F449327

General Info

Members Datasets Scaffolds Average Seq Length
464 273 464 125

Family's Representative Sequence

Representative Sequence 3300035170|Ga0373943_0236321|Ga0373943_0236321_23_430
Length 117
Sequence MNETQRSFDAGRPRYMISVAAELVGMHPQTLRIYEAKGLVTPQRTAGNTRLYSEADLDRLRLIQQLTTELGLNLAGVEHVIRLEEQITQVHKQYRRDLVPYDPTGVELVPKRWTSRG

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
149 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
150 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
156 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
157 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
162 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
165 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
168 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
169 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
170 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
171 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
172 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
173 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
174 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
180 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
204 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
205 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
206 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
207 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
208 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
247 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
248 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
249 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
250 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
251 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
255 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
259 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
269 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 11.42
Rhizosphere 87.72
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100072544 3300005329 Bacteria 3213
2 Ga0070683_101946737 3300005329 Bacteria 565
3 Ga0068869_100314903 3300005334 Bacteria 1267
4 Ga0070666_10662199 3300005335 Unclassified 764
5 Ga0068868_100264115 3300005338 Bacteria 1453
6 Ga0068868_100499741 3300005338 Bacteria 1065
7 Ga0070689_100402856 3300005340 Bacteria 1157
8 Ga0070691_10015309 3300005341 Bacteria 3523
9 Ga0070687_100128969 3300005343 Bacteria 1457
10 Ga0070687_101262967 3300005343 Unclassified 547
11 Ga0070661_100414472 3300005344 Bacteria 1067
12 Ga0070668_100519839 3300005347 Bacteria 1033
13 Ga0070668_100551073 3300005347 Bacteria 1004
14 Ga0070668_100816715 3300005347 Bacteria 829
15 Ga0070674_100271843 3300005356 Unclassified 1340
16 Ga0070673_100516528 3300005364 Bacteria 1082
17 Ga0070688_100085035 3300005365 Bacteria 2055
18 Ga0070659_101054705 3300005366 Bacteria 715
19 Ga0070713_100409180 3300005436 Unclassified 1268
20 Ga0070700_100404985 3300005441 Bacteria 1027
21 Ga0070694_100101087 3300005444 Bacteria 2040
22 Ga0070708_100134452 3300005445 Bacteria 2290
23 Ga0070708_100340349 3300005445 Bacteria 1414
24 Ga0070678_100012613 3300005456 Bacteria 5264
25 Ga0070662_100301050 3300005457 Bacteria 1303
26 Ga0068867_100240280 3300005459 Bacteria 1468
27 Ga0068867_100704878 3300005459 Bacteria 891
28 Ga0068867_100994807 3300005459 Bacteria 760
29 Ga0070685_10203904 3300005466 Bacteria 1287
30 Ga0070707_100221649 3300005468 Bacteria 1842
31 Ga0070698_100007005 3300005471 Bacteria 12211
32 Ga0070698_100051187 3300005471 Bacteria 4208
33 Ga0074259_10281497 3300005507 Bacteria 759
34 Ga0070699_100424960 3300005518 Bacteria 1203
35 Ga0070679_100034278 3300005530 Bacteria 5031
36 Ga0070684_100047835 3300005535 Bacteria 3708
37 Ga0070684_100056916 3300005535 Bacteria 3413
38 Ga0070684_100173715 3300005535 Bacteria 1958
39 Ga0070684_100244680 3300005535 Bacteria 1639
40 Ga0070697_100918106 3300005536 Bacteria 777
41 Ga0070686_100988014 3300005544 Unclassified 690
42 Ga0070695_100515526 3300005545 Unclassified 927
43 Ga0070693_100018856 3300005547 Bacteria 3609
44 Ga0070693_101104746 3300005547 Bacteria 605
45 Ga0070665_101216754 3300005548 Bacteria 764
46 Ga0070704_100293180 3300005549 Bacteria 1352
47 Ga0070704_100309221 3300005549 Bacteria 1320
48 Ga0070704_100585269 3300005549 Bacteria 979
49 Ga0070704_100768871 3300005549 Unclassified 859
50 Ga0070664_100065896 3300005564 Bacteria 3092
51 Ga0070664_100247477 3300005564 Bacteria 1602
52 Ga0070664_100580224 3300005564 Bacteria 1039
53 Ga0068857_100026637 3300005577 Bacteria 5096
54 Ga0068857_100571154 3300005577 Bacteria 1067
55 Ga0068854_100023298 3300005578 Bacteria 4228
56 Ga0068854_100088626 3300005578 Bacteria 2298
57 Ga0068856_100009977 3300005614 Bacteria 9220
58 Ga0068856_100039121 3300005614 Bacteria 4657
59 Ga0068856_100116403 3300005614 Bacteria 2673
60 Ga0070702_101692199 3300005615 Unclassified 526
61 Ga0068852_100118848 3300005616 Bacteria 2416
62 Ga0068859_100664249 3300005617 Bacteria 1134
63 Ga0068864_100382138 3300005618 Bacteria 1335
64 Ga0068866_10110587 3300005718 Bacteria 1532
65 Ga0068866_10438952 3300005718 Unclassified 851
66 Ga0068861_100100149 3300005719 Bacteria 2303
67 Ga0068861_101431812 3300005719 Bacteria 676
68 Ga0068870_10014321 3300005840 Bacteria 3745
69 Ga0068870_10388775 3300005840 Bacteria 905
70 Ga0068858_101445433 3300005842 Unclassified 678
71 Ga0068860_100362727 3300005843 Bacteria 1428
72 Ga0068860_102369963 3300005843 Bacteria 551
73 Ga0081455_10026545 3300005937 Bacteria 5323
74 Ga0081455_10050398 3300005937 Bacteria 3581
75 Ga0081539_10000384 3300005985 Bacteria 95594
76 Ga0081539_10001616 3300005985 Bacteria 36968
77 Ga0075432_10233656 3300006058 Bacteria 740
78 Ga0070712_100343310 3300006175 Unclassified 1220
79 Ga0070712_101655875 3300006175 Bacteria 560
80 Ga0075362_10385572 3300006177 Bacteria 705
81 Ga0075366_10285849 3300006195 Bacteria 1008
82 Ga0097621_100254225 3300006237 Bacteria 1539
83 Ga0068871_100984295 3300006358 Bacteria 785
84 Ga0075428_101493688 3300006844 Unclassified 708
85 Ga0075430_100102386 3300006846 Bacteria 2391
86 Ga0075433_10910559 3300006852 Bacteria 767
87 Ga0075434_100637633 3300006871 Bacteria 1084
88 Ga0075429_100136475 3300006880 Bacteria 2147
89 Ga0068865_100523267 3300006881 Bacteria 992
90 Ga0068865_100715782 3300006881 Bacteria 857
91 Ga0068865_100788391 3300006881 Bacteria 819
92 Ga0075436_100503518 3300006914 Bacteria 886
93 Ga0075436_100974683 3300006914 Bacteria 636
94 Ga0097620_100664249 3300006931 Bacteria 1134
95 Ga0111539_10035896 3300009094 Bacteria 6001
96 Ga0111539_10385283 3300009094 Bacteria 1632
97 Ga0111539_10928379 3300009094 Bacteria 1012
98 Ga0105245_10052562 3300009098 Bacteria 3654
99 Ga0105245_10087549 3300009098 Bacteria 2859
100 Ga0105245_10706165 3300009098 Bacteria 1042
101 Ga0105247_10935670 3300009101 Bacteria 672
102 Ga0114129_10131020 3300009147 Bacteria 3444
103 Ga0105243_10318080 3300009148 Bacteria 1417
104 Ga0105243_12514045 3300009148 Bacteria 554
105 Ga0105242_10419050 3300009176 Bacteria 1254
106 Ga0105242_10726028 3300009176 Bacteria 975
107 Ga0105248_10444487 3300009177 Bacteria 1461
108 Ga0105249_10106625 3300009553 Bacteria 2644
109 Ga0105249_10647322 3300009553 Bacteria 1114
110 Ga0105249_10989084 3300009553 Bacteria 910
111 Ga0105249_11424691 3300009553 Unclassified 765
112 Ga0105239_10116580 3300010375 Bacteria 2964
113 Ga0105246_10058598 3300011119 Bacteria 2669
114 Ga0157371_10847307 3300013102 Bacteria 691
115 Ga0157369_10895437 3300013105 Bacteria 910
116 Ga0163162_10205580 3300013306 Bacteria 2098
117 Ga0157375_10174208 3300013308 Bacteria 2300
118 Ga0157375_10290332 3300013308 Bacteria 1798
119 Ga0163163_10141163 3300014325 Bacteria 2451
120 Ga0163163_10267960 3300014325 Bacteria 1759
121 Ga0157380_10819893 3300014326 Bacteria 949
122 Ga0157377_10182938 3300014745 Bacteria 1319
123 Ga0157377_10311315 3300014745 Bacteria 1043
124 Ga0157379_10271236 3300014968 Bacteria 1543
125 Ga0157379_11105527 3300014968 Unclassified 759
