Length | 117 |
| Sequence | MNETQRSFDAGRPRYMISVAAELVGMHPQTLRIYEAKGLVTPQRTAGNTRLYSEADLDRLRLIQQLTTELGLNLAGVEHVIRLEEQITQVHKQYRRDLVPYDPTGVELVPKRWTSRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 3 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 48 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 49 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 52 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 56 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 121 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 124 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 125 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 126 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 127 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 128 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 129 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 130 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 131 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 132 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 133 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 134 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 135 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 136 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 137 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 138 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 139 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 140 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 141 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 142 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 143 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 144 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 145 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 146 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 147 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 148 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 149 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 150 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 151 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 152 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 153 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 154 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 212 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 213 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 214 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 215 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 216 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 217 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 220 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 221 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 222 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 223 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 224 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 225 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 226 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 250 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 251 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 252 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 260 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.65 |
| Nodule | 0 |
| Rhizoplane | 11.42 |
| Rhizosphere | 87.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100072544 | 3300005329 | Bacteria | 3213 |
| 2 | Ga0070683_101946737 | 3300005329 | Bacteria | 565 |
| 3 | Ga0068869_100314903 | 3300005334 | Bacteria | 1267 |
| 4 | Ga0070666_10662199 | 3300005335 | Unclassified | 764 |
| 5 | Ga0068868_100264115 | 3300005338 | Bacteria | 1453 |
| 6 | Ga0068868_100499741 | 3300005338 | Bacteria | 1065 |
| 7 | Ga0070689_100402856 | 3300005340 | Bacteria | 1157 |
| 8 | Ga0070691_10015309 | 3300005341 | Bacteria | 3523 |
| 9 | Ga0070687_100128969 | 3300005343 | Bacteria | 1457 |
| 10 | Ga0070687_101262967 | 3300005343 | Unclassified | 547 |
| 11 | Ga0070661_100414472 | 3300005344 | Bacteria | 1067 |
| 12 | Ga0070668_100519839 | 3300005347 | Bacteria | 1033 |
| 13 | Ga0070668_100551073 | 3300005347 | Bacteria | 1004 |
| 14 | Ga0070668_100816715 | 3300005347 | Bacteria | 829 |
| 15 | Ga0070674_100271843 | 3300005356 | Unclassified | 1340 |
| 16 | Ga0070673_100516528 | 3300005364 | Bacteria | 1082 |
| 17 | Ga0070688_100085035 | 3300005365 | Bacteria | 2055 |
| 18 | Ga0070659_101054705 | 3300005366 | Bacteria | 715 |
| 19 | Ga0070713_100409180 | 3300005436 | Unclassified | 1268 |
| 20 | Ga0070700_100404985 | 3300005441 | Bacteria | 1027 |
| 21 | Ga0070694_100101087 | 3300005444 | Bacteria | 2040 |
| 22 | Ga0070708_100134452 | 3300005445 | Bacteria | 2290 |
| 23 | Ga0070708_100340349 | 3300005445 | Bacteria | 1414 |
| 24 | Ga0070678_100012613 | 3300005456 | Bacteria | 5264 |
| 25 | Ga0070662_100301050 | 3300005457 | Bacteria | 1303 |
| 26 | Ga0068867_100240280 | 3300005459 | Bacteria | 1468 |
| 27 | Ga0068867_100704878 | 3300005459 | Bacteria | 891 |
| 28 | Ga0068867_100994807 | 3300005459 | Bacteria | 760 |
| 29 | Ga0070685_10203904 | 3300005466 | Bacteria | 1287 |
| 30 | Ga0070707_100221649 | 3300005468 | Bacteria | 1842 |
| 31 | Ga0070698_100007005 | 3300005471 | Bacteria | 12211 |
| 32 | Ga0070698_100051187 | 3300005471 | Bacteria | 4208 |
| 33 | Ga0074259_10281497 | 3300005507 | Bacteria | 759 |
| 34 | Ga0070699_100424960 | 3300005518 | Bacteria | 1203 |
| 35 | Ga0070679_100034278 | 3300005530 | Bacteria | 5031 |
| 36 | Ga0070684_100047835 | 3300005535 | Bacteria | 3708 |
| 37 | Ga0070684_100056916 | 3300005535 | Bacteria | 3413 |
| 38 | Ga0070684_100173715 | 3300005535 | Bacteria | 1958 |
| 39 | Ga0070684_100244680 | 3300005535 | Bacteria | 1639 |
| 40 | Ga0070697_100918106 | 3300005536 | Bacteria | 777 |
| 41 | Ga0070686_100988014 | 3300005544 | Unclassified | 690 |
| 42 | Ga0070695_100515526 | 3300005545 | Unclassified | 927 |
| 43 | Ga0070693_100018856 | 3300005547 | Bacteria | 3609 |
| 44 | Ga0070693_101104746 | 3300005547 | Bacteria | 605 |
| 45 | Ga0070665_101216754 | 3300005548 | Bacteria | 764 |
| 46 | Ga0070704_100293180 | 3300005549 | Bacteria | 1352 |
| 47 | Ga0070704_100309221 | 3300005549 | Bacteria | 1320 |
| 48 | Ga0070704_100585269 | 3300005549 | Bacteria | 979 |
| 49 | Ga0070704_100768871 | 3300005549 | Unclassified | 859 |
| 50 | Ga0070664_100065896 | 3300005564 | Bacteria | 3092 |
| 51 | Ga0070664_100247477 | 3300005564 | Bacteria | 1602 |
| 52 | Ga0070664_100580224 | 3300005564 | Bacteria | 1039 |
| 53 | Ga0068857_100026637 | 3300005577 | Bacteria | 5096 |
| 54 | Ga0068857_100571154 | 3300005577 | Bacteria | 1067 |
| 55 | Ga0068854_100023298 | 3300005578 | Bacteria | 4228 |
| 56 | Ga0068854_100088626 | 3300005578 | Bacteria | 2298 |
| 57 | Ga0068856_100009977 | 3300005614 | Bacteria | 9220 |
| 58 | Ga0068856_100039121 | 3300005614 | Bacteria | 4657 |
| 59 | Ga0068856_100116403 | 3300005614 | Bacteria | 2673 |
| 60 | Ga0070702_101692199 | 3300005615 | Unclassified | 526 |
| 61 | Ga0068852_100118848 | 3300005616 | Bacteria | 2416 |
| 62 | Ga0068859_100664249 | 3300005617 | Bacteria | 1134 |
| 63 | Ga0068864_100382138 | 3300005618 | Bacteria | 1335 |
| 64 | Ga0068866_10110587 | 3300005718 | Bacteria | 1532 |
| 65 | Ga0068866_10438952 | 3300005718 | Unclassified | 851 |
| 66 | Ga0068861_100100149 | 3300005719 | Bacteria | 2303 |
| 67 | Ga0068861_101431812 | 3300005719 | Bacteria | 676 |
| 68 | Ga0068870_10014321 | 3300005840 | Bacteria | 3745 |
| 69 | Ga0068870_10388775 | 3300005840 | Bacteria | 905 |
| 70 | Ga0068858_101445433 | 3300005842 | Unclassified | 678 |
| 71 | Ga0068860_100362727 | 3300005843 | Bacteria | 1428 |
| 72 | Ga0068860_102369963 | 3300005843 | Bacteria | 551 |
| 73 | Ga0081455_10026545 | 3300005937 | Bacteria | 5323 |
| 74 | Ga0081455_10050398 | 3300005937 | Bacteria | 3581 |
| 75 | Ga0081539_10000384 | 3300005985 | Bacteria | 95594 |
| 76 | Ga0081539_10001616 | 3300005985 | Bacteria | 36968 |
| 77 | Ga0075432_10233656 | 3300006058 | Bacteria | 740 |
| 78 | Ga0070712_100343310 | 3300006175 | Unclassified | 1220 |
| 79 | Ga0070712_101655875 | 3300006175 | Bacteria | 560 |
| 80 | Ga0075362_10385572 | 3300006177 | Bacteria | 705 |
| 81 | Ga0075366_10285849 | 3300006195 | Bacteria | 1008 |
| 82 | Ga0097621_100254225 | 3300006237 | Bacteria | 1539 |
| 83 | Ga0068871_100984295 | 3300006358 | Bacteria | 785 |
| 84 | Ga0075428_101493688 | 3300006844 | Unclassified | 708 |
| 85 | Ga0075430_100102386 | 3300006846 | Bacteria | 2391 |
| 86 | Ga0075433_10910559 | 3300006852 | Bacteria | 767 |
| 87 | Ga0075434_100637633 | 3300006871 | Bacteria | 1084 |
| 88 | Ga0075429_100136475 | 3300006880 | Bacteria | 2147 |
| 89 | Ga0068865_100523267 | 3300006881 | Bacteria | 992 |
| 90 | Ga0068865_100715782 | 3300006881 | Bacteria | 857 |
| 91 | Ga0068865_100788391 | 3300006881 | Bacteria | 819 |
| 92 | Ga0075436_100503518 | 3300006914 | Bacteria | 886 |
| 93 | Ga0075436_100974683 | 3300006914 | Bacteria | 636 |
| 94 | Ga0097620_100664249 | 3300006931 | Bacteria | 1134 |
| 95 | Ga0111539_10035896 | 3300009094 | Bacteria | 6001 |
| 96 | Ga0111539_10385283 | 3300009094 | Bacteria | 1632 |
| 97 | Ga0111539_10928379 | 3300009094 | Bacteria | 1012 |
| 98 | Ga0105245_10052562 | 3300009098 | Bacteria | 3654 |
| 99 | Ga0105245_10087549 | 3300009098 | Bacteria | 2859 |
| 100 | Ga0105245_10706165 | 3300009098 | Bacteria | 1042 |
| 101 | Ga0105247_10935670 | 3300009101 | Bacteria | 672 |
| 102 | Ga0114129_10131020 | 3300009147 | Bacteria | 3444 |
| 103 | Ga0105243_10318080 | 3300009148 | Bacteria | 1417 |
| 104 | Ga0105243_12514045 | 3300009148 | Bacteria | 554 |
| 105 | Ga0105242_10419050 | 3300009176 | Bacteria | 1254 |
| 106 | Ga0105242_10726028 | 3300009176 | Bacteria | 975 |
| 107 | Ga0105248_10444487 | 3300009177 | Bacteria | 1461 |
| 108 | Ga0105249_10106625 | 3300009553 | Bacteria | 2644 |
| 109 | Ga0105249_10647322 | 3300009553 | Bacteria | 1114 |
| 110 | Ga0105249_10989084 | 3300009553 | Bacteria | 910 |
| 111 | Ga0105249_11424691 | 3300009553 | Unclassified | 765 |
| 112 | Ga0105239_10116580 | 3300010375 | Bacteria | 2964 |
| 113 | Ga0105246_10058598 | 3300011119 | Bacteria | 2669 |
| 114 | Ga0157371_10847307 | 3300013102 | Bacteria | 691 |
| 115 | Ga0157369_10895437 | 3300013105 | Bacteria | 910 |
| 116 | Ga0163162_10205580 | 3300013306 | Bacteria | 2098 |
| 117 | Ga0157375_10174208 | 3300013308 | Bacteria | 2300 |
| 118 | Ga0157375_10290332 | 3300013308 | Bacteria | 1798 |
| 119 | Ga0163163_10141163 | 3300014325 | Bacteria | 2451 |
| 120 | Ga0163163_10267960 | 3300014325 | Bacteria | 1759 |
| 121 | Ga0157380_10819893 | 3300014326 | Bacteria | 949 |
| 122 | Ga0157377_10182938 | 3300014745 | Bacteria | 1319 |
| 123 | Ga0157377_10311315 | 3300014745 | Bacteria | 1043 |
| 124 | Ga0157379_10271236 | 3300014968 | Bacteria | 1543 |
| 125 | Ga0157379_11105527 | 3300014968 | Unclassified | 759 |
| 126 | Ga0157376_10679444 | 3300014969 | Bacteria | 1033 |
| 127 | Ga0207642_10296092 | 3300025899 | Unclassified | 936 |
| 128 | Ga0207642_11115853 | 3300025899 | Bacteria | 510 |
| 129 | Ga0207643_10013055 | 3300025908 | Bacteria | 4491 |
| 130 | Ga0207707_10352379 | 3300025912 | Bacteria | 1268 |
| 131 | Ga0207693_10266141 | 3300025915 | Bacteria | 1344 |
| 132 | Ga0207663_11201885 | 3300025916 | Bacteria | 610 |
| 133 | Ga0207660_10211906 | 3300025917 | Bacteria | 1517 |
| 134 | Ga0207660_11068979 | 3300025917 | Bacteria | 658 |
| 135 | Ga0207660_11503783 | 3300025917 | Bacteria | 544 |
| 136 | Ga0207662_10118864 | 3300025918 | Bacteria | 1655 |
| 137 | Ga0207657_10858295 | 3300025919 | Bacteria | 700 |
| 138 | Ga0207657_11166159 | 3300025919 | Unclassified | 587 |
| 139 | Ga0207652_10023577 | 3300025921 | Bacteria | 5098 |
| 140 | Ga0207652_11263361 | 3300025921 | Unclassified | 641 |
| 141 | Ga0207646_10176637 | 3300025922 | Bacteria | 1929 |
| 142 | Ga0207687_10012647 | 3300025927 | Bacteria | 5514 |
| 143 | Ga0207687_10037058 | 3300025927 | Bacteria | 3325 |
| 144 | Ga0207644_10408488 | 3300025931 | Bacteria | 1111 |
| 145 | Ga0207690_10576098 | 3300025932 | Bacteria | 917 |
| 146 | Ga0207706_10020046 | 3300025933 | Bacteria | 6008 |
| 147 | Ga0207706_10166914 | 3300025933 | Bacteria | 1935 |
| 148 | Ga0207686_11029137 | 3300025934 | Bacteria | 669 |
| 149 | Ga0207669_10149099 | 3300025937 | Unclassified | 1636 |
| 150 | Ga0207669_11896928 | 3300025937 | Unclassified | 509 |
| 151 | Ga0207704_10257498 | 3300025938 | Bacteria | 1314 |
| 152 | Ga0207704_10546847 | 3300025938 | Bacteria | 940 |
| 153 | Ga0207691_10127855 | 3300025940 | Bacteria | 2247 |
| 154 | Ga0207711_10607557 | 3300025941 | Bacteria | 1020 |
| 155 | Ga0207689_10062401 | 3300025942 | Bacteria | 3065 |
| 156 | Ga0207661_10003871 | 3300025944 | Bacteria | 10436 |
| 157 | Ga0207661_10031728 | 3300025944 | Bacteria | 4086 |
| 158 | Ga0207661_10490247 | 3300025944 | Bacteria | 1122 |
| 159 | Ga0207661_10505729 | 3300025944 | Bacteria | 1104 |
| 160 | Ga0207679_10043133 | 3300025945 | Bacteria | 3246 |
| 161 | Ga0207679_10062312 | 3300025945 | Bacteria | 2779 |
| 162 | Ga0207679_10160194 | 3300025945 | Bacteria | 1842 |
| 163 | Ga0207667_11373839 | 3300025949 | Bacteria | 680 |
| 164 | Ga0207651_10528884 | 3300025960 | Bacteria | 1023 |
| 165 | Ga0207712_10235437 | 3300025961 | Bacteria | 1472 |
| 166 | Ga0207712_11877161 | 3300025961 | Bacteria | 537 |
| 167 | Ga0207668_10582233 | 3300025972 | Bacteria | 973 |
| 168 | Ga0207668_10591262 | 3300025972 | Unclassified | 966 |
| 169 | Ga0207640_10146856 | 3300025981 | Bacteria | 1727 |
| 170 | Ga0207677_10034713 | 3300026023 | Bacteria | 3269 |
| 171 | Ga0207703_10501435 | 3300026035 | Unclassified | 1139 |
| 172 | Ga0207639_10175904 | 3300026041 | Bacteria | 1817 |
| 173 | Ga0207678_10524160 | 3300026067 | Bacteria | 1034 |
| 174 | Ga0207708_10172020 | 3300026075 | Bacteria | 1716 |
| 175 | Ga0207702_10009148 | 3300026078 | Bacteria | 8335 |
| 176 | Ga0207702_10074114 | 3300026078 | Bacteria | 2937 |
| 177 | Ga0207648_10235063 | 3300026089 | Bacteria | 1631 |
| 178 | Ga0207648_10296114 | 3300026089 | Bacteria | 1450 |
| 179 | Ga0207648_11324749 | 3300026089 | Bacteria | 677 |
| 180 | Ga0207674_10003638 | 3300026116 | Bacteria | 18798 |
| 181 | Ga0207674_10103087 | 3300026116 | Bacteria | 2833 |
| 182 | Ga0207674_10580246 | 3300026116 | Bacteria | 1083 |
| 183 | Ga0207675_101936540 | 3300026118 | Bacteria | 608 |
| 184 | Ga0207683_10007827 | 3300026121 | Bacteria | 9148 |
| 185 | Ga0207698_10158139 | 3300026142 | Bacteria | 1978 |
| 186 | Ga0207428_10010765 | 3300027907 | Bacteria | 8154 |
| 187 | Ga0207428_10405467 | 3300027907 | Bacteria | 998 |
| 188 | Ga0268266_10526443 | 3300028379 | Bacteria | 1131 |
| 189 | Ga0268266_11058816 | 3300028379 | Bacteria | 785 |
| 190 | Ga0268264_10261399 | 3300028381 | Bacteria | 1613 |
| 191 | Ga0268264_11845161 | 3300028381 | Bacteria | 614 |
| 192 | Ga0265338_10797197 | 3300028800 | Bacteria | 647 |
| 193 | Ga0307408_101465193 | 3300031548 | Bacteria | 644 |
| 194 | Ga0307405_10001365 | 3300031731 | Bacteria | 10241 |
| 195 | Ga0307413_10000877 | 3300031824 | Bacteria | 10625 |
| 196 | Ga0307410_10007282 | 3300031852 | Bacteria | 6046 |
| 197 | Ga0307410_10554914 | 3300031852 | Bacteria | 952 |
| 198 | Ga0307406_10005538 | 3300031901 | Bacteria | 6907 |
| 199 | Ga0307406_10035232 | 3300031901 | Bacteria | 3076 |
| 200 | Ga0307407_10012037 | 3300031903 | Bacteria | 4145 |
| 201 | Ga0307407_10142424 | 3300031903 | Bacteria | 1548 |
| 202 | Ga0307412_10152042 | 3300031911 | Bacteria | 1709 |
| 203 | Ga0307409_100010908 | 3300031995 | Bacteria | 5688 |
| 204 | Ga0307409_100015513 | 3300031995 | Bacteria | 5003 |
| 205 | Ga0307409_100399719 | 3300031995 | Bacteria | 1312 |
| 206 | Ga0307416_100004186 | 3300032002 | Bacteria | 8649 |
| 207 | Ga0307416_100056111 | 3300032002 | Bacteria | 3176 |
| 208 | Ga0307414_10011957 | 3300032004 | Bacteria | 5118 |
| 209 | Ga0307411_10026891 | 3300032005 | Bacteria | 3471 |
| 210 | Ga0307415_100000572 | 3300032126 | Bacteria | 16174 |
| 211 | Ga0307415_100035216 | 3300032126 | Bacteria | 3268 |
| 212 | Ga0373952_0277909 | 3300035092 | Unclassified | 515 |
| 213 | Ga0373936_0123054 | 3300035113 | Bacteria | 1110 |
| 214 | Ga0373943_0236321 | 3300035170 | Bacteria | 1023 |
| 215 | Ga0373961_0197292 | 3300035241 | Bacteria | 708 |
| 216 | Ga0373931_0531054 | 3300035691 | Bacteria | 762 |
| 217 | Ga0373935_1136608 | 3300035692 | Bacteria | 582 |
| 218 | Ga0395899_0006796 | 3300037312 | Bacteria | 8865 |
| 219 | Ga0395899_0014163 | 3300037312 | Bacteria | 6084 |
| 220 | Ga0395899_0038569 | 3300037312 | Bacteria | 3578 |
| 221 | Ga0395900_0013001 | 3300037418 | Bacteria | 8505 |
| 222 | Ga0395900_0031576 | 3300037418 | Bacteria | 5444 |