126 Ga0157376_10679444 3300014969 Bacteria 1033
127 Ga0207642_10296092 3300025899 Unclassified 936
128 Ga0207642_11115853 3300025899 Bacteria 510
129 Ga0207643_10013055 3300025908 Bacteria 4491
130 Ga0207707_10352379 3300025912 Bacteria 1268
131 Ga0207693_10266141 3300025915 Bacteria 1344
132 Ga0207663_11201885 3300025916 Bacteria 610
133 Ga0207660_10211906 3300025917 Bacteria 1517
134 Ga0207660_11068979 3300025917 Bacteria 658
135 Ga0207660_11503783 3300025917 Bacteria 544
136 Ga0207662_10118864 3300025918 Bacteria 1655
137 Ga0207657_10858295 3300025919 Bacteria 700
138 Ga0207657_11166159 3300025919 Unclassified 587
139 Ga0207652_10023577 3300025921 Bacteria 5098
140 Ga0207652_11263361 3300025921 Unclassified 641
141 Ga0207646_10176637 3300025922 Bacteria 1929
142 Ga0207687_10012647 3300025927 Bacteria 5514
143 Ga0207687_10037058 3300025927 Bacteria 3325
144 Ga0207644_10408488 3300025931 Bacteria 1111
145 Ga0207690_10576098 3300025932 Bacteria 917
146 Ga0207706_10020046 3300025933 Bacteria 6008
147 Ga0207706_10166914 3300025933 Bacteria 1935
148 Ga0207686_11029137 3300025934 Bacteria 669
149 Ga0207669_10149099 3300025937 Unclassified 1636
150 Ga0207669_11896928 3300025937 Unclassified 509
151 Ga0207704_10257498 3300025938 Bacteria 1314
152 Ga0207704_10546847 3300025938 Bacteria 940
153 Ga0207691_10127855 3300025940 Bacteria 2247
154 Ga0207711_10607557 3300025941 Bacteria 1020
155 Ga0207689_10062401 3300025942 Bacteria 3065
156 Ga0207661_10003871 3300025944 Bacteria 10436
157 Ga0207661_10031728 3300025944 Bacteria 4086
158 Ga0207661_10490247 3300025944 Bacteria 1122
159 Ga0207661_10505729 3300025944 Bacteria 1104
160 Ga0207679_10043133 3300025945 Bacteria 3246
161 Ga0207679_10062312 3300025945 Bacteria 2779
162 Ga0207679_10160194 3300025945 Bacteria 1842
163 Ga0207667_11373839 3300025949 Bacteria 680
164 Ga0207651_10528884 3300025960 Bacteria 1023
165 Ga0207712_10235437 3300025961 Bacteria 1472
166 Ga0207712_11877161 3300025961 Bacteria 537
167 Ga0207668_10582233 3300025972 Bacteria 973
168 Ga0207668_10591262 3300025972 Unclassified 966
169 Ga0207640_10146856 3300025981 Bacteria 1727
170 Ga0207677_10034713 3300026023 Bacteria 3269
171 Ga0207703_10501435 3300026035 Unclassified 1139
172 Ga0207639_10175904 3300026041 Bacteria 1817
173 Ga0207678_10524160 3300026067 Bacteria 1034
174 Ga0207708_10172020 3300026075 Bacteria 1716
175 Ga0207702_10009148 3300026078 Bacteria 8335
176 Ga0207702_10074114 3300026078 Bacteria 2937
177 Ga0207648_10235063 3300026089 Bacteria 1631
178 Ga0207648_10296114 3300026089 Bacteria 1450
179 Ga0207648_11324749 3300026089 Bacteria 677
180 Ga0207674_10003638 3300026116 Bacteria 18798
181 Ga0207674_10103087 3300026116 Bacteria 2833
182 Ga0207674_10580246 3300026116 Bacteria 1083
183 Ga0207675_101936540 3300026118 Bacteria 608
184 Ga0207683_10007827 3300026121 Bacteria 9148
185 Ga0207698_10158139 3300026142 Bacteria 1978
186 Ga0207428_10010765 3300027907 Bacteria 8154
187 Ga0207428_10405467 3300027907 Bacteria 998
188 Ga0268266_10526443 3300028379 Bacteria 1131
189 Ga0268266_11058816 3300028379 Bacteria 785
190 Ga0268264_10261399 3300028381 Bacteria 1613
191 Ga0268264_11845161 3300028381 Bacteria 614
192 Ga0265338_10797197 3300028800 Bacteria 647
193 Ga0307408_101465193 3300031548 Bacteria 644
194 Ga0307405_10001365 3300031731 Bacteria 10241
195 Ga0307413_10000877 3300031824 Bacteria 10625
196 Ga0307410_10007282 3300031852 Bacteria 6046
197 Ga0307410_10554914 3300031852 Bacteria 952
198 Ga0307406_10005538 3300031901 Bacteria 6907
199 Ga0307406_10035232 3300031901 Bacteria 3076
200 Ga0307407_10012037 3300031903 Bacteria 4145
201 Ga0307407_10142424 3300031903 Bacteria 1548
202 Ga0307412_10152042 3300031911 Bacteria 1709
203 Ga0307409_100010908 3300031995 Bacteria 5688
204 Ga0307409_100015513 3300031995 Bacteria 5003
205 Ga0307409_100399719 3300031995 Bacteria 1312
206 Ga0307416_100004186 3300032002 Bacteria 8649
207 Ga0307416_100056111 3300032002 Bacteria 3176
208 Ga0307414_10011957 3300032004 Bacteria 5118
209 Ga0307411_10026891 3300032005 Bacteria 3471
210 Ga0307415_100000572 3300032126 Bacteria 16174
211 Ga0307415_100035216 3300032126 Bacteria 3268
212 Ga0373952_0277909 3300035092 Unclassified 515
213 Ga0373936_0123054 3300035113 Bacteria 1110
214 Ga0373943_0236321 3300035170 Bacteria 1023
215 Ga0373961_0197292 3300035241 Bacteria 708
216 Ga0373931_0531054 3300035691 Bacteria 762
217 Ga0373935_1136608 3300035692 Bacteria 582
218 Ga0395899_0006796 3300037312 Bacteria 8865
219 Ga0395899_0014163 3300037312 Bacteria 6084
220 Ga0395899_0038569 3300037312 Bacteria 3578
221 Ga0395900_0013001 3300037418 Bacteria 8505
222 Ga0395900_0031576 3300037418 Bacteria 5444
223 Ga0395900_0209713 3300037418 Bacteria 1967
224 Ga0395900_0818230 3300037418 Bacteria 858
225 Ga0395900_1932547 3300037418 Unclassified 501
226 Ga0395898_0003238 3300037466 Bacteria 18294
227 Ga0395898_0040316 3300037466 Bacteria 4618
228 Ga0395898_0053569 3300037466 Bacteria 3940
229 Ga0395898_0113553 3300037466 Bacteria 2596
230 Ga0395898_0204245 3300037466 Bacteria 1885
231 Ga0395898_0262533 3300037466 Bacteria 1647
232 Ga0395898_1050753 3300037466 Unclassified 749
233 Ga0395905_0001864 3300037471 Bacteria 24276
234 Ga0395905_0007227 3300037471 Bacteria 11072
235 Ga0395905_0043481 3300037471 Bacteria 4214
236 Ga0395905_0122770 3300037471 Bacteria 2442
237 Ga0395905_0189479 3300037471 Bacteria 1929
238 Ga0395905_0339010 3300037471 Bacteria 1394
239 Ga0395905_1089926 3300037471 Unclassified 702
240 Ga0395905_1287708 3300037471 Bacteria 635
241 Ga0395905_1431376 3300037471 Unclassified 595
242 Ga0395901_0029559 3300038443 Bacteria 5642
243 Ga0395901_0058333 3300038443 Bacteria 4015
244 Ga0395901_0123828 3300038443 Bacteria 2716
245 Ga0395901_0199835 3300038443 Bacteria 2095
246 Ga0451853_0055024 3300041512 Bacteria 1380
247 Ga0439448_0169387 3300042005 Bacteria 762
248 Ga0450903_061155 3300042138 Bacteria 546
249 Ga0439435_0047575 3300042436 Bacteria 1219
250 Ga0466960_0334065 3300044901 Bacteria 861
251 Ga0451576_0199058 3300045051 Bacteria 2092
252 Ga0466967_1257139 3300045976 Bacteria 737
253 Ga0495603_0185158 3300046455 Bacteria 1204
254 Ga0495603_0773733 3300046455 Bacteria 548
255 Ga0495590_0101105 3300046457 Bacteria 1024
256 Ga0495591_034676 3300046458 Bacteria 1483
257 Ga0495641_0139131 3300046461 Unclassified 1084
258 Ga0495582_0028000 3300046473 Bacteria 3091
259 Ga0495582_0144382 3300046473 Bacteria 1350
260 Ga0495605_0030681 3300046474 Bacteria 2754
261 Ga0495639_0687518 3300046475 Unclassified 528
262 Ga0495584_0035765 3300046491 Bacteria 2510
263 Ga0495585_0039141 3300046492 Bacteria 2666
264 Ga0495585_0350079 3300046492 Bacteria 718
265 Ga0495594_0358993 3300046499 Bacteria 830
266 Ga0495596_0069261 3300046500 Bacteria 1371
267 Ga0495607_0175315 3300046501 Bacteria 1079
268 Ga0495607_0377641 3300046501 Bacteria 649
269 Ga0495608_0454852 3300046511 Bacteria 779
270 Ga0495616_0049947 3300046513 Bacteria 2094
271 Ga0495616_0227906 3300046513 Bacteria 809
272 Ga0495616_0386836 3300046513 Bacteria 577
273 Ga0495620_0219829 3300046515 Bacteria 727
274 Ga0495631_0084975 3300046518 Bacteria 1363
275 Ga0495637_0034063 3300046520 Bacteria 2232
276 Ga0495643_0283792 3300046522 Unclassified 761
277 Ga0495644_0046503 3300046523 Bacteria 1631
278 Ga0495644_0052695 3300046523 Bacteria 1528
279 Ga0495663_0045293 3300046525 Bacteria 1348
280 Ga0495663_0105125 3300046525 Bacteria 933
281 Ga0495663_0293691 3300046525 Bacteria 584
282 Ga0495642_0065575 3300046528 Bacteria 1512
283 Ga0495642_0071156 3300046528 Bacteria 1455
284 Ga0495665_0194906 3300046531 Bacteria 1051
285 Ga0495640_0174812 3300046533 Bacteria 1371
286 Ga0495586_0053854 3300046535 Bacteria 2180
287 Ga0495586_0461956 3300046535 Bacteria 732
288 Ga0495587_0211515 3300046536 Bacteria 1095
289 Ga0495598_0118111 3300046537 Bacteria 896
290 Ga0495609_0106343 3300046538 Bacteria 1213
291 Ga0495609_0138746 3300046538 Bacteria 1038
292 Ga0495621_0084779 3300046539 Bacteria 1187
293 Ga0495597_0031067 3300046542 Bacteria 2432
294 Ga0495667_0105699 3300046559 Bacteria 1820