| 223 | Ga0395900_0209713 | 3300037418 | Bacteria | 1967 |
| 224 | Ga0395900_0818230 | 3300037418 | Bacteria | 858 |
| 225 | Ga0395900_1932547 | 3300037418 | Unclassified | 501 |
| 226 | Ga0395898_0003238 | 3300037466 | Bacteria | 18294 |
| 227 | Ga0395898_0040316 | 3300037466 | Bacteria | 4618 |
| 228 | Ga0395898_0053569 | 3300037466 | Bacteria | 3940 |
| 229 | Ga0395898_0113553 | 3300037466 | Bacteria | 2596 |
| 230 | Ga0395898_0204245 | 3300037466 | Bacteria | 1885 |
| 231 | Ga0395898_0262533 | 3300037466 | Bacteria | 1647 |
| 232 | Ga0395898_1050753 | 3300037466 | Unclassified | 749 |
| 233 | Ga0395905_0001864 | 3300037471 | Bacteria | 24276 |
| 234 | Ga0395905_0007227 | 3300037471 | Bacteria | 11072 |
| 235 | Ga0395905_0043481 | 3300037471 | Bacteria | 4214 |
| 236 | Ga0395905_0122770 | 3300037471 | Bacteria | 2442 |
| 237 | Ga0395905_0189479 | 3300037471 | Bacteria | 1929 |
| 238 | Ga0395905_0339010 | 3300037471 | Bacteria | 1394 |
| 239 | Ga0395905_1089926 | 3300037471 | Unclassified | 702 |
| 240 | Ga0395905_1287708 | 3300037471 | Bacteria | 635 |
| 241 | Ga0395905_1431376 | 3300037471 | Unclassified | 595 |
| 242 | Ga0395901_0029559 | 3300038443 | Bacteria | 5642 |
| 243 | Ga0395901_0058333 | 3300038443 | Bacteria | 4015 |
| 244 | Ga0395901_0123828 | 3300038443 | Bacteria | 2716 |
| 245 | Ga0395901_0199835 | 3300038443 | Bacteria | 2095 |
| 246 | Ga0451853_0055024 | 3300041512 | Bacteria | 1380 |
| 247 | Ga0439448_0169387 | 3300042005 | Bacteria | 762 |
| 248 | Ga0450903_061155 | 3300042138 | Bacteria | 546 |
| 249 | Ga0439435_0047575 | 3300042436 | Bacteria | 1219 |
| 250 | Ga0466960_0334065 | 3300044901 | Bacteria | 861 |
| 251 | Ga0451576_0199058 | 3300045051 | Bacteria | 2092 |
| 252 | Ga0466967_1257139 | 3300045976 | Bacteria | 737 |
| 253 | Ga0495603_0185158 | 3300046455 | Bacteria | 1204 |
| 254 | Ga0495603_0773733 | 3300046455 | Bacteria | 548 |
| 255 | Ga0495590_0101105 | 3300046457 | Bacteria | 1024 |
| 256 | Ga0495591_034676 | 3300046458 | Bacteria | 1483 |
| 257 | Ga0495641_0139131 | 3300046461 | Unclassified | 1084 |
| 258 | Ga0495582_0028000 | 3300046473 | Bacteria | 3091 |
| 259 | Ga0495582_0144382 | 3300046473 | Bacteria | 1350 |
| 260 | Ga0495605_0030681 | 3300046474 | Bacteria | 2754 |
| 261 | Ga0495639_0687518 | 3300046475 | Unclassified | 528 |
| 262 | Ga0495584_0035765 | 3300046491 | Bacteria | 2510 |
| 263 | Ga0495585_0039141 | 3300046492 | Bacteria | 2666 |
| 264 | Ga0495585_0350079 | 3300046492 | Bacteria | 718 |
| 265 | Ga0495594_0358993 | 3300046499 | Bacteria | 830 |
| 266 | Ga0495596_0069261 | 3300046500 | Bacteria | 1371 |
| 267 | Ga0495607_0175315 | 3300046501 | Bacteria | 1079 |
| 268 | Ga0495607_0377641 | 3300046501 | Bacteria | 649 |
| 269 | Ga0495608_0454852 | 3300046511 | Bacteria | 779 |
| 270 | Ga0495616_0049947 | 3300046513 | Bacteria | 2094 |
| 271 | Ga0495616_0227906 | 3300046513 | Bacteria | 809 |
| 272 | Ga0495616_0386836 | 3300046513 | Bacteria | 577 |
| 273 | Ga0495620_0219829 | 3300046515 | Bacteria | 727 |
| 274 | Ga0495631_0084975 | 3300046518 | Bacteria | 1363 |
| 275 | Ga0495637_0034063 | 3300046520 | Bacteria | 2232 |
| 276 | Ga0495643_0283792 | 3300046522 | Unclassified | 761 |
| 277 | Ga0495644_0046503 | 3300046523 | Bacteria | 1631 |
| 278 | Ga0495644_0052695 | 3300046523 | Bacteria | 1528 |
| 279 | Ga0495663_0045293 | 3300046525 | Bacteria | 1348 |
| 280 | Ga0495663_0105125 | 3300046525 | Bacteria | 933 |
| 281 | Ga0495663_0293691 | 3300046525 | Bacteria | 584 |
| 282 | Ga0495642_0065575 | 3300046528 | Bacteria | 1512 |
| 283 | Ga0495642_0071156 | 3300046528 | Bacteria | 1455 |
| 284 | Ga0495665_0194906 | 3300046531 | Bacteria | 1051 |
| 285 | Ga0495640_0174812 | 3300046533 | Bacteria | 1371 |
| 286 | Ga0495586_0053854 | 3300046535 | Bacteria | 2180 |
| 287 | Ga0495586_0461956 | 3300046535 | Bacteria | 732 |
| 288 | Ga0495587_0211515 | 3300046536 | Bacteria | 1095 |
| 289 | Ga0495598_0118111 | 3300046537 | Bacteria | 896 |
| 290 | Ga0495609_0106343 | 3300046538 | Bacteria | 1213 |
| 291 | Ga0495609_0138746 | 3300046538 | Bacteria | 1038 |
| 292 | Ga0495621_0084779 | 3300046539 | Bacteria | 1187 |
| 293 | Ga0495597_0031067 | 3300046542 | Bacteria | 2432 |
| 294 | Ga0495667_0105699 | 3300046559 | Bacteria | 1820 |
| 295 | Ga0495656_0106694 | 3300046615 | Bacteria | 1304 |
| 296 | Ga0495656_0806984 | 3300046615 | Bacteria | 507 |
| 297 | Ga0495668_0060537 | 3300046616 | Bacteria | 2089 |
| 298 | Ga0495611_0135390 | 3300046648 | Bacteria | 1150 |
| 299 | Ga0495635_0160470 | 3300046663 | Bacteria | 1530 |
| 300 | Ga0495659_0006269 | 3300046664 | Bacteria | 3758 |
| 301 | Ga0495659_0195154 | 3300046664 | Bacteria | 829 |
| 302 | Ga0495588_0113594 | 3300046674 | Bacteria | 1427 |
| 303 | Ga0495657_0894460 | 3300046675 | Bacteria | 505 |
| 304 | Ga0495599_0481954 | 3300046678 | Bacteria | 732 |
| 305 | Ga0495647_0023995 | 3300046681 | Bacteria | 2217 |
| 306 | Ga0495658_0172206 | 3300046683 | Bacteria | 1340 |
| 307 | Ga0495669_0549350 | 3300046684 | Bacteria | 562 |
| 308 | Ga0495613_0157584 | 3300046689 | Bacteria | 1617 |
| 309 | Ga0495613_1047092 | 3300046689 | Unclassified | 522 |
| 310 | Ga0495670_0057036 | 3300046691 | Bacteria | 1960 |
| 311 | Ga0495671_0053022 | 3300046692 | Bacteria | 2014 |
| 312 | Ga0495649_0482089 | 3300046694 | Unclassified | 618 |
| 313 | Ga0495589_0136618 | 3300046794 | Bacteria | 1175 |
| 314 | Ga0495589_0302181 | 3300046794 | Bacteria | 741 |
| 315 | Ga0495589_0409534 | 3300046794 | Bacteria | 622 |
| 316 | Ga0495581_0023560 | 3300047315 | Bacteria | 3566 |
| 317 | Ga0495676_0097917 | 3300047321 | Bacteria | 2177 |
| 318 | Ga0495676_0381391 | 3300047321 | Bacteria | 938 |
| 319 | Ga0495680_0406736 | 3300047322 | Bacteria | 939 |
| 320 | Ga0495677_0025618 | 3300047445 | Bacteria | 2140 |
| 321 | Ga0495677_0042394 | 3300047445 | Bacteria | 1667 |
| 322 | Ga0495679_150163 | 3300047446 | Bacteria | 626 |
| 323 | Ga0495685_034252 | 3300047447 | Bacteria | 1745 |
| 324 | Ga0495614_0311728 | 3300048089 | Bacteria | 729 |
| 325 | Ga0495615_0025555 | 3300048090 | Bacteria | 1372 |
| 326 | Ga0495626_0071293 | 3300048091 | Bacteria | 1562 |
| 327 | Ga0496100_0010775 | 3300048903 | Bacteria | 5186 |
| 328 | Ga0496100_0021104 | 3300048903 | Bacteria | 3917 |
| 329 | Ga0496100_0120873 | 3300048903 | Bacteria | 1832 |
| 330 | Ga0496100_0287520 | 3300048903 | Bacteria | 1227 |
| 331 | Ga0496101_0051563 | 3300048904 | Bacteria | 2965 |
| 332 | Ga0496101_0069648 | 3300048904 | Bacteria | 2574 |
| 333 | Ga0496101_0207366 | 3300048904 | Bacteria | 1517 |
| 334 | Ga0496101_0850035 | 3300048904 | Bacteria | 719 |
| 335 | Ga0496102_0017881 | 3300048905 | Bacteria | 6217 |
| 336 | Ga0496102_0260196 | 3300048905 | Bacteria | 1636 |
| 337 | Ga0496102_0301266 | 3300048905 | Bacteria | 1511 |
| 338 | Ga0496102_1820387 | 3300048905 | Bacteria | 526 |
| 339 | Ga0496103_0089826 | 3300048906 | Bacteria | 1938 |
| 340 | Ga0496103_0485803 | 3300048906 | Bacteria | 791 |
| 341 | Ga0496104_0000617 | 3300048907 | Bacteria | 30492 |
| 342 | Ga0496104_0061664 | 3300048907 | Bacteria | 3555 |
| 343 | Ga0496105_0000147 | 3300048908 | Bacteria | 46556 |
| 344 | Ga0496105_0018500 | 3300048908 | Bacteria | 5603 |
| 345 | Ga0496105_0025367 | 3300048908 | Bacteria | 4826 |
| 346 | Ga0496105_0709627 | 3300048908 | Bacteria | 771 |
| 347 | Ga0496106_0299574 | 3300048909 | Bacteria | 1289 |
| 348 | Ga0496107_0043862 | 3300048910 | Bacteria | 3214 |
| 349 | Ga0496107_0069997 | 3300048910 | Bacteria | 2547 |
| 350 | Ga0496107_1247834 | 3300048910 | Bacteria | 533 |
| 351 | Ga0496108_0015314 | 3300048911 | Bacteria | 6256 |
| 352 | Ga0496108_0088555 | 3300048911 | Bacteria | 2630 |
| 353 | Ga0496108_0329165 | 3300048911 | Bacteria | 1332 |
| 354 | Ga0496108_0921069 | 3300048911 | Bacteria | 749 |
| 355 | Ga0496108_1653851 | 3300048911 | Bacteria | 528 |
| 356 | Ga0496109_0004593 | 3300048912 | Bacteria | 11528 |
| 357 | Ga0496109_0030399 | 3300048912 | Bacteria | 4841 |
| 358 | Ga0496109_0101486 | 3300048912 | Bacteria | 2670 |
| 359 | Ga0496109_0144023 | 3300048912 | Bacteria | 2229 |
| 360 | Ga0496109_0199209 | 3300048912 | Bacteria | 1882 |
| 361 | Ga0496109_1093736 | 3300048912 | Bacteria | 734 |
| 362 | Ga0496110_0007430 | 3300048913 | Bacteria | 8753 |
| 363 | Ga0496110_0007665 | 3300048913 | Bacteria | 8636 |
| 364 | Ga0496110_0024072 | 3300048913 | Bacteria | 5188 |
| 365 | Ga0496110_0211348 | 3300048913 | Bacteria | 1764 |
| 366 | Ga0496111_0003991 | 3300048914 | Bacteria | 9259 |
| 367 | Ga0496111_0005761 | 3300048914 | Bacteria | 7994 |
| 368 | Ga0496111_0069308 | 3300048914 | Bacteria | 2564 |
| 369 | Ga0496111_0645298 | 3300048914 | Bacteria | 773 |
| 370 | Ga0496112_0108987 | 3300048915 | Bacteria | 2740 |
| 371 | Ga0496112_0626791 | 3300048915 | Bacteria | 1006 |
| 372 | Ga0496112_1509940 | 3300048915 | Bacteria | 586 |
| 373 | Ga0496113_0052982 | 3300048916 | Bacteria | 3033 |
| 374 | Ga0496113_0090923 | 3300048916 | Bacteria | 2352 |
| 375 | Ga0496113_1479554 | 3300048916 | Bacteria | 524 |
| 376 | Ga0496114_0002427 | 3300048917 | Bacteria | 14222 |
| 377 | Ga0496114_0475443 | 3300048917 | Bacteria | 1106 |
| 378 | Ga0496115_0271512 | 3300048918 | Bacteria | 1393 |
| 379 | Ga0496115_0608719 | 3300048918 | Bacteria | 868 |
| 380 | Ga0501291_014733 | 3300049514 | Bacteria | 1174 |
| 381 | Ga0501032_0060793 | 3300049569 | Bacteria | 2534 |
| 382 | Ga0501033_0133117 | 3300049570 | Bacteria | 1800 |
| 383 | Ga0501034_0194398 | 3300049571 | Bacteria | 1990 |
| 384 | Ga0501036_0096344 | 3300049572 | Bacteria | 2501 |
| 385 | Ga0501036_0230013 | 3300049572 | Bacteria | 1556 |
| 386 | Ga0501038_0137162 | 3300049574 | Bacteria | 2003 |
| 387 | Ga0501038_0782953 | 3300049574 | Bacteria | 710 |
| 388 | Ga0501039_0211622 | 3300049575 | Bacteria | 1524 |
| 389 | Ga0501039_0815929 | 3300049575 | Bacteria | 727 |
| 390 | Ga0501040_0020553 | 3300049576 | Bacteria | 4401 |
| 391 | Ga0501040_0132210 | 3300049576 | Bacteria | 1755 |
| 392 | Ga0501041_0120918 | 3300049577 | Bacteria | 1627 |
| 393 | Ga0501042_0139231 | 3300049578 | Bacteria | 1749 |
| 394 | Ga0501043_0568393 | 3300049579 | Bacteria | 841 |
| 395 | Ga0501046_0125368 | 3300049580 | Bacteria | 1951 |
| 396 | Ga0501047_0318919 | 3300049581 | Bacteria | 1394 |
| 397 | Ga0501048_0040996 | 3300049582 | Bacteria | 3316 |
| 398 | Ga0501048_0714694 | 3300049582 | Bacteria | 719 |
| 399 | Ga0501068_0010774 | 3300049584 | Bacteria | 5141 |
| 400 | Ga0501068_0461335 | 3300049584 | Bacteria | 822 |
| 401 | Ga0501068_0920930 | 3300049584 | Bacteria | 575 |
| 402 | Ga0501069_0055297 | 3300049585 | Bacteria | 2211 |
| 403 | Ga0501069_0179793 | 3300049585 | Bacteria | 1222 |
| 404 | Ga0501070_0077653 | 3300049586 | Bacteria | 2748 |
| 405 | Ga0501070_0303738 | 3300049586 | Bacteria | 1300 |
| 406 | Ga0501071_0041228 | 3300049587 | Bacteria | 3306 |
| 407 | Ga0501071_0264436 | 3300049587 | Bacteria | 1299 |
| 408 | Ga0501072_0038530 | 3300049588 | Bacteria | 3751 |
| 409 | Ga0501072_0244792 | 3300049588 | Bacteria | 1428 |
| 410 | Ga0501072_1282960 | 3300049588 | Unclassified | 568 |
| 411 | Ga0501073_0314870 | 3300049589 | Bacteria | 1080 |
| 412 | Ga0501074_0122999 | 3300049590 | Bacteria | 1856 |
| 413 | Ga0501074_0209201 | 3300049590 | Bacteria | 1390 |
| 414 | Ga0501074_0227599 | 3300049590 | Bacteria | 1327 |
| 415 | Ga0501075_0110393 | 3300049591 | Bacteria | 2091 |
| 416 | Ga0501076_0003745 | 3300049592 | Bacteria | 10689 |
| 417 | Ga0501076_0031474 | 3300049592 | Bacteria | 4138 |
| 418 | Ga0501076_0190256 | 3300049592 | Bacteria | 1674 |
| 419 | Ga0501076_0794761 | 3300049592 | Bacteria | 781 |
| 420 | Ga0501077_0009366 | 3300049593 | Bacteria | 6084 |
| 421 | Ga0501077_0090471 | 3300049593 | Bacteria | 1939 |
| 422 | Ga0501077_0131739 | 3300049593 | Bacteria | 1585 |
| 423 | Ga0501209_130063 | 3300049656 | Bacteria | 751 |
| 424 | Ga0501217_028904 | 3300049661 | Bacteria | 1353 |
| 425 | Ga0501259_185781 | 3300049688 | Unclassified | 528 |
| 426 | Ga0501079_0090059 | 3300049741 | Bacteria | 2376 |
| 427 | Ga0501079_0238863 | 3300049741 | Bacteria | 1419 |
| 428 | Ga0501079_0348892 | 3300049741 | Bacteria | 1159 |
| 429 | Ga0501079_0961315 | 3300049741 | Bacteria | 673 |
| 430 | Ga0501080_0041568 | 3300049742 | Bacteria | 4283 |
| 431 | Ga0501081_0030904 | 3300049743 | Bacteria | 3628 |
| 432 | Ga0501081_1402301 | 3300049743 | Bacteria | 530 |
| 433 | Ga0501083_0239311 | 3300049744 | Bacteria | 1182 |
| 434 | Ga0501035_0410574 | 3300049822 | Bacteria | 1125 |
| 435 | Ga0501044_0459871 | 3300049823 | Bacteria | 1178 |
| 436 | Ga0501045_0152623 | 3300049824 | Bacteria | 1718 |
| 437 | Ga0501045_0700154 | 3300049824 | Bacteria | 747 |
| 438 | nmdc:mga03683_342683_c1 | 3300050489 | Bacteria | 706 |
| 439 | nmdc:mga05p37_267216_c1 | 3300050507 | Bacteria | 2045 |
| 440 | nmdc:mga09592_40684_c1 | 3300050508 | Bacteria | 3905 |
| 441 | nmdc:mga0qj67_394559_c1 | 3300050509 | Unclassified | 1117 |
| 442 | nmdc:mga06r32_69755_c1 | 3300050510 | Bacteria | 3397 |
| 443 | nmdc:mga08y16_11600_c1 | 3300050511 | Bacteria | 9258 |
| 444 | nmdc:mga08y16_19285_c1 | 3300050511 | Bacteria | 7187 |
| 445 | nmdc:mga08y16_799086_c1 | 3300050511 | Bacteria | 936 |
| 446 | nmdc:mga0n895_1038531_c1 | 3300050512 | Bacteria | 799 |
| 447 | nmdc:mga0a205_833855_c1 | 3300050515 | Bacteria | 769 |
| 448 | Ga0495601_0924789 | 3300053077 | Bacteria | 550 |
| 449 | Ga0495655_0316573 | 3300053083 | Bacteria | 539 |
| 450 | Ga0495595_0524645 | 3300053084 | Bacteria | 604 |
| 451 | Ga0495595_0609448 | 3300053084 | Bacteria | 558 |
| 452 | Ga0495619_0067780 | 3300053085 | Bacteria | 2383 |
| 453 | Ga0495619_0202518 | 3300053085 | Bacteria | 1374 |
| 454 | Ga0495619_0229951 | 3300053085 | Bacteria | 1285 |
| 455 | Ga0495619_0385657 | 3300053085 | Bacteria | 968 |
| 456 | Ga0501084_0741240 | 3300054114 | Bacteria | 828 |
| 457 | Ga0501082_0031092 | 3300060353 | Bacteria | 4601 |
| 458 | Ga0501082_0309758 | 3300060353 | Bacteria | 1375 |
| 459 | Ga0501082_0379836 | 3300060353 | Bacteria | 1233 |
| 460 | Ga0501082_1504426 | 3300060353 | Bacteria | 588 |
| 461 | Ga0530510_0020936 | 3300061734 | Bacteria | 4651 |
| 462 | Ga0530510_0023613 | 3300061734 | Bacteria | 4383 |
| 463 | Ga0530510_0217755 | 3300061734 | Bacteria | 1419 |
| 464 | Ga0530510_1490435 | 3300061734 | Bacteria | 519 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037312 | Ga0395899_0014163 | Ga0395899_0014163_351_713 | 102 |
| 2 | 3300037418 | Ga0395900_0013001 | Ga0395900_0013001_2854_3216 | 102 |
| 3 | 3300037466 | Ga0395898_0040316 | Ga0395898_0040316_1036_1398 | 102 |
| 4 | 3300037471 | Ga0395905_0007227 | Ga0395905_0007227_9842_10204 | 102 |
| 5 | 3300038443 | Ga0395901_0123828 | Ga0395901_0123828_2275_2637 | 102 |
| 6 | 3300044901 | Ga0466960_0334065 | Ga0466960_0334065_105_578 | 106 |
| 7 | 3300046455 | Ga0495603_0185158 | Ga0495603_0185158_389_751 | 106 |
| 8 | 3300005459 | Ga0068867_100994807 | Ga0068867_1009948072 | 109 |
| 9 | 3300005549 | Ga0070704_100585269 | Ga0070704_1005852691 | 109 |
| 10 | 3300006881 | Ga0068865_100715782 | Ga0068865_1007157823 | 109 |
| 11 | 3300026089 | Ga0207648_11324749 | Ga0207648_113247492 | 109 |
| 12 | 3300035113 | Ga0373936_0123054 | Ga0373936_0123054_614_1000 | 109 |
| 13 | 3300035170 | Ga0373943_0236321 | Ga0373943_0236321_23_430 | 109 |
| 14 | 3300046473 | Ga0495582_0028000 | Ga0495582_0028000_2316_2702 | 109 |
| 15 | 3300046475 | Ga0495639_0687518 | Ga0495639_0687518_115_501 | 109 |
| 16 | 3300046531 | Ga0495665_0194906 | Ga0495665_0194906_491_877 | 109 |
| 17 | 3300046535 | Ga0495586_0053854 | Ga0495586_0053854_1314_1700 | 109 |
| 18 | 3300046681 | Ga0495647_0023995 | Ga0495647_0023995_1559_1945 | 109 |
| 19 | 3300046689 | Ga0495613_1047092 | Ga0495613_1047092_23_409 | 109 |
| 20 | 3300047315 | Ga0495581_0023560 | Ga0495581_0023560_1515_1901 | 109 |
| 21 | 3300047321 | Ga0495676_0097917 | Ga0495676_0097917_1477_1863 | 109 |
| 22 | 3300048089 | Ga0495614_0311728 | Ga0495614_0311728_151_537 | 109 |
| 23 | 3300005719 | Ga0068861_101431812 | Ga0068861_1014318122 | 113 |
| 24 | 3300026118 | Ga0207675_101936540 | Ga0207675_1019365402 | 113 |
| 25 | 3300037418 | Ga0395900_0818230 | Ga0395900_0818230_218_619 | 113 |
| 26 | 3300037466 | Ga0395898_0204245 | Ga0395898_0204245_240_641 | 113 |
| 27 | 3300037471 | Ga0395905_0189479 | Ga0395905_0189479_892_1293 | 113 |
| 28 | 3300048911 | Ga0496108_1653851 | Ga0496108_1653851_24_407 | 113 |
| 29 | 3300005937 | Ga0081455_10050398 | Ga0081455_100503982 | 114 |
| 30 | 3300048904 | Ga0496101_0850035 | Ga0496101_0850035_349_702 | 114 |
| 31 | 3300049572 | Ga0501036_0230013 | Ga0501036_0230013_877_1257 | 114 |
| 32 | 3300060353 | Ga0501082_0379836 | Ga0501082_0379836_627_1007 | 114 |
| 33 | 3300005338 | Ga0068868_100499741 | Ga0068868_1004997412 | 115 |