295 Ga0495656_0106694 3300046615 Bacteria 1304
296 Ga0495656_0806984 3300046615 Bacteria 507
297 Ga0495668_0060537 3300046616 Bacteria 2089
298 Ga0495611_0135390 3300046648 Bacteria 1150
299 Ga0495635_0160470 3300046663 Bacteria 1530
300 Ga0495659_0006269 3300046664 Bacteria 3758
301 Ga0495659_0195154 3300046664 Bacteria 829
302 Ga0495588_0113594 3300046674 Bacteria 1427
303 Ga0495657_0894460 3300046675 Bacteria 505
304 Ga0495599_0481954 3300046678 Bacteria 732
305 Ga0495647_0023995 3300046681 Bacteria 2217
306 Ga0495658_0172206 3300046683 Bacteria 1340
307 Ga0495669_0549350 3300046684 Bacteria 562
308 Ga0495613_0157584 3300046689 Bacteria 1617
309 Ga0495613_1047092 3300046689 Unclassified 522
310 Ga0495670_0057036 3300046691 Bacteria 1960
311 Ga0495671_0053022 3300046692 Bacteria 2014
312 Ga0495649_0482089 3300046694 Unclassified 618
313 Ga0495589_0136618 3300046794 Bacteria 1175
314 Ga0495589_0302181 3300046794 Bacteria 741
315 Ga0495589_0409534 3300046794 Bacteria 622
316 Ga0495581_0023560 3300047315 Bacteria 3566
317 Ga0495676_0097917 3300047321 Bacteria 2177
318 Ga0495676_0381391 3300047321 Bacteria 938
319 Ga0495680_0406736 3300047322 Bacteria 939
320 Ga0495677_0025618 3300047445 Bacteria 2140
321 Ga0495677_0042394 3300047445 Bacteria 1667
322 Ga0495679_150163 3300047446 Bacteria 626
323 Ga0495685_034252 3300047447 Bacteria 1745
324 Ga0495614_0311728 3300048089 Bacteria 729
325 Ga0495615_0025555 3300048090 Bacteria 1372
326 Ga0495626_0071293 3300048091 Bacteria 1562
327 Ga0496100_0010775 3300048903 Bacteria 5186
328 Ga0496100_0021104 3300048903 Bacteria 3917
329 Ga0496100_0120873 3300048903 Bacteria 1832
330 Ga0496100_0287520 3300048903 Bacteria 1227
331 Ga0496101_0051563 3300048904 Bacteria 2965
332 Ga0496101_0069648 3300048904 Bacteria 2574
333 Ga0496101_0207366 3300048904 Bacteria 1517
334 Ga0496101_0850035 3300048904 Bacteria 719
335 Ga0496102_0017881 3300048905 Bacteria 6217
336 Ga0496102_0260196 3300048905 Bacteria 1636
337 Ga0496102_0301266 3300048905 Bacteria 1511
338 Ga0496102_1820387 3300048905 Bacteria 526
339 Ga0496103_0089826 3300048906 Bacteria 1938
340 Ga0496103_0485803 3300048906 Bacteria 791
341 Ga0496104_0000617 3300048907 Bacteria 30492
342 Ga0496104_0061664 3300048907 Bacteria 3555
343 Ga0496105_0000147 3300048908 Bacteria 46556
344 Ga0496105_0018500 3300048908 Bacteria 5603
345 Ga0496105_0025367 3300048908 Bacteria 4826
346 Ga0496105_0709627 3300048908 Bacteria 771
347 Ga0496106_0299574 3300048909 Bacteria 1289
348 Ga0496107_0043862 3300048910 Bacteria 3214
349 Ga0496107_0069997 3300048910 Bacteria 2547
350 Ga0496107_1247834 3300048910 Bacteria 533
351 Ga0496108_0015314 3300048911 Bacteria 6256
352 Ga0496108_0088555 3300048911 Bacteria 2630
353 Ga0496108_0329165 3300048911 Bacteria 1332
354 Ga0496108_0921069 3300048911 Bacteria 749
355 Ga0496108_1653851 3300048911 Bacteria 528
356 Ga0496109_0004593 3300048912 Bacteria 11528
357 Ga0496109_0030399 3300048912 Bacteria 4841
358 Ga0496109_0101486 3300048912 Bacteria 2670
359 Ga0496109_0144023 3300048912 Bacteria 2229
360 Ga0496109_0199209 3300048912 Bacteria 1882
361 Ga0496109_1093736 3300048912 Bacteria 734
362 Ga0496110_0007430 3300048913 Bacteria 8753
363 Ga0496110_0007665 3300048913 Bacteria 8636
364 Ga0496110_0024072 3300048913 Bacteria 5188
365 Ga0496110_0211348 3300048913 Bacteria 1764
366 Ga0496111_0003991 3300048914 Bacteria 9259
367 Ga0496111_0005761 3300048914 Bacteria 7994
368 Ga0496111_0069308 3300048914 Bacteria 2564
369 Ga0496111_0645298 3300048914 Bacteria 773
370 Ga0496112_0108987 3300048915 Bacteria 2740
371 Ga0496112_0626791 3300048915 Bacteria 1006
372 Ga0496112_1509940 3300048915 Bacteria 586
373 Ga0496113_0052982 3300048916 Bacteria 3033
374 Ga0496113_0090923 3300048916 Bacteria 2352
375 Ga0496113_1479554 3300048916 Bacteria 524
376 Ga0496114_0002427 3300048917 Bacteria 14222
377 Ga0496114_0475443 3300048917 Bacteria 1106
378 Ga0496115_0271512 3300048918 Bacteria 1393
379 Ga0496115_0608719 3300048918 Bacteria 868
380 Ga0501291_014733 3300049514 Bacteria 1174
381 Ga0501032_0060793 3300049569 Bacteria 2534
382 Ga0501033_0133117 3300049570 Bacteria 1800
383 Ga0501034_0194398 3300049571 Bacteria 1990
384 Ga0501036_0096344 3300049572 Bacteria 2501
385 Ga0501036_0230013 3300049572 Bacteria 1556
386 Ga0501038_0137162 3300049574 Bacteria 2003
387 Ga0501038_0782953 3300049574 Bacteria 710
388 Ga0501039_0211622 3300049575 Bacteria 1524
389 Ga0501039_0815929 3300049575 Bacteria 727
390 Ga0501040_0020553 3300049576 Bacteria 4401
391 Ga0501040_0132210 3300049576 Bacteria 1755
392 Ga0501041_0120918 3300049577 Bacteria 1627
393 Ga0501042_0139231 3300049578 Bacteria 1749
394 Ga0501043_0568393 3300049579 Bacteria 841
395 Ga0501046_0125368 3300049580 Bacteria 1951
396 Ga0501047_0318919 3300049581 Bacteria 1394
397 Ga0501048_0040996 3300049582 Bacteria 3316
398 Ga0501048_0714694 3300049582 Bacteria 719
399 Ga0501068_0010774 3300049584 Bacteria 5141
400 Ga0501068_0461335 3300049584 Bacteria 822
401 Ga0501068_0920930 3300049584 Bacteria 575
402 Ga0501069_0055297 3300049585 Bacteria 2211
403 Ga0501069_0179793 3300049585 Bacteria 1222
404 Ga0501070_0077653 3300049586 Bacteria 2748
405 Ga0501070_0303738 3300049586 Bacteria 1300
406 Ga0501071_0041228 3300049587 Bacteria 3306
407 Ga0501071_0264436 3300049587 Bacteria 1299
408 Ga0501072_0038530 3300049588 Bacteria 3751
409 Ga0501072_0244792 3300049588 Bacteria 1428
410 Ga0501072_1282960 3300049588 Unclassified 568
411 Ga0501073_0314870 3300049589 Bacteria 1080
412 Ga0501074_0122999 3300049590 Bacteria 1856
413 Ga0501074_0209201 3300049590 Bacteria 1390
414 Ga0501074_0227599 3300049590 Bacteria 1327
415 Ga0501075_0110393 3300049591 Bacteria 2091
416 Ga0501076_0003745 3300049592 Bacteria 10689
417 Ga0501076_0031474 3300049592 Bacteria 4138
418 Ga0501076_0190256 3300049592 Bacteria 1674
419 Ga0501076_0794761 3300049592 Bacteria 781
420 Ga0501077_0009366 3300049593 Bacteria 6084
421 Ga0501077_0090471 3300049593 Bacteria 1939
422 Ga0501077_0131739 3300049593 Bacteria 1585
423 Ga0501209_130063 3300049656 Bacteria 751
424 Ga0501217_028904 3300049661 Bacteria 1353
425 Ga0501259_185781 3300049688 Unclassified 528
426 Ga0501079_0090059 3300049741 Bacteria 2376
427 Ga0501079_0238863 3300049741 Bacteria 1419
428 Ga0501079_0348892 3300049741 Bacteria 1159
429 Ga0501079_0961315 3300049741 Bacteria 673
430 Ga0501080_0041568 3300049742 Bacteria 4283
431 Ga0501081_0030904 3300049743 Bacteria 3628
432 Ga0501081_1402301 3300049743 Bacteria 530
433 Ga0501083_0239311 3300049744 Bacteria 1182
434 Ga0501035_0410574 3300049822 Bacteria 1125
435 Ga0501044_0459871 3300049823 Bacteria 1178
436 Ga0501045_0152623 3300049824 Bacteria 1718
437 Ga0501045_0700154 3300049824 Bacteria 747
438 nmdc:mga03683_342683_c1 3300050489 Bacteria 706
439 nmdc:mga05p37_267216_c1 3300050507 Bacteria 2045
440 nmdc:mga09592_40684_c1 3300050508 Bacteria 3905
441 nmdc:mga0qj67_394559_c1 3300050509 Unclassified 1117
442 nmdc:mga06r32_69755_c1 3300050510 Bacteria 3397
443 nmdc:mga08y16_11600_c1 3300050511 Bacteria 9258
444 nmdc:mga08y16_19285_c1 3300050511 Bacteria 7187
445 nmdc:mga08y16_799086_c1 3300050511 Bacteria 936
446 nmdc:mga0n895_1038531_c1 3300050512 Bacteria 799
447 nmdc:mga0a205_833855_c1 3300050515 Bacteria 769
448 Ga0495601_0924789 3300053077 Bacteria 550
449 Ga0495655_0316573 3300053083 Bacteria 539
450 Ga0495595_0524645 3300053084 Bacteria 604
451 Ga0495595_0609448 3300053084 Bacteria 558
452 Ga0495619_0067780 3300053085 Bacteria 2383
453 Ga0495619_0202518 3300053085 Bacteria 1374
454 Ga0495619_0229951 3300053085 Bacteria 1285
455 Ga0495619_0385657 3300053085 Bacteria 968
456 Ga0501084_0741240 3300054114 Bacteria 828
457 Ga0501082_0031092 3300060353 Bacteria 4601
458 Ga0501082_0309758 3300060353 Bacteria 1375
459 Ga0501082_0379836 3300060353 Bacteria 1233
460 Ga0501082_1504426 3300060353 Bacteria 588
461 Ga0530510_0020936 3300061734 Bacteria 4651
462 Ga0530510_0023613 3300061734 Bacteria 4383
463 Ga0530510_0217755 3300061734 Bacteria 1419
464 Ga0530510_1490435 3300061734 Bacteria 519