| 34 | 3300005341 | Ga0070691_10015309 | Ga0070691_100153095 | 115 |
| 35 | 3300005347 | Ga0070668_100519839 | Ga0070668_1005198391 | 115 |
| 36 | 3300005445 | Ga0070708_100134452 | Ga0070708_1001344523 | 115 |
| 37 | 3300005459 | Ga0068867_100240280 | Ga0068867_1002402802 | 115 |
| 38 | 3300005471 | Ga0070698_100007005 | Ga0070698_1000070059 | 115 |
| 39 | 3300005518 | Ga0070699_100424960 | Ga0070699_1004249602 | 115 |
| 40 | 3300005545 | Ga0070695_100515526 | Ga0070695_1005155263 | 115 |
| 41 | 3300005578 | Ga0068854_100023298 | Ga0068854_1000232983 | 115 |
| 42 | 3300005719 | Ga0068861_100100149 | Ga0068861_1001001494 | 115 |
| 43 | 3300006914 | Ga0075436_100503518 | Ga0075436_1005035182 | 115 |
| 44 | 3300009098 | Ga0105245_10052562 | Ga0105245_100525622 | 115 |
| 45 | 3300014745 | Ga0157377_10311315 | Ga0157377_103113152 | 115 |
| 46 | 3300031852 | Ga0307410_10554914 | Ga0307410_105549142 | 115 |
| 47 | 3300031901 | Ga0307406_10005538 | Ga0307406_100055382 | 115 |
| 48 | 3300031903 | Ga0307407_10142424 | Ga0307407_101424243 | 115 |
| 49 | 3300031911 | Ga0307412_10152042 | Ga0307412_101520423 | 115 |
| 50 | 3300031995 | Ga0307409_100010908 | Ga0307409_1000109086 | 115 |
| 51 | 3300032002 | Ga0307416_100004186 | Ga0307416_1000041869 | 115 |
| 52 | 3300032126 | Ga0307415_100000572 | Ga0307415_1000005725 | 115 |
| 53 | 3300046455 | Ga0495603_0773733 | Ga0495603_0773733_51_401 | 115 |
| 54 | 3300046473 | Ga0495582_0144382 | Ga0495582_0144382_916_1266 | 115 |
| 55 | 3300046535 | Ga0495586_0461956 | Ga0495586_0461956_362_712 | 115 |
| 56 | 3300046683 | Ga0495658_0172206 | Ga0495658_0172206_742_1092 | 115 |
| 57 | 3300048912 | Ga0496109_1093736 | Ga0496109_1093736_97_447 | 115 |
| 58 | 3300048913 | Ga0496110_0211348 | Ga0496110_0211348_129_479 | 115 |
| 59 | 3300048914 | Ga0496111_0645298 | Ga0496111_0645298_60_410 | 115 |
| 60 | 3300049584 | Ga0501068_0920930 | Ga0501068_0920930_47_439 | 115 |
| 61 | 3300005547 | Ga0070693_101104746 | Ga0070693_1011047462 | 116 |
| 62 | 3300025917 | Ga0207660_10211906 | Ga0207660_102119063 | 116 |
| 63 | 3300046501 | Ga0495607_0377641 | Ga0495607_0377641_125_544 | 116 |
| 64 | 3300049571 | Ga0501034_0194398 | Ga0501034_0194398_740_1090 | 116 |
| 65 | 3300049590 | Ga0501074_0209201 | Ga0501074_0209201_680_1030 | 116 |
| 66 | 3300049592 | Ga0501076_0794761 | Ga0501076_0794761_352_744 | 116 |
| 67 | 3300009094 | Ga0111539_10928379 | Ga0111539_109283792 | 117 |
| 68 | 3300009101 | Ga0105247_10935670 | Ga0105247_109356702 | 117 |
| 69 | 3300009148 | Ga0105243_12514045 | Ga0105243_125140451 | 117 |
| 70 | 3300048906 | Ga0496103_0485803 | Ga0496103_0485803_117_500 | 117 |
| 71 | 3300049576 | Ga0501040_0132210 | Ga0501040_0132210_427_819 | 117 |
| 72 | 3300053083 | Ga0495655_0316573 | Ga0495655_0316573_18_407 | 117 |
| 73 | 3300054114 | Ga0501084_0741240 | Ga0501084_0741240_134_493 | 117 |
| 74 | 3300060353 | Ga0501082_0309758 | Ga0501082_0309758_530_922 | 117 |
| 75 | 3300061734 | Ga0530510_1490435 | Ga0530510_1490435_55_447 | 117 |
| 76 | 3300005564 | Ga0070664_100580224 | Ga0070664_1005802242 | 118 |
| 77 | 3300053084 | Ga0495595_0609448 | Ga0495595_0609448_61_426 | 118 |
| 78 | 3300005471 | Ga0070698_100051187 | Ga0070698_1000511872 | 119 |
| 79 | 3300005536 | Ga0070697_100918106 | Ga0070697_1009181062 | 119 |
| 80 | 3300009148 | Ga0105243_10318080 | Ga0105243_103180802 | 119 |
| 81 | 3300025916 | Ga0207663_11201885 | Ga0207663_112018852 | 119 |
| 82 | 3300025919 | Ga0207657_10858295 | Ga0207657_108582952 | 119 |
| 83 | 3300025933 | Ga0207706_10166914 | Ga0207706_101669143 | 119 |
| 84 | 3300025938 | Ga0207704_10257498 | Ga0207704_102574982 | 119 |
| 85 | 3300026089 | Ga0207648_10235063 | Ga0207648_102350633 | 119 |
| 86 | 3300035692 | Ga0373935_1136608 | Ga0373935_1136608_118_480 | 119 |
| 87 | 3300046511 | Ga0495608_0454852 | Ga0495608_0454852_299_661 | 119 |
| 88 | 3300046559 | Ga0495667_0105699 | Ga0495667_0105699_645_1007 | 119 |
| 89 | 3300046675 | Ga0495657_0894460 | Ga0495657_0894460_38_400 | 119 |
| 90 | 3300046694 | Ga0495649_0482089 | Ga0495649_0482089_28_417 | 119 |
| 91 | 3300047322 | Ga0495680_0406736 | Ga0495680_0406736_554_913 | 119 |
| 92 | 3300048911 | Ga0496108_0329165 | Ga0496108_0329165_266_625 | 119 |
| 93 | 3300053084 | Ga0495595_0524645 | Ga0495595_0524645_99_461 | 119 |
| 94 | 3300053085 | Ga0495619_0067780 | Ga0495619_0067780_1733_2095 | 119 |
| 95 | 3300005343 | Ga0070687_101262967 | Ga0070687_1012629672 | 120 |
| 96 | 3300005985 | Ga0081539_10001616 | Ga0081539_1000161621 | 120 |
| 97 | 3300037312 | Ga0395899_0038569 | Ga0395899_0038569_1576_1977 | 120 |
| 98 | 3300037466 | Ga0395898_0053569 | Ga0395898_0053569_1060_1461 | 120 |
| 99 | 3300037471 | Ga0395905_0043481 | Ga0395905_0043481_2754_3155 | 120 |
| 100 | 3300038443 | Ga0395901_0029559 | Ga0395901_0029559_3256_3657 | 120 |
| 101 | 3300046513 | Ga0495616_0386836 | Ga0495616_0386836_49_411 | 120 |
| 102 | 3300005436 | Ga0070713_100409180 | Ga0070713_1004091802 | 121 |
| 103 | 3300005445 | Ga0070708_100340349 | Ga0070708_1003403492 | 121 |
| 104 | 3300006175 | Ga0070712_100343310 | Ga0070712_1003433102 | 121 |
| 105 | 3300025915 | Ga0207693_10266141 | Ga0207693_102661412 | 121 |
| 106 | 3300025921 | Ga0207652_11263361 | Ga0207652_112633612 | 121 |
| 107 | 3300037466 | Ga0395898_0262533 | Ga0395898_0262533_124_489 | 121 |
| 108 | 3300037471 | Ga0395905_1431376 | Ga0395905_1431376_66_431 | 121 |
| 109 | 3300046461 | Ga0495641_0139131 | Ga0495641_0139131_341_706 | 121 |
| 110 | 3300048903 | Ga0496100_0021104 | Ga0496100_0021104_1131_1496 | 121 |
| 111 | 3300048904 | Ga0496101_0207366 | Ga0496101_0207366_936_1301 | 121 |
| 112 | 3300048907 | Ga0496104_0061664 | Ga0496104_0061664_1749_2114 | 121 |
| 113 | 3300048908 | Ga0496105_0025367 | Ga0496105_0025367_1839_2204 | 121 |
| 114 | 3300048912 | Ga0496109_0144023 | Ga0496109_0144023_1545_1910 | 121 |
| 115 | 3300048917 | Ga0496114_0475443 | Ga0496114_0475443_123_488 | 121 |
| 116 | 3300049584 | Ga0501068_0010774 | Ga0501068_0010774_4535_4924 | 121 |
| 117 | 3300049585 | Ga0501069_0179793 | Ga0501069_0179793_694_1083 | 121 |
| 118 | 3300049586 | Ga0501070_0077653 | Ga0501070_0077653_1630_2019 | 121 |
| 119 | 3300049743 | Ga0501081_1402301 | Ga0501081_1402301_118_507 | 121 |
| 120 | 3300053085 | Ga0495619_0229951 | Ga0495619_0229951_543_908 | 121 |
| 121 | 3300061734 | Ga0530510_0217755 | Ga0530510_0217755_489_878 | 121 |
| 122 | 3300005340 | Ga0070689_100402856 | Ga0070689_1004028562 | 122 |
| 123 | 3300005507 | Ga0074259_10281497 | Ga0074259_102814971 | 122 |
| 124 | 3300005549 | Ga0070704_100309221 | Ga0070704_1003092212 | 122 |
| 125 | 3300005549 | Ga0070704_100768871 | Ga0070704_1007688712 | 122 |
| 126 | 3300009176 | Ga0105242_10419050 | Ga0105242_104190502 | 122 |
| 127 | 3300009176 | Ga0105242_10726028 | Ga0105242_107260282 | 122 |
| 128 | 3300025934 | Ga0207686_11029137 | Ga0207686_110291371 | 122 |
| 129 | 3300037466 | Ga0395898_1050753 | Ga0395898_1050753_96_464 | 122 |
| 130 | 3300037471 | Ga0395905_0339010 | Ga0395905_0339010_673_1041 | 122 |
| 131 | 3300037471 | Ga0395905_1089926 | Ga0395905_1089926_267_635 | 122 |
| 132 | 3300037471 | Ga0395905_1287708 | Ga0395905_1287708_46_414 | 122 |
| 133 | 3300046499 | Ga0495594_0358993 | Ga0495594_0358993_369_737 | 122 |
| 134 | 3300046513 | Ga0495616_0227906 | Ga0495616_0227906_276_644 | 122 |
| 135 | 3300046518 | Ga0495631_0084975 | Ga0495631_0084975_626_994 | 122 |
| 136 | 3300046523 | Ga0495644_0046503 | Ga0495644_0046503_507_875 | 122 |
| 137 | 3300046525 | Ga0495663_0045293 | Ga0495663_0045293_136_504 | 122 |
| 138 | 3300046528 | Ga0495642_0065575 | Ga0495642_0065575_405_773 | 122 |
| 139 | 3300046536 | Ga0495587_0211515 | Ga0495587_0211515_675_1043 | 122 |
| 140 | 3300046538 | Ga0495609_0138746 | Ga0495609_0138746_361_729 | 122 |
| 141 | 3300046616 | Ga0495668_0060537 | Ga0495668_0060537_1628_1996 | 122 |
| 142 | 3300046663 | Ga0495635_0160470 | Ga0495635_0160470_255_623 | 122 |
| 143 | 3300046664 | Ga0495659_0195154 | Ga0495659_0195154_273_641 | 122 |
| 144 | 3300046674 | Ga0495588_0113594 | Ga0495588_0113594_192_560 | 122 |
| 145 | 3300046678 | Ga0495599_0481954 | Ga0495599_0481954_154_522 | 122 |
| 146 | 3300046794 | Ga0495589_0302181 | Ga0495589_0302181_174_542 | 122 |
| 147 | 3300047321 | Ga0495676_0381391 | Ga0495676_0381391_409_777 | 122 |
| 148 | 3300047445 | Ga0495677_0025618 | Ga0495677_0025618_609_977 | 122 |