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0014163 Ga0395899_0014163_351_713 102
2 3300037418 Ga0395900_0013001 Ga0395900_0013001_2854_3216 102
3 3300037466 Ga0395898_0040316 Ga0395898_0040316_1036_1398 102
4 3300037471 Ga0395905_0007227 Ga0395905_0007227_9842_10204 102
5 3300038443 Ga0395901_0123828 Ga0395901_0123828_2275_2637 102
6 3300044901 Ga0466960_0334065 Ga0466960_0334065_105_578 106
7 3300046455 Ga0495603_0185158 Ga0495603_0185158_389_751 106
8 3300005459 Ga0068867_100994807 Ga0068867_1009948072 109
9 3300005549 Ga0070704_100585269 Ga0070704_1005852691 109
10 3300006881 Ga0068865_100715782 Ga0068865_1007157823 109
11 3300026089 Ga0207648_11324749 Ga0207648_113247492 109
12 3300035113 Ga0373936_0123054 Ga0373936_0123054_614_1000 109
13 3300035170 Ga0373943_0236321 Ga0373943_0236321_23_430 109
14 3300046473 Ga0495582_0028000 Ga0495582_0028000_2316_2702 109
15 3300046475 Ga0495639_0687518 Ga0495639_0687518_115_501 109
16 3300046531 Ga0495665_0194906 Ga0495665_0194906_491_877 109
17 3300046535 Ga0495586_0053854 Ga0495586_0053854_1314_1700 109
18 3300046681 Ga0495647_0023995 Ga0495647_0023995_1559_1945 109
19 3300046689 Ga0495613_1047092 Ga0495613_1047092_23_409 109
20 3300047315 Ga0495581_0023560 Ga0495581_0023560_1515_1901 109
21 3300047321 Ga0495676_0097917 Ga0495676_0097917_1477_1863 109
22 3300048089 Ga0495614_0311728 Ga0495614_0311728_151_537 109
23 3300005719 Ga0068861_101431812 Ga0068861_1014318122 113
24 3300026118 Ga0207675_101936540 Ga0207675_1019365402 113
25 3300037418 Ga0395900_0818230 Ga0395900_0818230_218_619 113
26 3300037466 Ga0395898_0204245 Ga0395898_0204245_240_641 113
27 3300037471 Ga0395905_0189479 Ga0395905_0189479_892_1293 113
28 3300048911 Ga0496108_1653851 Ga0496108_1653851_24_407 113
29 3300005937 Ga0081455_10050398 Ga0081455_100503982 114
30 3300048904 Ga0496101_0850035 Ga0496101_0850035_349_702 114
31 3300049572 Ga0501036_0230013 Ga0501036_0230013_877_1257 114
32 3300060353 Ga0501082_0379836 Ga0501082_0379836_627_1007 114
33 3300005338 Ga0068868_100499741 Ga0068868_1004997412 115
34 3300005341 Ga0070691_10015309 Ga0070691_100153095 115
35 3300005347 Ga0070668_100519839 Ga0070668_1005198391 115
36 3300005445 Ga0070708_100134452 Ga0070708_1001344523 115
37 3300005459 Ga0068867_100240280 Ga0068867_1002402802 115
38 3300005471 Ga0070698_100007005 Ga0070698_1000070059 115
39 3300005518 Ga0070699_100424960 Ga0070699_1004249602 115
40 3300005545 Ga0070695_100515526 Ga0070695_1005155263 115
41 3300005578 Ga0068854_100023298 Ga0068854_1000232983 115
42 3300005719 Ga0068861_100100149 Ga0068861_1001001494 115
43 3300006914 Ga0075436_100503518 Ga0075436_1005035182 115
44 3300009098 Ga0105245_10052562 Ga0105245_100525622 115
45 3300014745 Ga0157377_10311315 Ga0157377_103113152 115
46 3300031852 Ga0307410_10554914 Ga0307410_105549142 115
47 3300031901 Ga0307406_10005538 Ga0307406_100055382 115
48 3300031903 Ga0307407_10142424 Ga0307407_101424243 115
49 3300031911 Ga0307412_10152042 Ga0307412_101520423 115
50 3300031995 Ga0307409_100010908 Ga0307409_1000109086 115
51 3300032002 Ga0307416_100004186 Ga0307416_1000041869 115
52 3300032126 Ga0307415_100000572 Ga0307415_1000005725 115
53 3300046455 Ga0495603_0773733 Ga0495603_0773733_51_401 115
54 3300046473 Ga0495582_0144382 Ga0495582_0144382_916_1266 115
55 3300046535 Ga0495586_0461956 Ga0495586_0461956_362_712 115
56 3300046683 Ga0495658_0172206 Ga0495658_0172206_742_1092 115
57 3300048912 Ga0496109_1093736 Ga0496109_1093736_97_447 115
58 3300048913 Ga0496110_0211348 Ga0496110_0211348_129_479 115
59 3300048914 Ga0496111_0645298 Ga0496111_0645298_60_410 115
60 3300049584 Ga0501068_0920930 Ga0501068_0920930_47_439 115
61 3300005547 Ga0070693_101104746 Ga0070693_1011047462 116
62 3300025917 Ga0207660_10211906 Ga0207660_102119063 116
63 3300046501 Ga0495607_0377641 Ga0495607_0377641_125_544 116
64 3300049571 Ga0501034_0194398 Ga0501034_0194398_740_1090 116
65 3300049590 Ga0501074_0209201 Ga0501074_0209201_680_1030 116
66 3300049592 Ga0501076_0794761 Ga0501076_0794761_352_744 116
67 3300009094 Ga0111539_10928379 Ga0111539_109283792 117
68 3300009101 Ga0105247_10935670 Ga0105247_109356702 117
69 3300009148 Ga0105243_12514045 Ga0105243_125140451 117
70 3300048906 Ga0496103_0485803 Ga0496103_0485803_117_500 117
71 3300049576 Ga0501040_0132210 Ga0501040_0132210_427_819 117
72 3300053083 Ga0495655_0316573 Ga0495655_0316573_18_407 117
73 3300054114 Ga0501084_0741240 Ga0501084_0741240_134_493 117
74 3300060353 Ga0501082_0309758 Ga0501082_0309758_530_922 117
75 3300061734 Ga0530510_1490435 Ga0530510_1490435_55_447 117
76 3300005564 Ga0070664_100580224 Ga0070664_1005802242 118
77 3300053084 Ga0495595_0609448 Ga0495595_0609448_61_426 118
78 3300005471 Ga0070698_100051187 Ga0070698_1000511872 119
79 3300005536 Ga0070697_100918106 Ga0070697_1009181062 119
80 3300009148 Ga0105243_10318080 Ga0105243_103180802 119
81 3300025916 Ga0207663_11201885 Ga0207663_112018852 119
82 3300025919 Ga0207657_10858295 Ga0207657_108582952 119
83 3300025933 Ga0207706_10166914 Ga0207706_101669143 119
84 3300025938 Ga0207704_10257498 Ga0207704_102574982 119
85 3300026089 Ga0207648_10235063 Ga0207648_102350633 119
86 3300035692 Ga0373935_1136608 Ga0373935_1136608_118_480 119
87 3300046511 Ga0495608_0454852 Ga0495608_0454852_299_661 119
88 3300046559 Ga0495667_0105699 Ga0495667_0105699_645_1007 119
89 3300046675 Ga0495657_0894460 Ga0495657_0894460_38_400 119
90 3300046694 Ga0495649_0482089 Ga0495649_0482089_28_417 119
91 3300047322 Ga0495680_0406736 Ga0495680_0406736_554_913 119
92 3300048911 Ga0496108_0329165 Ga0496108_0329165_266_625 119
93 3300053084 Ga0495595_0524645 Ga0495595_0524645_99_461 119
94 3300053085 Ga0495619_0067780 Ga0495619_0067780_1733_2095 119
95 3300005343 Ga0070687_101262967 Ga0070687_1012629672 120
96 3300005985 Ga0081539_10001616 Ga0081539_1000161621 120
97 3300037312 Ga0395899_0038569 Ga0395899_0038569_1576_1977 120
98 3300037466 Ga0395898_0053569 Ga0395898_0053569_1060_1461 120
99 3300037471 Ga0395905_0043481 Ga0395905_0043481_2754_3155 120
100 3300038443 Ga0395901_0029559 Ga0395901_0029559_3256_3657 120
101 3300046513 Ga0495616_0386836 Ga0495616_0386836_49_411 120
102 3300005436 Ga0070713_100409180 Ga0070713_1004091802 121
103 3300005445 Ga0070708_100340349 Ga0070708_1003403492 121
104 3300006175 Ga0070712_100343310 Ga0070712_1003433102 121
105 3300025915 Ga0207693_10266141 Ga0207693_102661412 121
106 3300025921 Ga0207652_11263361 Ga0207652_112633612 121
107 3300037466 Ga0395898_0262533 Ga0395898_0262533_124_489 121
108 3300037471 Ga0395905_1431376 Ga0395905_1431376_66_431 121
109 3300046461 Ga0495641_0139131 Ga0495641_0139131_341_706 121
110 3300048903 Ga0496100_0021104 Ga0496100_0021104_1131_1496 121
111 3300048904 Ga0496101_0207366 Ga0496101_0207366_936_1301 121
112 3300048907 Ga0496104_0061664 Ga0496104_0061664_1749_2114 121
113 3300048908 Ga0496105_0025367 Ga0496105_0025367_1839_2204 121
114 3300048912 Ga0496109_0144023 Ga0496109_0144023_1545_1910 121
115 3300048917 Ga0496114_0475443 Ga0496114_0475443_123_488 121
116 3300049584 Ga0501068_0010774 Ga0501068_0010774_4535_4924 121
117 3300049585 Ga0501069_0179793 Ga0501069_0179793_694_1083 121
118 3300049586 Ga0501070_0077653 Ga0501070_0077653_1630_2019 121
119 3300049743 Ga0501081_1402301 Ga0501081_1402301_118_507 121
120 3300053085 Ga0495619_0229951 Ga0495619_0229951_543_908 121
121 3300061734 Ga0530510_0217755 Ga0530510_0217755_489_878 121
122 3300005340 Ga0070689_100402856 Ga0070689_1004028562 122
123 3300005507 Ga0074259_10281497 Ga0074259_102814971 122
124 3300005549 Ga0070704_100309221 Ga0070704_1003092212 122
125 3300005549 Ga0070704_100768871 Ga0070704_1007688712 122
126 3300009176 Ga0105242_10419050 Ga0105242_104190502 122
127 3300009176 Ga0105242_10726028 Ga0105242_107260282 122
128 3300025934 Ga0207686_11029137 Ga0207686_110291371 122
129 3300037466 Ga0395898_1050753 Ga0395898_1050753_96_464 122
130 3300037471 Ga0395905_0339010 Ga0395905_0339010_673_1041 122
131 3300037471 Ga0395905_1089926 Ga0395905_1089926_267_635 122
132 3300037471 Ga0395905_1287708 Ga0395905_1287708_46_414 122
133 3300046499 Ga0495594_0358993 Ga0495594_0358993_369_737 122
134 3300046513 Ga0495616_0227906 Ga0495616_0227906_276_644 122
135 3300046518 Ga0495631_0084975 Ga0495631_0084975_626_994 122
136 3300046523 Ga0495644_0046503 Ga0495644_0046503_507_875 122
137 3300046525 Ga0495663_0045293 Ga0495663_0045293_136_504 122
138 3300046528 Ga0495642_0065575 Ga0495642_0065575_405_773 122
139 3300046536 Ga0495587_0211515 Ga0495587_0211515_675_1043 122
140 3300046538 Ga0495609_0138746 Ga0495609_0138746_361_729 122
141 3300046616 Ga0495668_0060537 Ga0495668_0060537_1628_1996 122
142 3300046663 Ga0495635_0160470 Ga0495635_0160470_255_623 122
143 3300046664 Ga0495659_0195154 Ga0495659_0195154_273_641 122
144 3300046674 Ga0495588_0113594 Ga0495588_0113594_192_560 122
145 3300046678 Ga0495599_0481954 Ga0495599_0481954_154_522 122
146 3300046794 Ga0495589_0302181 Ga0495589_0302181_174_542 122
147 3300047321 Ga0495676_0381391 Ga0495676_0381391_409_777 122
148 3300047445 Ga0495677_0025618 Ga0495677_0025618_609_977 122
149 3300048905 Ga0496102_0260196 Ga0496102_0260196_363_731 122
150 3300048915 Ga0496112_0108987 Ga0496112_0108987_516_884 122
151 3300048915 Ga0496112_1509940 Ga0496112_1509940_19_387 122
152 3300053085 Ga0495619_0385657 Ga0495619_0385657_294_662 122
153 3300005347 Ga0070668_100816715 Ga0070668_1008167152 123
154 3300005441 Ga0070700_100404985 Ga0070700_1004049852 123
155 3300005535 Ga0070684_100244680 Ga0070684_1002446802 123
156 3300005614 Ga0068856_100039121 Ga0068856_1000391213 123
157 3300005843 Ga0068860_102369963 Ga0068860_1023699631 123
158 3300006175 Ga0070712_101655875 Ga0070712_1016558751 123
159 3300006852 Ga0075433_10910559 Ga0075433_109105592 123
160 3300006871 Ga0075434_100637633 Ga0075434_1006376332 123
161 3300009094 Ga0111539_10385283 Ga0111539_103852832 123
162 3300009553 Ga0105249_10647322 Ga0105249_106473222 123
163 3300013105 Ga0157369_10895437 Ga0157369_108954373 123
164 3300014745 Ga0157377_10182938 Ga0157377_101829382 123
165 3300025917 Ga0207660_11503783 Ga0207660_115037831 123
166 3300025944 Ga0207661_10505729 Ga0207661_105057293 123
167 3300025961 Ga0207712_10235437 Ga0207712_102354373 123
168 3300025972 Ga0207668_10591262 Ga0207668_105912622 123
169 3300026075 Ga0207708_10172020 Ga0207708_101720202 123
170 3300028800 Ga0265338_10797197 Ga0265338_107971971 123
171 3300041512 Ga0451853_0055024 Ga0451853_0055024_72_443 123
172 3300048903 Ga0496100_0287520 Ga0496100_0287520_747_1127 123
173 3300048904 Ga0496101_0051563 Ga0496101_0051563_2042_2422 123
174 3300048905 Ga0496102_0301266 Ga0496102_0301266_441_821 123
175 3300048908 Ga0496105_0018500 Ga0496105_0018500_1247_1627 123
176 3300048909 Ga0496106_0299574 Ga0496106_0299574_853_1233 123
177 3300048910 Ga0496107_0069997 Ga0496107_0069997_435_815 123
178 3300048911 Ga0496108_0921069 Ga0496108_0921069_174_554 123
179 3300048912 Ga0496109_0199209 Ga0496109_0199209_898_1278 123
180 3300048913 Ga0496110_0007665 Ga0496110_0007665_3772_4152 123
181 3300048914 Ga0496111_0005761 Ga0496111_0005761_3982_4362 123
182 3300048916 Ga0496113_0052982 Ga0496113_0052982_909_1289 123
183 3300049574 Ga0501038_0782953 Ga0501038_0782953_318_692 123
184 3300049579 Ga0501043_0568393 Ga0501043_0568393_115_489 123
185 3300049581 Ga0501047_0318919 Ga0501047_0318919_488_862 123
186 3300049589 Ga0501073_0314870 Ga0501073_0314870_158_532 123
187 3300049823 Ga0501044_0459871 Ga0501044_0459871_221_595 123
188 3300050515 nmdc:mga0a205_833855_c1 nmdc:mga0a205_833855_c1_56_436 123
189 3300005338 Ga0068868_100264115 Ga0068868_1002641153 124
190 3300005366 Ga0070659_101054705 Ga0070659_1010547051 124
191 3300005456 Ga0070678_100012613 Ga0070678_1000126134 124
192 3300005530 Ga0070679_100034278 Ga0070679_1000342785 124
193 3300005535 Ga0070684_100056916 Ga0070684_1000569165 124
194 3300005547 Ga0070693_100018856 Ga0070693_1000188562 124
195 3300005548 Ga0070665_101216754 Ga0070665_1012167542 124
196 3300005564 Ga0070664_100065896 Ga0070664_1000658962 124
197 3300005577 Ga0068857_100571154 Ga0068857_1005711542 124
198 3300005578 Ga0068854_100088626 Ga0068854_1000886262 124
199 3300005614 Ga0068856_100009977 Ga0068856_1000099774 124
200 3300005614 Ga0068856_100116403 Ga0068856_1001164032 124
201 3300005840 Ga0068870_10388775 Ga0068870_103887752 124
202 3300006237 Ga0097621_100254225 Ga0097621_1002542253 124
203 3300006844 Ga0075428_101493688 Ga0075428_1014936882 124
204 3300006846 Ga0075430_100102386 Ga0075430_1001023862 124
205 3300006880 Ga0075429_100136475 Ga0075429_1001364752 124
206 3300006881 Ga0068865_100523267 Ga0068865_1005232672 124
207 3300006881 Ga0068865_100788391 Ga0068865_1007883912 124
208 3300009098 Ga0105245_10087549 Ga0105245_100875492 124
209 3300009147 Ga0114129_10131020 Ga0114129_101310202 124
210 3300009553 Ga0105249_10989084 Ga0105249_109890842 124
211 3300013308 Ga0157375_10174208 Ga0157375_101742082 124
212 3300014325 Ga0163163_10141163 Ga0163163_101411632 124
213 3300014968 Ga0157379_10271236 Ga0157379_102712362 124
214 3300014969 Ga0157376_10679444 Ga0157376_106794443 124
215 3300025912 Ga0207707_10352379 Ga0207707_103523792 124
216 3300025921 Ga0207652_10023577 Ga0207652_100235775 124
217 3300025927 Ga0207687_10012647 Ga0207687_100126475 124
218 3300025932 Ga0207690_10576098 Ga0207690_105760982 124
219 3300025938 Ga0207704_10546847 Ga0207704_105468472 124
220 3300025944 Ga0207661_10003871 Ga0207661_1000387111 124
221 3300025945 Ga0207679_10062312 Ga0207679_100623123 124
222 3300026023 Ga0207677_10034713 Ga0207677_100347132 124
223 3300026041 Ga0207639_10175904 Ga0207639_101759042 124
224 3300026078 Ga0207702_10009148 Ga0207702_100091487 124
225 3300026078 Ga0207702_10074114 Ga0207702_100741144 124
226 3300026116 Ga0207674_10580246 Ga0207674_105802462 124
227 3300026121 Ga0207683_10007827 Ga0207683_100078275 124
228 3300028379 Ga0268266_11058816 Ga0268266_110588162 124
229 3300042138 Ga0450903_061155 Ga0450903_061155_99_482 124
230 3300046533 Ga0495640_0174812 Ga0495640_0174812_532_915 124
231 3300046689 Ga0495613_0157584 Ga0495613_0157584_746_1129 124
232 3300048903 Ga0496100_0010775 Ga0496100_0010775_2827_3210 124
233 3300048903 Ga0496100_0120873 Ga0496100_0120873_68_454 124
234 3300048904 Ga0496101_0069648 Ga0496101_0069648_390_773 124
235 3300048905 Ga0496102_0017881 Ga0496102_0017881_122_508 124
236 3300048906 Ga0496103_0089826 Ga0496103_0089826_1439_1822 124
237 3300048907 Ga0496104_0000617 Ga0496104_0000617_11874_12257 124
238 3300048908 Ga0496105_0000147 Ga0496105_0000147_8355_8738 124
239 3300048908 Ga0496105_0709627 Ga0496105_0709627_292_675 124
240 3300048910 Ga0496107_0043862 Ga0496107_0043862_741_1124 124
241 3300048910 Ga0496107_1247834 Ga0496107_1247834_112_498 124
242 3300048911 Ga0496108_0088555 Ga0496108_0088555_1446_1829 124
243 3300048912 Ga0496109_0004593 Ga0496109_0004593_350_733 124
244 3300048912 Ga0496109_0101486 Ga0496109_0101486_1919_2305 124
245 3300048913 Ga0496110_0024072 Ga0496110_0024072_3796_4179 124
246 3300048914 Ga0496111_0069308 Ga0496111_0069308_270_653 124
247 3300048915 Ga0496112_0626791 Ga0496112_0626791_205_588 124
248 3300048916 Ga0496113_1479554 Ga0496113_1479554_105_488 124
249 3300048917 Ga0496114_0002427 Ga0496114_0002427_1691_2074 124
250 3300048918 Ga0496115_0271512 Ga0496115_0271512_349_735 124
251 3300049588 Ga0501072_1282960 Ga0501072_1282960_50_424 124
252 3300050507 nmdc:mga05p37_267216_c1 nmdc:mga05p37_267216_c1_1575_1952 124
253 3300050508 nmdc:mga09592_40684_c1 nmdc:mga09592_40684_c1_1542_1919 124
254 3300050509 nmdc:mga0qj67_394559_c1 nmdc:mga0qj67_394559_c1_315_692 124
255 3300050511 nmdc:mga08y16_799086_c1 nmdc:mga08y16_799086_c1_372_749 124
256 3300050512 nmdc:mga0n895_1038531_c1 nmdc:mga0n895_1038531_c1_33_416 124
257 3300053077 Ga0495601_0924789 Ga0495601_0924789_50_433 124
258 3300053085 Ga0495619_0202518 Ga0495619_0202518_275_658 124
259 3300005468 Ga0070707_100221649 Ga0070707_1002216492 125
260 3300025922 Ga0207646_10176637 Ga0207646_101766373 125
261 3300045976 Ga0466967_1257139 Ga0466967_1257139_217_597 125
262 3300048918 Ga0496115_0608719 Ga0496115_0608719_213_596 125
263 3300035241 Ga0373961_0197292 Ga0373961_0197292_93_476 127
264 3300035691 Ga0373931_0531054 Ga0373931_0531054_222_605 127
265 3300037418 Ga0395900_1932547 Ga0395900_1932547_16_399 127
266 3300046615 Ga0495656_0106694 Ga0495656_0106694_887_1270 127
267 3300049582 Ga0501048_0714694 Ga0501048_0714694_287_670 127
268 3300049586 Ga0501070_0303738 Ga0501070_0303738_330_713 127
269 3300049588 Ga0501072_0244792 Ga0501072_0244792_783_1166 127
270 3300049590 Ga0501074_0122999 Ga0501074_0122999_485_868 127
271 3300049591 Ga0501075_0110393 Ga0501075_0110393_607_990 127
272 3300049592 Ga0501076_0031474 Ga0501076_0031474_3210_3593 127
273 3300049593 Ga0501077_0131739 Ga0501077_0131739_79_462 127
274 3300049741 Ga0501079_0090059 Ga0501079_0090059_1407_1790 127
275 3300049744 Ga0501083_0239311 Ga0501083_0239311_617_1000 127
276 3300061734 Ga0530510_0020936 Ga0530510_0020936_70_453 127
277 3300006914 Ga0075436_100974683 Ga0075436_1009746832 128
278 3300025918 Ga0207662_10118864 Ga0207662_101188643 128
279 3300031548 Ga0307408_101465193 Ga0307408_1014651932 128
280 3300031731 Ga0307405_10001365 Ga0307405_100013653 128
281 3300031824 Ga0307413_10000877 Ga0307413_100008774 128
282 3300031852 Ga0307410_10007282 Ga0307410_100072825 128
283 3300031901 Ga0307406_10035232 Ga0307406_100352325 128
284 3300031903 Ga0307407_10012037 Ga0307407_100120373 128
285 3300031995 Ga0307409_100015513 Ga0307409_1000155132 128
286 3300032002 Ga0307416_100056111 Ga0307416_1000561112 128
287 3300032004 Ga0307414_10011957 Ga0307414_100119572 128
288 3300032005 Ga0307411_10026891 Ga0307411_100268912 128
289 3300032126 Ga0307415_100035216 Ga0307415_1000352165 128
290 3300037312 Ga0395899_0006796 Ga0395899_0006796_7476_7862 128
291 3300037418 Ga0395900_0031576 Ga0395900_0031576_1851_2279 128
292 3300037418 Ga0395900_0209713 Ga0395900_0209713_1004_1390 128
293 3300037466 Ga0395898_0003238 Ga0395898_0003238_5862_6248 128
294 3300037466 Ga0395898_0113553 Ga0395898_0113553_2054_2482 128
295 3300037471 Ga0395905_0001864 Ga0395905_0001864_10049_10435 128
296 3300037471 Ga0395905_0122770 Ga0395905_0122770_785_1213 128
297 3300038443 Ga0395901_0058333 Ga0395901_0058333_412_840 128
298 3300038443 Ga0395901_0199835 Ga0395901_0199835_1132_1518 128
299 3300042436 Ga0439435_0047575 Ga0439435_0047575_769_1161 128
300 3300047446 Ga0495679_150163 Ga0495679_150163_95_481 128
301 3300049569 Ga0501032_0060793 Ga0501032_0060793_1593_1985 128
302 3300049570 Ga0501033_0133117 Ga0501033_0133117_731_1123 128
303 3300049572 Ga0501036_0096344 Ga0501036_0096344_1119_1511 128
304 3300049574 Ga0501038_0137162 Ga0501038_0137162_1572_1964 128
305 3300049575 Ga0501039_0211622 Ga0501039_0211622_70_462 128
306 3300049575 Ga0501039_0815929 Ga0501039_0815929_304_696 128
307 3300049576 Ga0501040_0020553 Ga0501040_0020553_2452_2844 128
308 3300049577 Ga0501041_0120918 Ga0501041_0120918_349_741 128
309 3300049578 Ga0501042_0139231 Ga0501042_0139231_991_1383 128
310 3300049580 Ga0501046_0125368 Ga0501046_0125368_1521_1913 128
311 3300049582 Ga0501048_0040996 Ga0501048_0040996_2267_2659 128
312 3300049584 Ga0501068_0461335 Ga0501068_0461335_38_430 128
313 3300049585 Ga0501069_0055297 Ga0501069_0055297_887_1279 128
314 3300049587 Ga0501071_0041228 Ga0501071_0041228_2328_2720 128
315 3300049587 Ga0501071_0264436 Ga0501071_0264436_668_1060 128
316 3300049588 Ga0501072_0038530 Ga0501072_0038530_1032_1424 128
317 3300049590 Ga0501074_0227599 Ga0501074_0227599_883_1275 128
318 3300049592 Ga0501076_0003745 Ga0501076_0003745_9279_9671 128
319 3300049592 Ga0501076_0190256 Ga0501076_0190256_1019_1411 128
320 3300049593 Ga0501077_0009366 Ga0501077_0009366_4516_4908 128
321 3300049593 Ga0501077_0090471 Ga0501077_0090471_608_1000 128
322 3300049656 Ga0501209_130063 Ga0501209_130063_230_616 128
323 3300049688 Ga0501259_185781 Ga0501259_185781_116_502 128
324 3300049741 Ga0501079_0238863 Ga0501079_0238863_849_1241 128
325 3300049741 Ga0501079_0348892 Ga0501079_0348892_104_496 128
326 3300049742 Ga0501080_0041568 Ga0501080_0041568_3091_3483 128
327 3300049743 Ga0501081_0030904 Ga0501081_0030904_991_1383 128
328 3300049822 Ga0501035_0410574 Ga0501035_0410574_550_942 128
329 3300049824 Ga0501045_0152623 Ga0501045_0152623_1138_1530 128
330 3300049824 Ga0501045_0700154 Ga0501045_0700154_155_547 128
331 3300050510 nmdc:mga06r32_69755_c1 nmdc:mga06r32_69755_c1_1435_1836 128
332 3300060353 Ga0501082_0031092 Ga0501082_0031092_672_1064 128
333 3300061734 Ga0530510_0023613 Ga0530510_0023613_2360_2752 128
334 3300005329 Ga0070683_101946737 Ga0070683_1019467371 129
335 3300005347 Ga0070668_100551073 Ga0070668_1005510733 129
336 3300005444 Ga0070694_100101087 Ga0070694_1001010873 129
337 3300005459 Ga0068867_100704878 Ga0068867_1007048782 129
338 3300005549 Ga0070704_100293180 Ga0070704_1002931803 129
339 3300005718 Ga0068866_10110587 Ga0068866_101105872 129
340 3300005985 Ga0081539_10000384 Ga0081539_1000038432 129
341 3300009098 Ga0105245_10706165 Ga0105245_107061652 129
342 3300009553 Ga0105249_10106625 Ga0105249_101066252 129
343 3300025899 Ga0207642_11115853 Ga0207642_111158531 129
344 3300025917 Ga0207660_11068979 Ga0207660_110689792 129
345 3300025937 Ga0207669_11896928 Ga0207669_118969281 129
346 3300025949 Ga0207667_11373839 Ga0207667_113738392 129
347 3300025961 Ga0207712_11877161 Ga0207712_118771612 129
348 3300025972 Ga0207668_10582233 Ga0207668_105822332 129
349 3300026067 Ga0207678_10524160 Ga0207678_105241601 129
350 3300026089 Ga0207648_10296114 Ga0207648_102961142 129
351 3300027907 Ga0207428_10405467 Ga0207428_104054672 129
352 3300028381 Ga0268264_11845161 Ga0268264_118451611 129
353 3300035092 Ga0373952_0277909 Ga0373952_0277909_72_461 129
354 3300042005 Ga0439448_0169387 Ga0439448_0169387_289_678 129
355 3300045051 Ga0451576_0199058 Ga0451576_0199058_726_1115 129
356 3300046457 Ga0495590_0101105 Ga0495590_0101105_43_432 129
357 3300046458 Ga0495591_034676 Ga0495591_034676_276_665 129
358 3300046474 Ga0495605_0030681 Ga0495605_0030681_1340_1729 129
359 3300046491 Ga0495584_0035765 Ga0495584_0035765_2049_2438 129
360 3300046492 Ga0495585_0039141 Ga0495585_0039141_2026_2415 129
361 3300046500 Ga0495596_0069261 Ga0495596_0069261_593_982 129
362 3300046501 Ga0495607_0175315 Ga0495607_0175315_224_613 129
363 3300046513 Ga0495616_0049947 Ga0495616_0049947_1570_1959 129
364 3300046515 Ga0495620_0219829 Ga0495620_0219829_157_546 129
365 3300046520 Ga0495637_0034063 Ga0495637_0034063_1474_1863 129
366 3300046522 Ga0495643_0283792 Ga0495643_0283792_129_518 129
367 3300046523 Ga0495644_0052695 Ga0495644_0052695_989_1378 129
368 3300046525 Ga0495663_0105125 Ga0495663_0105125_270_659 129
369 3300046528 Ga0495642_0071156 Ga0495642_0071156_291_680 129
370 3300046537 Ga0495598_0118111 Ga0495598_0118111_315_704 129
371 3300046538 Ga0495609_0106343 Ga0495609_0106343_687_1076 129
372 3300046542 Ga0495597_0031067 Ga0495597_0031067_1730_2119 129
373 3300046648 Ga0495611_0135390 Ga0495611_0135390_293_682 129
374 3300046664 Ga0495659_0006269 Ga0495659_0006269_1458_1847 129
375 3300046691 Ga0495670_0057036 Ga0495670_0057036_166_555 129
376 3300046692 Ga0495671_0053022 Ga0495671_0053022_882_1271 129
377 3300046794 Ga0495589_0136618 Ga0495589_0136618_496_885 129
378 3300047445 Ga0495677_0042394 Ga0495677_0042394_813_1202 129
379 3300047447 Ga0495685_034252 Ga0495685_034252_188_577 129
380 3300048090 Ga0495615_0025555 Ga0495615_0025555_297_686 129
381 3300048091 Ga0495626_0071293 Ga0495626_0071293_837_1226 129
382 3300048905 Ga0496102_1820387 Ga0496102_1820387_52_441 129
383 3300050511 nmdc:mga08y16_19285_c1 nmdc:mga08y16_19285_c1_584_973 129
384 3300005334 Ga0068869_100314903 Ga0068869_1003149032 130
385 3300005335 Ga0070666_10662199 Ga0070666_106621992 130
386 3300005343 Ga0070687_100128969 Ga0070687_1001289692 130
387 3300005344 Ga0070661_100414472 Ga0070661_1004144723 130
388 3300005356 Ga0070674_100271843 Ga0070674_1002718431 130
389 3300005364 Ga0070673_100516528 Ga0070673_1005165282 130
390 3300005365 Ga0070688_100085035 Ga0070688_1000850351 130
391 3300005457 Ga0070662_100301050 Ga0070662_1003010502 130
392 3300005466 Ga0070685_10203904 Ga0070685_102039042 130
393 3300005535 Ga0070684_100047835 Ga0070684_1000478352 130
394 3300005544 Ga0070686_100988014 Ga0070686_1009880142 130
395 3300005615 Ga0070702_101692199 Ga0070702_1016921991 130
396 3300005616 Ga0068852_100118848 Ga0068852_1001188482 130
397 3300005617 Ga0068859_100664249 Ga0068859_1006642492 130
398 3300005618 Ga0068864_100382138 Ga0068864_1003821383 130
399 3300005718 Ga0068866_10438952 Ga0068866_104389522 130
400 3300005840 Ga0068870_10014321 Ga0068870_100143212 130
401 3300005842 Ga0068858_101445433 Ga0068858_1014454331 130
402 3300005843 Ga0068860_100362727 Ga0068860_1003627272 130
403 3300005937 Ga0081455_10026545 Ga0081455_100265454 130
404 3300006358 Ga0068871_100984295 Ga0068871_1009842952 130
405 3300006931 Ga0097620_100664249 Ga0097620_1006642492 130
406 3300009177 Ga0105248_10444487 Ga0105248_104444872 130
407 3300009553 Ga0105249_11424691 Ga0105249_114246912 130
408 3300010375 Ga0105239_10116580 Ga0105239_101165802 130
409 3300011119 Ga0105246_10058598 Ga0105246_100585982 130
410 3300013102 Ga0157371_10847307 Ga0157371_108473071 130
411 3300013306 Ga0163162_10205580 Ga0163162_102055802 130
412 3300013308 Ga0157375_10290332 Ga0157375_102903322 130
413 3300014325 Ga0163163_10267960 Ga0163163_102679602 130
414 3300014326 Ga0157380_10819893 Ga0157380_108198932 130
415 3300014968 Ga0157379_11105527 Ga0157379_111055272 130
416 3300025899 Ga0207642_10296092 Ga0207642_102960922 130
417 3300025908 Ga0207643_10013055 Ga0207643_100130555 130
418 3300025919 Ga0207657_11166159 Ga0207657_111661592 130
419 3300025927 Ga0207687_10037058 Ga0207687_100370583 130
420 3300025931 Ga0207644_10408488 Ga0207644_104084882 130
421 3300025933 Ga0207706_10020046 Ga0207706_100200463 130
422 3300025937 Ga0207669_10149099 Ga0207669_101490992 130
423 3300025940 Ga0207691_10127855 Ga0207691_101278552 130
424 3300025941 Ga0207711_10607557 Ga0207711_106075572 130
425 3300025942 Ga0207689_10062401 Ga0207689_100624013 130
426 3300025944 Ga0207661_10490247 Ga0207661_104902472 130
427 3300025945 Ga0207679_10160194 Ga0207679_101601942 130
428 3300025960 Ga0207651_10528884 Ga0207651_105288841 130
429 3300025981 Ga0207640_10146856 Ga0207640_101468562 130
430 3300026035 Ga0207703_10501435 Ga0207703_105014353 130
431 3300026116 Ga0207674_10103087 Ga0207674_101030873 130
432 3300026142 Ga0207698_10158139 Ga0207698_101581394 130
433 3300028379 Ga0268266_10526443 Ga0268266_105264432 130
434 3300028381 Ga0268264_10261399 Ga0268264_102613993 130
435 3300031995 Ga0307409_100399719 Ga0307409_1003997192 130
436 3300046492 Ga0495585_0350079 Ga0495585_0350079_179_571 130
437 3300046525 Ga0495663_0293691 Ga0495663_0293691_177_569 130
438 3300046539 Ga0495621_0084779 Ga0495621_0084779_306_698 130
439 3300046615 Ga0495656_0806984 Ga0495656_0806984_65_457 130
440 3300046684 Ga0495669_0549350 Ga0495669_0549350_24_416 130
441 3300046794 Ga0495589_0409534 Ga0495589_0409534_13_405 130
442 3300048911 Ga0496108_0015314 Ga0496108_0015314_4485_4877 130
443 3300048912 Ga0496109_0030399 Ga0496109_0030399_2938_3330 130
444 3300048913 Ga0496110_0007430 Ga0496110_0007430_2449_2841 130
445 3300048914 Ga0496111_0003991 Ga0496111_0003991_3983_4375 130
446 3300048916 Ga0496113_0090923 Ga0496113_0090923_921_1313 130
447 3300049514 Ga0501291_014733 Ga0501291_014733_241_633 130
448 3300049661 Ga0501217_028904 Ga0501217_028904_410_802 130
449 3300060353 Ga0501082_1504426 Ga0501082_1504426_82_474 130
450 3300005329 Ga0070683_100072544 Ga0070683_1000725445 143
451 3300005535 Ga0070684_100173715 Ga0070684_1001737153 143
452 3300005564 Ga0070664_100247477 Ga0070664_1002474772 143
453 3300005577 Ga0068857_100026637 Ga0068857_1000266374 143
454 3300006058 Ga0075432_10233656 Ga0075432_102336562 143
455 3300006177 Ga0075362_10385572 Ga0075362_103855721 143
456 3300006195 Ga0075366_10285849 Ga0075366_102858492 143
457 3300009094 Ga0111539_10035896 Ga0111539_100358965 143
458 3300025944 Ga0207661_10031728 Ga0207661_100317282 143
459 3300025945 Ga0207679_10043133 Ga0207679_100431333 143
460 3300026116 Ga0207674_10003638 Ga0207674_1000363819 143
461 3300027907 Ga0207428_10010765 Ga0207428_100107659 143
462 3300049741 Ga0501079_0961315 Ga0501079_0961315_45_476 143
463 3300050489 nmdc:mga03683_342683_c1 nmdc:mga03683_342683_c1_243_674 143
464 3300050511 nmdc:mga08y16_11600_c1 nmdc:mga08y16_11600_c1_7615_8046 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00376