| 149 | 3300048905 | Ga0496102_0260196 | Ga0496102_0260196_363_731 | 122 |
| 150 | 3300048915 | Ga0496112_0108987 | Ga0496112_0108987_516_884 | 122 |
| 151 | 3300048915 | Ga0496112_1509940 | Ga0496112_1509940_19_387 | 122 |
| 152 | 3300053085 | Ga0495619_0385657 | Ga0495619_0385657_294_662 | 122 |
| 153 | 3300005347 | Ga0070668_100816715 | Ga0070668_1008167152 | 123 |
| 154 | 3300005441 | Ga0070700_100404985 | Ga0070700_1004049852 | 123 |
| 155 | 3300005535 | Ga0070684_100244680 | Ga0070684_1002446802 | 123 |
| 156 | 3300005614 | Ga0068856_100039121 | Ga0068856_1000391213 | 123 |
| 157 | 3300005843 | Ga0068860_102369963 | Ga0068860_1023699631 | 123 |
| 158 | 3300006175 | Ga0070712_101655875 | Ga0070712_1016558751 | 123 |
| 159 | 3300006852 | Ga0075433_10910559 | Ga0075433_109105592 | 123 |
| 160 | 3300006871 | Ga0075434_100637633 | Ga0075434_1006376332 | 123 |
| 161 | 3300009094 | Ga0111539_10385283 | Ga0111539_103852832 | 123 |
| 162 | 3300009553 | Ga0105249_10647322 | Ga0105249_106473222 | 123 |
| 163 | 3300013105 | Ga0157369_10895437 | Ga0157369_108954373 | 123 |
| 164 | 3300014745 | Ga0157377_10182938 | Ga0157377_101829382 | 123 |
| 165 | 3300025917 | Ga0207660_11503783 | Ga0207660_115037831 | 123 |
| 166 | 3300025944 | Ga0207661_10505729 | Ga0207661_105057293 | 123 |
| 167 | 3300025961 | Ga0207712_10235437 | Ga0207712_102354373 | 123 |
| 168 | 3300025972 | Ga0207668_10591262 | Ga0207668_105912622 | 123 |
| 169 | 3300026075 | Ga0207708_10172020 | Ga0207708_101720202 | 123 |
| 170 | 3300028800 | Ga0265338_10797197 | Ga0265338_107971971 | 123 |
| 171 | 3300041512 | Ga0451853_0055024 | Ga0451853_0055024_72_443 | 123 |
| 172 | 3300048903 | Ga0496100_0287520 | Ga0496100_0287520_747_1127 | 123 |
| 173 | 3300048904 | Ga0496101_0051563 | Ga0496101_0051563_2042_2422 | 123 |
| 174 | 3300048905 | Ga0496102_0301266 | Ga0496102_0301266_441_821 | 123 |
| 175 | 3300048908 | Ga0496105_0018500 | Ga0496105_0018500_1247_1627 | 123 |
| 176 | 3300048909 | Ga0496106_0299574 | Ga0496106_0299574_853_1233 | 123 |
| 177 | 3300048910 | Ga0496107_0069997 | Ga0496107_0069997_435_815 | 123 |
| 178 | 3300048911 | Ga0496108_0921069 | Ga0496108_0921069_174_554 | 123 |
| 179 | 3300048912 | Ga0496109_0199209 | Ga0496109_0199209_898_1278 | 123 |
| 180 | 3300048913 | Ga0496110_0007665 | Ga0496110_0007665_3772_4152 | 123 |
| 181 | 3300048914 | Ga0496111_0005761 | Ga0496111_0005761_3982_4362 | 123 |
| 182 | 3300048916 | Ga0496113_0052982 | Ga0496113_0052982_909_1289 | 123 |
| 183 | 3300049574 | Ga0501038_0782953 | Ga0501038_0782953_318_692 | 123 |
| 184 | 3300049579 | Ga0501043_0568393 | Ga0501043_0568393_115_489 | 123 |
| 185 | 3300049581 | Ga0501047_0318919 | Ga0501047_0318919_488_862 | 123 |
| 186 | 3300049589 | Ga0501073_0314870 | Ga0501073_0314870_158_532 | 123 |
| 187 | 3300049823 | Ga0501044_0459871 | Ga0501044_0459871_221_595 | 123 |
| 188 | 3300050515 | nmdc:mga0a205_833855_c1 | nmdc:mga0a205_833855_c1_56_436 | 123 |
| 189 | 3300005338 | Ga0068868_100264115 | Ga0068868_1002641153 | 124 |
| 190 | 3300005366 | Ga0070659_101054705 | Ga0070659_1010547051 | 124 |
| 191 | 3300005456 | Ga0070678_100012613 | Ga0070678_1000126134 | 124 |
| 192 | 3300005530 | Ga0070679_100034278 | Ga0070679_1000342785 | 124 |
| 193 | 3300005535 | Ga0070684_100056916 | Ga0070684_1000569165 | 124 |
| 194 | 3300005547 | Ga0070693_100018856 | Ga0070693_1000188562 | 124 |
| 195 | 3300005548 | Ga0070665_101216754 | Ga0070665_1012167542 | 124 |
| 196 | 3300005564 | Ga0070664_100065896 | Ga0070664_1000658962 | 124 |
| 197 | 3300005577 | Ga0068857_100571154 | Ga0068857_1005711542 | 124 |
| 198 | 3300005578 | Ga0068854_100088626 | Ga0068854_1000886262 | 124 |
| 199 | 3300005614 | Ga0068856_100009977 | Ga0068856_1000099774 | 124 |
| 200 | 3300005614 | Ga0068856_100116403 | Ga0068856_1001164032 | 124 |
| 201 | 3300005840 | Ga0068870_10388775 | Ga0068870_103887752 | 124 |
| 202 | 3300006237 | Ga0097621_100254225 | Ga0097621_1002542253 | 124 |
| 203 | 3300006844 | Ga0075428_101493688 | Ga0075428_1014936882 | 124 |
| 204 | 3300006846 | Ga0075430_100102386 | Ga0075430_1001023862 | 124 |
| 205 | 3300006880 | Ga0075429_100136475 | Ga0075429_1001364752 | 124 |
| 206 | 3300006881 | Ga0068865_100523267 | Ga0068865_1005232672 | 124 |
| 207 | 3300006881 | Ga0068865_100788391 | Ga0068865_1007883912 | 124 |
| 208 | 3300009098 | Ga0105245_10087549 | Ga0105245_100875492 | 124 |
| 209 | 3300009147 | Ga0114129_10131020 | Ga0114129_101310202 | 124 |
| 210 | 3300009553 | Ga0105249_10989084 | Ga0105249_109890842 | 124 |
| 211 | 3300013308 | Ga0157375_10174208 | Ga0157375_101742082 | 124 |
| 212 | 3300014325 | Ga0163163_10141163 | Ga0163163_101411632 | 124 |
| 213 | 3300014968 | Ga0157379_10271236 | Ga0157379_102712362 | 124 |
| 214 | 3300014969 | Ga0157376_10679444 | Ga0157376_106794443 | 124 |
| 215 | 3300025912 | Ga0207707_10352379 | Ga0207707_103523792 | 124 |
| 216 | 3300025921 | Ga0207652_10023577 | Ga0207652_100235775 | 124 |
| 217 | 3300025927 | Ga0207687_10012647 | Ga0207687_100126475 | 124 |
| 218 | 3300025932 | Ga0207690_10576098 | Ga0207690_105760982 | 124 |
| 219 | 3300025938 | Ga0207704_10546847 | Ga0207704_105468472 | 124 |
| 220 | 3300025944 | Ga0207661_10003871 | Ga0207661_1000387111 | 124 |
| 221 | 3300025945 | Ga0207679_10062312 | Ga0207679_100623123 | 124 |
| 222 | 3300026023 | Ga0207677_10034713 | Ga0207677_100347132 | 124 |
| 223 | 3300026041 | Ga0207639_10175904 | Ga0207639_101759042 | 124 |
| 224 | 3300026078 | Ga0207702_10009148 | Ga0207702_100091487 | 124 |
| 225 | 3300026078 | Ga0207702_10074114 | Ga0207702_100741144 | 124 |
| 226 | 3300026116 | Ga0207674_10580246 | Ga0207674_105802462 | 124 |
| 227 | 3300026121 | Ga0207683_10007827 | Ga0207683_100078275 | 124 |
| 228 | 3300028379 | Ga0268266_11058816 | Ga0268266_110588162 | 124 |
| 229 | 3300042138 | Ga0450903_061155 | Ga0450903_061155_99_482 | 124 |
| 230 | 3300046533 | Ga0495640_0174812 | Ga0495640_0174812_532_915 | 124 |
| 231 | 3300046689 | Ga0495613_0157584 | Ga0495613_0157584_746_1129 | 124 |
| 232 | 3300048903 | Ga0496100_0010775 | Ga0496100_0010775_2827_3210 | 124 |
| 233 | 3300048903 | Ga0496100_0120873 | Ga0496100_0120873_68_454 | 124 |
| 234 | 3300048904 | Ga0496101_0069648 | Ga0496101_0069648_390_773 | 124 |
| 235 | 3300048905 | Ga0496102_0017881 | Ga0496102_0017881_122_508 | 124 |
| 236 | 3300048906 | Ga0496103_0089826 | Ga0496103_0089826_1439_1822 | 124 |
| 237 | 3300048907 | Ga0496104_0000617 | Ga0496104_0000617_11874_12257 | 124 |
| 238 | 3300048908 | Ga0496105_0000147 | Ga0496105_0000147_8355_8738 | 124 |
| 239 | 3300048908 | Ga0496105_0709627 | Ga0496105_0709627_292_675 | 124 |
| 240 | 3300048910 | Ga0496107_0043862 | Ga0496107_0043862_741_1124 | 124 |
| 241 | 3300048910 | Ga0496107_1247834 | Ga0496107_1247834_112_498 | 124 |
| 242 | 3300048911 | Ga0496108_0088555 | Ga0496108_0088555_1446_1829 | 124 |
| 243 | 3300048912 | Ga0496109_0004593 | Ga0496109_0004593_350_733 | 124 |
| 244 | 3300048912 | Ga0496109_0101486 | Ga0496109_0101486_1919_2305 | 124 |
| 245 | 3300048913 | Ga0496110_0024072 | Ga0496110_0024072_3796_4179 | 124 |
| 246 | 3300048914 | Ga0496111_0069308 | Ga0496111_0069308_270_653 | 124 |
| 247 | 3300048915 | Ga0496112_0626791 | Ga0496112_0626791_205_588 | 124 |
| 248 | 3300048916 | Ga0496113_1479554 | Ga0496113_1479554_105_488 | 124 |
| 249 | 3300048917 | Ga0496114_0002427 | Ga0496114_0002427_1691_2074 | 124 |
| 250 | 3300048918 | Ga0496115_0271512 | Ga0496115_0271512_349_735 | 124 |
| 251 | 3300049588 | Ga0501072_1282960 | Ga0501072_1282960_50_424 | 124 |
| 252 | 3300050507 | nmdc:mga05p37_267216_c1 | nmdc:mga05p37_267216_c1_1575_1952 | 124 |
| 253 | 3300050508 | nmdc:mga09592_40684_c1 | nmdc:mga09592_40684_c1_1542_1919 | 124 |
| 254 | 3300050509 | nmdc:mga0qj67_394559_c1 | nmdc:mga0qj67_394559_c1_315_692 | 124 |
| 255 | 3300050511 | nmdc:mga08y16_799086_c1 | nmdc:mga08y16_799086_c1_372_749 | 124 |
| 256 | 3300050512 | nmdc:mga0n895_1038531_c1 | nmdc:mga0n895_1038531_c1_33_416 | 124 |
| 257 | 3300053077 | Ga0495601_0924789 | Ga0495601_0924789_50_433 | 124 |
| 258 | 3300053085 | Ga0495619_0202518 | Ga0495619_0202518_275_658 | 124 |
| 259 | 3300005468 | Ga0070707_100221649 | Ga0070707_1002216492 | 125 |
| 260 | 3300025922 | Ga0207646_10176637 | Ga0207646_101766373 | 125 |
| 261 | 3300045976 | Ga0466967_1257139 | Ga0466967_1257139_217_597 | 125 |