MerR

MerR family regulatory protein

17

52

0.98

PF13411

MerR_1

MerR HTH family regulatory protein

15

84

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tea-assembly2.cif.gz_C crystal structure of s. aureus glnr-dna complex 0.9648 7 76
2dg6-assembly1.cif.gz_A-2 crystal structure of the putative transcriptional regulator sco5550 from streptomyces coelicolor a3(2) 0.9444 9 75
6jyw-assembly1.cif.gz_A crystal structure of the transcription regulator cadr n81m mutant from p. putida in complex with cadmium(ii) and dna 0.9365 9 79
5i44-assembly4.cif.gz_E structure of raca-dna complex; p21 form 0.9204 7 63
5i44-assembly4.cif.gz_G-2 structure of raca-dna complex; p21 form 0.9168 8 71
ID Description Score Start End Superfamily
af_O06302_4_79_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9807 8 74 1.10.1660.10
af_P33358_1_73_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9536 8 76 1.10.1660.10
af_P9WME7_10_96_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9263 9 73 1.10.1660.10
3hh0D01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9158 8 74 1.10.1660.10
3hh0C01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9096 8 77 1.10.1660.10
ID Description Score Start End GO Terms
AF-A0A2W4PR80-F1-model_v4 MerR family DNA-binding transcriptional regulator 0.995 5 95 GO:0003677
GO:0003700
AF-A0A523I756-F1-model_v4 MerR family transcriptional regulator 0.9866 9 83 GO:0003677
GO:0003700
AF-A0A6L7RVL5-F1-model_v4 MerR family transcriptional regulator 0.9863 8 80 GO:0003677
GO:0003700
AF-A0A383F7G8-F1-model_v4 HTH merR-type domain-containing protein 0.9797 9 83 GO:0003677
GO:0003700
AF-A0A6A7KZ87-F1-model_v4 MerR family transcriptional regulator 0.9796 5 85 GO:0003677
GO:0003700

Feature Viewer

pLDDT pTM Quality
81.64 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map