| 262 | 3300048918 | Ga0496115_0608719 | Ga0496115_0608719_213_596 | 125 |
| 263 | 3300035241 | Ga0373961_0197292 | Ga0373961_0197292_93_476 | 127 |
| 264 | 3300035691 | Ga0373931_0531054 | Ga0373931_0531054_222_605 | 127 |
| 265 | 3300037418 | Ga0395900_1932547 | Ga0395900_1932547_16_399 | 127 |
| 266 | 3300046615 | Ga0495656_0106694 | Ga0495656_0106694_887_1270 | 127 |
| 267 | 3300049582 | Ga0501048_0714694 | Ga0501048_0714694_287_670 | 127 |
| 268 | 3300049586 | Ga0501070_0303738 | Ga0501070_0303738_330_713 | 127 |
| 269 | 3300049588 | Ga0501072_0244792 | Ga0501072_0244792_783_1166 | 127 |
| 270 | 3300049590 | Ga0501074_0122999 | Ga0501074_0122999_485_868 | 127 |
| 271 | 3300049591 | Ga0501075_0110393 | Ga0501075_0110393_607_990 | 127 |
| 272 | 3300049592 | Ga0501076_0031474 | Ga0501076_0031474_3210_3593 | 127 |
| 273 | 3300049593 | Ga0501077_0131739 | Ga0501077_0131739_79_462 | 127 |
| 274 | 3300049741 | Ga0501079_0090059 | Ga0501079_0090059_1407_1790 | 127 |
| 275 | 3300049744 | Ga0501083_0239311 | Ga0501083_0239311_617_1000 | 127 |
| 276 | 3300061734 | Ga0530510_0020936 | Ga0530510_0020936_70_453 | 127 |
| 277 | 3300006914 | Ga0075436_100974683 | Ga0075436_1009746832 | 128 |
| 278 | 3300025918 | Ga0207662_10118864 | Ga0207662_101188643 | 128 |
| 279 | 3300031548 | Ga0307408_101465193 | Ga0307408_1014651932 | 128 |
| 280 | 3300031731 | Ga0307405_10001365 | Ga0307405_100013653 | 128 |
| 281 | 3300031824 | Ga0307413_10000877 | Ga0307413_100008774 | 128 |
| 282 | 3300031852 | Ga0307410_10007282 | Ga0307410_100072825 | 128 |
| 283 | 3300031901 | Ga0307406_10035232 | Ga0307406_100352325 | 128 |
| 284 | 3300031903 | Ga0307407_10012037 | Ga0307407_100120373 | 128 |
| 285 | 3300031995 | Ga0307409_100015513 | Ga0307409_1000155132 | 128 |
| 286 | 3300032002 | Ga0307416_100056111 | Ga0307416_1000561112 | 128 |
| 287 | 3300032004 | Ga0307414_10011957 | Ga0307414_100119572 | 128 |
| 288 | 3300032005 | Ga0307411_10026891 | Ga0307411_100268912 | 128 |
| 289 | 3300032126 | Ga0307415_100035216 | Ga0307415_1000352165 | 128 |
| 290 | 3300037312 | Ga0395899_0006796 | Ga0395899_0006796_7476_7862 | 128 |
| 291 | 3300037418 | Ga0395900_0031576 | Ga0395900_0031576_1851_2279 | 128 |
| 292 | 3300037418 | Ga0395900_0209713 | Ga0395900_0209713_1004_1390 | 128 |
| 293 | 3300037466 | Ga0395898_0003238 | Ga0395898_0003238_5862_6248 | 128 |
| 294 | 3300037466 | Ga0395898_0113553 | Ga0395898_0113553_2054_2482 | 128 |
| 295 | 3300037471 | Ga0395905_0001864 | Ga0395905_0001864_10049_10435 | 128 |
| 296 | 3300037471 | Ga0395905_0122770 | Ga0395905_0122770_785_1213 | 128 |
| 297 | 3300038443 | Ga0395901_0058333 | Ga0395901_0058333_412_840 | 128 |
| 298 | 3300038443 | Ga0395901_0199835 | Ga0395901_0199835_1132_1518 | 128 |
| 299 | 3300042436 | Ga0439435_0047575 | Ga0439435_0047575_769_1161 | 128 |
| 300 | 3300047446 | Ga0495679_150163 | Ga0495679_150163_95_481 | 128 |
| 301 | 3300049569 | Ga0501032_0060793 | Ga0501032_0060793_1593_1985 | 128 |
| 302 | 3300049570 | Ga0501033_0133117 | Ga0501033_0133117_731_1123 | 128 |
| 303 | 3300049572 | Ga0501036_0096344 | Ga0501036_0096344_1119_1511 | 128 |
| 304 | 3300049574 | Ga0501038_0137162 | Ga0501038_0137162_1572_1964 | 128 |
| 305 | 3300049575 | Ga0501039_0211622 | Ga0501039_0211622_70_462 | 128 |
| 306 | 3300049575 | Ga0501039_0815929 | Ga0501039_0815929_304_696 | 128 |
| 307 | 3300049576 | Ga0501040_0020553 | Ga0501040_0020553_2452_2844 | 128 |
| 308 | 3300049577 | Ga0501041_0120918 | Ga0501041_0120918_349_741 | 128 |
| 309 | 3300049578 | Ga0501042_0139231 | Ga0501042_0139231_991_1383 | 128 |
| 310 | 3300049580 | Ga0501046_0125368 | Ga0501046_0125368_1521_1913 | 128 |
| 311 | 3300049582 | Ga0501048_0040996 | Ga0501048_0040996_2267_2659 | 128 |
| 312 | 3300049584 | Ga0501068_0461335 | Ga0501068_0461335_38_430 | 128 |
| 313 | 3300049585 | Ga0501069_0055297 | Ga0501069_0055297_887_1279 | 128 |
| 314 | 3300049587 | Ga0501071_0041228 | Ga0501071_0041228_2328_2720 | 128 |
| 315 | 3300049587 | Ga0501071_0264436 | Ga0501071_0264436_668_1060 | 128 |
| 316 | 3300049588 | Ga0501072_0038530 | Ga0501072_0038530_1032_1424 | 128 |
| 317 | 3300049590 | Ga0501074_0227599 | Ga0501074_0227599_883_1275 | 128 |
| 318 | 3300049592 | Ga0501076_0003745 | Ga0501076_0003745_9279_9671 | 128 |
| 319 | 3300049592 | Ga0501076_0190256 | Ga0501076_0190256_1019_1411 | 128 |
| 320 | 3300049593 | Ga0501077_0009366 | Ga0501077_0009366_4516_4908 | 128 |
| 321 | 3300049593 | Ga0501077_0090471 | Ga0501077_0090471_608_1000 | 128 |
| 322 | 3300049656 | Ga0501209_130063 | Ga0501209_130063_230_616 | 128 |
| 323 | 3300049688 | Ga0501259_185781 | Ga0501259_185781_116_502 | 128 |
| 324 | 3300049741 | Ga0501079_0238863 | Ga0501079_0238863_849_1241 | 128 |
| 325 | 3300049741 | Ga0501079_0348892 | Ga0501079_0348892_104_496 | 128 |
| 326 | 3300049742 | Ga0501080_0041568 | Ga0501080_0041568_3091_3483 | 128 |
| 327 | 3300049743 | Ga0501081_0030904 | Ga0501081_0030904_991_1383 | 128 |
| 328 | 3300049822 | Ga0501035_0410574 | Ga0501035_0410574_550_942 | 128 |
| 329 | 3300049824 | Ga0501045_0152623 | Ga0501045_0152623_1138_1530 | 128 |
| 330 | 3300049824 | Ga0501045_0700154 | Ga0501045_0700154_155_547 | 128 |
| 331 | 3300050510 | nmdc:mga06r32_69755_c1 | nmdc:mga06r32_69755_c1_1435_1836 | 128 |
| 332 | 3300060353 | Ga0501082_0031092 | Ga0501082_0031092_672_1064 | 128 |
| 333 | 3300061734 | Ga0530510_0023613 | Ga0530510_0023613_2360_2752 | 128 |
| 334 | 3300005329 | Ga0070683_101946737 | Ga0070683_1019467371 | 129 |
| 335 | 3300005347 | Ga0070668_100551073 | Ga0070668_1005510733 | 129 |
| 336 | 3300005444 | Ga0070694_100101087 | Ga0070694_1001010873 | 129 |
| 337 | 3300005459 | Ga0068867_100704878 | Ga0068867_1007048782 | 129 |
| 338 | 3300005549 | Ga0070704_100293180 | Ga0070704_1002931803 | 129 |
| 339 | 3300005718 | Ga0068866_10110587 | Ga0068866_101105872 | 129 |
| 340 | 3300005985 | Ga0081539_10000384 | Ga0081539_1000038432 | 129 |
| 341 | 3300009098 | Ga0105245_10706165 | Ga0105245_107061652 | 129 |
| 342 | 3300009553 | Ga0105249_10106625 | Ga0105249_101066252 | 129 |
| 343 | 3300025899 | Ga0207642_11115853 | Ga0207642_111158531 | 129 |
| 344 | 3300025917 | Ga0207660_11068979 | Ga0207660_110689792 | 129 |
| 345 | 3300025937 | Ga0207669_11896928 | Ga0207669_118969281 | 129 |
| 346 | 3300025949 | Ga0207667_11373839 | Ga0207667_113738392 | 129 |
| 347 | 3300025961 | Ga0207712_11877161 | Ga0207712_118771612 | 129 |
| 348 | 3300025972 | Ga0207668_10582233 | Ga0207668_105822332 | 129 |
| 349 | 3300026067 | Ga0207678_10524160 | Ga0207678_105241601 | 129 |
| 350 | 3300026089 | Ga0207648_10296114 | Ga0207648_102961142 | 129 |
| 351 | 3300027907 | Ga0207428_10405467 | Ga0207428_104054672 | 129 |
| 352 | 3300028381 | Ga0268264_11845161 | Ga0268264_118451611 | 129 |
| 353 | 3300035092 | Ga0373952_0277909 | Ga0373952_0277909_72_461 | 129 |
| 354 | 3300042005 | Ga0439448_0169387 | Ga0439448_0169387_289_678 | 129 |
| 355 | 3300045051 | Ga0451576_0199058 | Ga0451576_0199058_726_1115 | 129 |
| 356 | 3300046457 | Ga0495590_0101105 | Ga0495590_0101105_43_432 | 129 |
| 357 | 3300046458 | Ga0495591_034676 | Ga0495591_034676_276_665 | 129 |
| 358 | 3300046474 | Ga0495605_0030681 | Ga0495605_0030681_1340_1729 | 129 |
| 359 | 3300046491 | Ga0495584_0035765 | Ga0495584_0035765_2049_2438 | 129 |
| 360 | 3300046492 | Ga0495585_0039141 | Ga0495585_0039141_2026_2415 | 129 |
| 361 | 3300046500 | Ga0495596_0069261 | Ga0495596_0069261_593_982 | 129 |
| 362 | 3300046501 | Ga0495607_0175315 | Ga0495607_0175315_224_613 | 129 |
| 363 | 3300046513 | Ga0495616_0049947 | Ga0495616_0049947_1570_1959 | 129 |
| 364 | 3300046515 | Ga0495620_0219829 | Ga0495620_0219829_157_546 | 129 |
| 365 | 3300046520 | Ga0495637_0034063 | Ga0495637_0034063_1474_1863 | 129 |
| 366 | 3300046522 | Ga0495643_0283792 | Ga0495643_0283792_129_518 | 129 |
| 367 | 3300046523 | Ga0495644_0052695 | Ga0495644_0052695_989_1378 | 129 |
| 368 | 3300046525 | Ga0495663_0105125 | Ga0495663_0105125_270_659 | 129 |
| 369 | 3300046528 | Ga0495642_0071156 | Ga0495642_0071156_291_680 | 129 |
| 370 | 3300046537 | Ga0495598_0118111 | Ga0495598_0118111_315_704 | 129 |
| 371 | 3300046538 | Ga0495609_0106343 | Ga0495609_0106343_687_1076 | 129 |
| 372 | 3300046542 | Ga0495597_0031067 | Ga0495597_0031067_1730_2119 | 129 |
| 373 | 3300046648 | Ga0495611_0135390 | Ga0495611_0135390_293_682 | 129 |
| 374 | 3300046664 | Ga0495659_0006269 | Ga0495659_0006269_1458_1847 | 129 |
| 375 | 3300046691 | Ga0495670_0057036 | Ga0495670_0057036_166_555 | 129 |
| 376 | 3300046692 | Ga0495671_0053022 | Ga0495671_0053022_882_1271 | 129 |
| 377 | 3300046794 | Ga0495589_0136618 | Ga0495589_0136618_496_885 | 129 |
| 378 | 3300047445 | Ga0495677_0042394 | Ga0495677_0042394_813_1202 | 129 |
| 379 | 3300047447 | Ga0495685_034252 | Ga0495685_034252_188_577 | 129 |
| 380 | 3300048090 | Ga0495615_0025555 | Ga0495615_0025555_297_686 | 129 |
| 381 | 3300048091 | Ga0495626_0071293 | Ga0495626_0071293_837_1226 | 129 |
| 382 | 3300048905 | Ga0496102_1820387 | Ga0496102_1820387_52_441 | 129 |
| 383 | 3300050511 | nmdc:mga08y16_19285_c1 | nmdc:mga08y16_19285_c1_584_973 | 129 |
| 384 | 3300005334 | Ga0068869_100314903 | Ga0068869_1003149032 | 130 |
| 385 | 3300005335 | Ga0070666_10662199 | Ga0070666_106621992 | 130 |
| 386 | 3300005343 | Ga0070687_100128969 | Ga0070687_1001289692 | 130 |
| 387 | 3300005344 | Ga0070661_100414472 | Ga0070661_1004144723 | 130 |
| 388 | 3300005356 | Ga0070674_100271843 | Ga0070674_1002718431 | 130 |
| 389 | 3300005364 | Ga0070673_100516528 | Ga0070673_1005165282 | 130 |
| 390 | 3300005365 | Ga0070688_100085035 | Ga0070688_1000850351 | 130 |
| 391 | 3300005457 | Ga0070662_100301050 | Ga0070662_1003010502 | 130 |
| 392 | 3300005466 | Ga0070685_10203904 | Ga0070685_102039042 | 130 |
| 393 | 3300005535 | Ga0070684_100047835 | Ga0070684_1000478352 | 130 |
| 394 | 3300005544 | Ga0070686_100988014 | Ga0070686_1009880142 | 130 |
| 395 | 3300005615 | Ga0070702_101692199 | Ga0070702_1016921991 | 130 |
| 396 | 3300005616 | Ga0068852_100118848 | Ga0068852_1001188482 | 130 |
| 397 | 3300005617 | Ga0068859_100664249 | Ga0068859_1006642492 | 130 |
| 398 | 3300005618 | Ga0068864_100382138 | Ga0068864_1003821383 | 130 |
| 399 | 3300005718 | Ga0068866_10438952 | Ga0068866_104389522 | 130 |
| 400 | 3300005840 | Ga0068870_10014321 | Ga0068870_100143212 | 130 |
| 401 | 3300005842 | Ga0068858_101445433 | Ga0068858_1014454331 | 130 |
| 402 | 3300005843 | Ga0068860_100362727 | Ga0068860_1003627272 | 130 |
| 403 | 3300005937 | Ga0081455_10026545 | Ga0081455_100265454 | 130 |
| 404 | 3300006358 | Ga0068871_100984295 | Ga0068871_1009842952 | 130 |
| 405 | 3300006931 | Ga0097620_100664249 | Ga0097620_1006642492 | 130 |
| 406 | 3300009177 | Ga0105248_10444487 | Ga0105248_104444872 | 130 |
| 407 | 3300009553 | Ga0105249_11424691 | Ga0105249_114246912 | 130 |
| 408 | 3300010375 | Ga0105239_10116580 | Ga0105239_101165802 | 130 |
| 409 | 3300011119 | Ga0105246_10058598 | Ga0105246_100585982 | 130 |
| 410 | 3300013102 | Ga0157371_10847307 | Ga0157371_108473071 | 130 |
| 411 | 3300013306 | Ga0163162_10205580 | Ga0163162_102055802 | 130 |
| 412 | 3300013308 | Ga0157375_10290332 | Ga0157375_102903322 | 130 |
| 413 | 3300014325 | Ga0163163_10267960 | Ga0163163_102679602 | 130 |
| 414 | 3300014326 | Ga0157380_10819893 | Ga0157380_108198932 | 130 |
| 415 | 3300014968 | Ga0157379_11105527 | Ga0157379_111055272 | 130 |
| 416 | 3300025899 | Ga0207642_10296092 | Ga0207642_102960922 | 130 |
| 417 | 3300025908 | Ga0207643_10013055 | Ga0207643_100130555 | 130 |
| 418 | 3300025919 | Ga0207657_11166159 | Ga0207657_111661592 | 130 |
| 419 | 3300025927 | Ga0207687_10037058 | Ga0207687_100370583 | 130 |
| 420 | 3300025931 | Ga0207644_10408488 | Ga0207644_104084882 | 130 |
| 421 | 3300025933 | Ga0207706_10020046 | Ga0207706_100200463 | 130 |
| 422 | 3300025937 | Ga0207669_10149099 | Ga0207669_101490992 | 130 |
| 423 | 3300025940 | Ga0207691_10127855 | Ga0207691_101278552 | 130 |
| 424 | 3300025941 | Ga0207711_10607557 | Ga0207711_106075572 | 130 |
| 425 | 3300025942 | Ga0207689_10062401 | Ga0207689_100624013 | 130 |
| 426 | 3300025944 | Ga0207661_10490247 | Ga0207661_104902472 | 130 |
| 427 | 3300025945 | Ga0207679_10160194 | Ga0207679_101601942 | 130 |
| 428 | 3300025960 | Ga0207651_10528884 | Ga0207651_105288841 | 130 |
| 429 | 3300025981 | Ga0207640_10146856 | Ga0207640_101468562 | 130 |
| 430 | 3300026035 | Ga0207703_10501435 | Ga0207703_105014353 | 130 |
| 431 | 3300026116 | Ga0207674_10103087 | Ga0207674_101030873 | 130 |
| 432 | 3300026142 | Ga0207698_10158139 | Ga0207698_101581394 | 130 |
| 433 | 3300028379 | Ga0268266_10526443 | Ga0268266_105264432 | 130 |
| 434 | 3300028381 | Ga0268264_10261399 | Ga0268264_102613993 | 130 |
| 435 | 3300031995 | Ga0307409_100399719 | Ga0307409_1003997192 | 130 |
| 436 | 3300046492 | Ga0495585_0350079 | Ga0495585_0350079_179_571 | 130 |
| 437 | 3300046525 | Ga0495663_0293691 | Ga0495663_0293691_177_569 | 130 |
| 438 | 3300046539 | Ga0495621_0084779 | Ga0495621_0084779_306_698 | 130 |
| 439 | 3300046615 | Ga0495656_0806984 | Ga0495656_0806984_65_457 | 130 |
| 440 | 3300046684 | Ga0495669_0549350 | Ga0495669_0549350_24_416 | 130 |
| 441 | 3300046794 | Ga0495589_0409534 | Ga0495589_0409534_13_405 | 130 |
| 442 | 3300048911 | Ga0496108_0015314 | Ga0496108_0015314_4485_4877 | 130 |
| 443 | 3300048912 | Ga0496109_0030399 | Ga0496109_0030399_2938_3330 | 130 |
| 444 | 3300048913 | Ga0496110_0007430 | Ga0496110_0007430_2449_2841 | 130 |
| 445 | 3300048914 | Ga0496111_0003991 | Ga0496111_0003991_3983_4375 | 130 |
| 446 | 3300048916 | Ga0496113_0090923 | Ga0496113_0090923_921_1313 | 130 |
| 447 | 3300049514 | Ga0501291_014733 | Ga0501291_014733_241_633 | 130 |
| 448 | 3300049661 | Ga0501217_028904 | Ga0501217_028904_410_802 | 130 |
| 449 | 3300060353 | Ga0501082_1504426 | Ga0501082_1504426_82_474 | 130 |
| 450 | 3300005329 | Ga0070683_100072544 | Ga0070683_1000725445 | 143 |
| 451 | 3300005535 | Ga0070684_100173715 | Ga0070684_1001737153 | 143 |
| 452 | 3300005564 | Ga0070664_100247477 | Ga0070664_1002474772 | 143 |
| 453 | 3300005577 | Ga0068857_100026637 | Ga0068857_1000266374 | 143 |
| 454 | 3300006058 | Ga0075432_10233656 | Ga0075432_102336562 | 143 |
| 455 | 3300006177 | Ga0075362_10385572 | Ga0075362_103855721 | 143 |
| 456 | 3300006195 | Ga0075366_10285849 | Ga0075366_102858492 | 143 |
| 457 | 3300009094 | Ga0111539_10035896 | Ga0111539_100358965 | 143 |
| 458 | 3300025944 | Ga0207661_10031728 | Ga0207661_100317282 | 143 |
| 459 | 3300025945 | Ga0207679_10043133 | Ga0207679_100431333 | 143 |
| 460 | 3300026116 | Ga0207674_10003638 | Ga0207674_1000363819 | 143 |
| 461 | 3300027907 | Ga0207428_10010765 | Ga0207428_100107659 | 143 |
| 462 | 3300049741 | Ga0501079_0961315 | Ga0501079_0961315_45_476 | 143 |
| 463 | 3300050489 | nmdc:mga03683_342683_c1 | nmdc:mga03683_342683_c1_243_674 | 143 |
| 464 | 3300050511 | nmdc:mga08y16_11600_c1 | nmdc:mga08y16_11600_c1_7615_8046 | 143 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7tea-assembly2.cif.gz_C | crystal structure of s. aureus glnr-dna complex | 0.9648 | 7 | 76 |
| 2dg6-assembly1.cif.gz_A-2 | crystal structure of the putative transcriptional regulator sco5550 from streptomyces coelicolor a3(2) | 0.9444 | 9 | 75 |
| 6jyw-assembly1.cif.gz_A | crystal structure of the transcription regulator cadr n81m mutant from p. putida in complex with cadmium(ii) and dna | 0.9365 | 9 | 79 |
| 5i44-assembly4.cif.gz_E | structure of raca-dna complex; p21 form | 0.9204 | 7 | 63 |
| 5i44-assembly4.cif.gz_G-2 | structure of raca-dna complex; p21 form | 0.9168 | 8 | 71 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O06302_4_79_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.9807 | 8 | 74 | 1.10.1660.10 |
| af_P33358_1_73_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.9536 | 8 | 76 | 1.10.1660.10 |
| af_P9WME7_10_96_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.9263 | 9 | 73 | 1.10.1660.10 |
| 3hh0D01 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.9158 | 8 | 74 | 1.10.1660.10 |
| 3hh0C01 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.9096 | 8 | 77 | 1.10.1660.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W4PR80-F1-model_v4 | MerR family DNA-binding transcriptional regulator | 0.995 | 5 | 95 |
GO:0003677
GO:0003700 |
| AF-A0A523I756-F1-model_v4 | MerR family transcriptional regulator | 0.9866 | 9 | 83 |
GO:0003677
GO:0003700 |
| AF-A0A6L7RVL5-F1-model_v4 | MerR family transcriptional regulator | 0.9863 | 8 | 80 |
GO:0003677
GO:0003700 |
| AF-A0A383F7G8-F1-model_v4 | HTH merR-type domain-containing protein | 0.9797 | 9 | 83 |
GO:0003677
GO:0003700 |
| AF-A0A6A7KZ87-F1-model_v4 | MerR family transcriptional regulator | 0.9796 | 5 | 85 |
GO:0003677
GO:0003700 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar