F449325

General Info

Members Datasets Scaffolds Average Seq Length
464 298 928 203

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10011533|Ga0307414_100115333
Length 198
Sequence VTHPAADRIIGLYQDKAADWIRDRGDALRRNEGDWDEVAWLDRFTAGWPPGGRVLDVGSGSLARGFKLIGLEASPSLIAHARETLPSGDWRLGDMRQGLPDGAFHGVLAWHSLFHLTPEAQTLVLPALAARVADGGRLMFTAGPAHGEAIGEWRGEPLYHGSLDPDAYRALLTEAELTVENDGDQGVWLARRAILSAK

Samples

Sample ID Description Type Environment
1 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
95 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
153 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
169 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
170 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
171 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
172 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
183 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
186 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
187 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
188 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
189 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
190 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
191 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
192 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
193 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
194 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
199 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
200 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
204 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
222 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
223 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
224 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
225 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
228 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
245 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
251 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
252 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
253 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
254 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
255 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
256 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
257 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
258 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
259 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
260 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
261 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
262 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
263 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
264 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
265 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
266 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
267 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
268 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
269 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
270 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
271 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
274 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
275 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
276 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
277 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
278 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
279 2643221733 Bosea sp. Root381 Isolate Unclassified
280 2643221734 Bosea sp. Root670 Isolate Unclassified
281 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
282 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
283 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
284 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
285 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
286 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
287 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
288 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
289 2904424332 Duganella sp. 1411 Isolate Rhizosphere
290 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
291 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
292 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
293 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
294 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
295 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
296 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
297 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
298 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.61
Metatranscriptomes 0
Isolates 5.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.84
Nodule 2.16
Rhizoplane 5.82
Rhizosphere 60.78
Stem 0
Stem Tuber 0
Unclassified 1.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307414_10011533 3300032004 Bacteria 5188
2 JGI25158J39367_1000176 3300002739 Bacteria 15017
3 JGI25152J39213_1003572 3300002773 Bacteria 5263
4 JGI25152J39213_1005999 3300002773 Bacteria 3407
5 JGI25150J39212_1020280 3300002774 Bacteria 1028
6 JGI25159J45721_1000724 3300002987 Bacteria 14403
7 JGI25151J46595_10000030 3300003187 Bacteria 202084
8 JGI25406J46586_10002011 3300003203 Bacteria 9608
9 JGI25153J46596_10011885 3300003215 Bacteria 3813
10 JGI25153J46596_10013733 3300003215 Bacteria 3407
11 rootH2_10171214 3300003320 Bacteria 1573
12 rootL2_10142571 3300003322 Bacteria 1781
13 JGI25160J50197_1005712 3300003354 Bacteria 5140
14 JGI25161J50226_1000104 3300003374 Bacteria 67942
15 Ga0055526_1000242 3300003771 Bacteria 46203
16 Ga0055526_1002235 3300003771 Bacteria 13255
17 Ga0055524_1000069 3300003775 Bacteria 128956
18 Ga0055524_1041126 3300003775 Bacteria 1169
19 Ga0055534_1019540 3300003784 Bacteria 1160
20 Ga0055528_1002926 3300003790 Bacteria 8865
21 Ga0055528_1036697 3300003790 Bacteria 1165
22 Ga0055540_1007048 3300003792 Bacteria 4324
23 Ga0055543_1000280 3300004625 Bacteria 37509
24 Ga0065165_1005059 3300005262 Bacteria 7680
25 Ga0065165_1043826 3300005262 Bacteria 1311
26 Ga0070658_10060332 3300005327 Bacteria 3089
27 Ga0070658_10384749 3300005327 Bacteria 1204
28 Ga0070676_10080895 3300005328 Bacteria 1971
29 Ga0070676_10530670 3300005328 Bacteria 840
30 Ga0070690_100148775 3300005330 Bacteria 1596
31 Ga0070670_100159623 3300005331 Bacteria 1954
32 Ga0070670_100468849 3300005331 Bacteria 1117
33 Ga0068869_100072135 3300005334 Bacteria 2558
34 Ga0068869_100120816 3300005334 Bacteria 2003
35 Ga0068869_100234632 3300005334 Bacteria 1459
36 Ga0070666_10621740 3300005335 Bacteria 789
37 Ga0070682_100021597 3300005337 Bacteria 3802
38 Ga0068868_100018772 3300005338 Bacteria 5172
39 Ga0068868_100724518 3300005338 Bacteria 892
40 Ga0070689_100181952 3300005340 Bacteria 1707
41 Ga0070689_100377681 3300005340 Bacteria 1194
42 Ga0070668_100062405 3300005347 Bacteria 2887
43 Ga0070668_100575846 3300005347 Bacteria 982
44 Ga0070669_100072806 3300005353 Bacteria 2545
45 Ga0070669_100365145 3300005353 Bacteria 1175
46 Ga0070669_100673135 3300005353 Bacteria 872
47 Ga0070675_100624214 3300005354 Bacteria 978
48 Ga0070674_100031516 3300005356 Bacteria 3513
49 Ga0070673_100167771 3300005364 Bacteria 1872
50 Ga0070673_100291603 3300005364 Bacteria 1434
51 Ga0070673_100471579 3300005364 Bacteria 1132
52 Ga0070710_10218573 3300005437 Bacteria 1211
53 Ga0070711_100102314 3300005439 Bacteria 2086
54 Ga0070700_100465815 3300005441 Bacteria 965
55 Ga0070700_100670904 3300005441 Bacteria 821
56 Ga0070663_101056484 3300005455 Bacteria 708
57 Ga0070678_100009855 3300005456 Bacteria 5808
58 Ga0070678_100028625 3300005456 Bacteria 3803
59 Ga0070678_100368647 3300005456 Bacteria 1239
60 Ga0070678_100410919 3300005456 Bacteria 1178
61 Ga0070707_100289068 3300005468 Bacteria 1593
62 Ga0070684_100192396 3300005535 Bacteria 1857
63 Ga0068853_100186538 3300005539 Bacteria 1883
64 Ga0068853_100424134 3300005539 Bacteria 1248
65 Ga0068853_100651375 3300005539 Bacteria 1002
66 Ga0070693_100058738 3300005547 Bacteria 2228
67 Ga0070665_100060805 3300005548 Bacteria 3787
68 Ga0070665_100177360 3300005548 Bacteria 2132
69 Ga0070665_100720514 3300005548 Bacteria 1010
70 Ga0070664_100133946 3300005564 Bacteria 2178
71 Ga0068857_100163811 3300005577 Bacteria 2018
72 Ga0068857_100225243 3300005577 Bacteria 1714
73 Ga0068856_100024894 3300005614 Bacteria 5831
74 Ga0068859_100111658 3300005617 Bacteria 2796
75 Ga0068859_100830529 3300005617 Bacteria 1011
76 Ga0068864_100010493 3300005618 Bacteria 7655
77 Ga0068864_100172287 3300005618 Bacteria 1974
78 Ga0068864_100459618 3300005618 Bacteria 1219
79 Ga0068861_100066683 3300005719 Bacteria 2775
80 Ga0068861_100096748 3300005719 Bacteria 2340
81 Ga0068851_10086373 3300005834 Bacteria 1646
82 Ga0068863_100147541 3300005841 Unclassified 2250
83 Ga0068863_100305433 3300005841 Bacteria 1544
84 Ga0068863_100319237 3300005841 Bacteria 1508
85 Ga0068858_100132231 3300005842 Bacteria 2340
86 Ga0068858_100386651 3300005842 Bacteria 1343
87 Ga0068862_100046924 3300005844 Bacteria 3685
88 Ga0068862_100075304 3300005844 Bacteria 2919
89 Ga0068862_100942960 3300005844 Bacteria 851
90 Ga0081455_10009559 3300005937 Bacteria 9958
91 Ga0081455_10024376 3300005937 Bacteria 5604
92 Ga0081455_10032712 3300005937 Bacteria 4684
93 Ga0081540_1012609 3300005983 Bacteria 5548
94 Ga0081540_1014738 3300005983 Bacteria 4989
95 Ga0081540_1103789 3300005983 Bacteria 1218
96 Ga0081539_10000626 3300005985 Bacteria 71615
97 Ga0075365_10474852 3300006038 Bacteria 883
98 Ga0075365_10570550 3300006038 Bacteria 800
99 Ga0075368_10084040 3300006042 Bacteria 1297
100 Ga0075363_100323519 3300006048 Bacteria 897
101 Ga0075364_10232252 3300006051 Bacteria 1252
102 Ga0075364_10370361 3300006051 Bacteria 977
103 Ga0070716_100121137 3300006173 Bacteria 1638
104 Ga0075362_10140257 3300006177 Bacteria 1155
105 Ga0075362_10347611 3300006177 Bacteria 742
106 Ga0075367_10013817 3300006178 Bacteria 4355
107 Ga0075367_10090079 3300006178 Bacteria 1865
108 Ga0075367_10207026 3300006178 Bacteria 1226
109 Ga0075369_10144163 3300006186 Bacteria 1087
110 Ga0075369_10343492 3300006186 Bacteria 700
111 Ga0068871_100360452 3300006358 Bacteria 1288
112 Ga0075428_100103367 3300006844 Unclassified 3107
113 Ga0075431_100125628 3300006847 Bacteria 2647
114 Ga0075433_10432944 3300006852 Bacteria 1160
115 Ga0075434_100090325 3300006871 Bacteria 3065
116 Ga0097620_100111660 3300006931 Bacteria 2796
117 Ga0097620_100830541 3300006931 Bacteria 1011
118 Ga0111539_10188143 3300009094 Bacteria 2410
119 Ga0105245_10017389 3300009098 Bacteria 6272
120 Ga0105245_10100501 3300009098 Bacteria 2675
121 Ga0105245_10623434 3300009098 Bacteria 1107
122 Ga0105247_10157273 3300009101 Bacteria 1502
123 Ga0105247_10339304 3300009101 Bacteria 1053
124 Ga0105247_10346397 3300009101 Bacteria 1044
125 Ga0105243_10236464 3300009148 Bacteria 1623
126 Ga0105243_10413284 3300009148 Bacteria 1256
127 Ga0105241_10131618 3300009174 Bacteria 2026
128 Ga0105241_10395676 3300009174 Bacteria 1210
129 Ga0105241_10788769 3300009174 Bacteria 874
130 Ga0105248_10132660 3300009177 Bacteria 2810
131 Ga0105248_10206774 3300009177 Bacteria 2212
132 Ga0105248_10266903 3300009177 Unclassified 1927
133 Ga0105237_10050647 3300009545 Bacteria 4173
134 Ga0105238_10703468 3300009551 Bacteria 1023
135 Ga0105249_10347747 3300009553 Bacteria 1501
136 Ga0105249_11031822 3300009553 Bacteria 892
137 Ga0105239_10094908 3300010375 Bacteria 3295
138 Ga0105239_10192647 3300010375 Bacteria 2282
139 Ga0105239_10224669 3300010375 Bacteria 2106
140 Ga0105246_10081306 3300011119 Bacteria 2309
141 Ga0105246_10093735 3300011119 Bacteria 2170
142 Ga0105246_10099947 3300011119 Bacteria 2110
143 Ga0157371_10031659 3300013102 Bacteria 3811
144 Ga0157374_10076644 3300013296 Bacteria 3162
145 Ga0157378_10246332 3300013297 Bacteria 1709
146 Ga0157378_10265958 3300013297 Bacteria 1647
147 Ga0157378_10973761 3300013297 Bacteria 882
148 Ga0163162_10029891 3300013306 Bacteria 5395
149 Ga0163162_10191599 3300013306 Bacteria 2172
150 Ga0163162_10630676 3300013306 Bacteria 1196
151 Ga0157372_10006513 3300013307 Bacteria 12431
152 Ga0157375_10402706 3300013308 Bacteria 1535
153 Ga0157375_10535645 3300013308 Bacteria 1334
154 Ga0163163_10118688 3300014325 Bacteria 2678
155 Ga0163163_10575311 3300014325 Bacteria 1189
156 Ga0163163_10630356 3300014325 Bacteria 1135
157 Ga0157380_10089291 3300014326 Bacteria 2538
158 Ga0157377_10071443 3300014745 Bacteria 2007
159 Ga0157379_10087069 3300014968 Bacteria 2801
160 Ga0157379_10146070 3300014968 Bacteria 2133
161 Ga0157376_10060648 3300014969 Bacteria 3178
162 Ga0157376_10272855 3300014969 Bacteria 1589
163 Ga0157376_10983293 3300014969 Bacteria 866
164 Ga0163161_10857133 3300017792 Unclassified 767
165 Ga0209436_100023 3300025208 Bacteria 96401
166 Ga0209436_100027 3300025208 Bacteria 87534
167 Ga0207425_1004962 3300025245 Bacteria 3877
168 Ga0207425_1019849 3300025245 Bacteria 1443
169 Ga0209129_1000952 3300025258 Bacteria 17416
170 Ga0209129_1002503 3300025258 Bacteria 8962
171 Ga0209673_1001918 3300025273 Bacteria 16546
172 Ga0209673_1017891 3300025273 Bacteria 2598
173 Ga0209673_1027530 3300025273 Bacteria 1847
174 Ga0209130_1000173 3300025284 Bacteria 92248
175 Ga0209675_1011034 3300025291 Bacteria 3028
176 Ga0209676_1033789 3300025292 Bacteria 1519
177 Ga0209025_1000063 3300025294 Bacteria 303962
178 Ga0209025_1009819 3300025294 Bacteria 6603
179 Ga0209564_1000043 3300025295 Bacteria 388153
180 Ga0209564_1000052 3300025295 Bacteria 356578
181 Ga0209564_1001125 3300025295 Bacteria 31471
182 Ga0209564_1054993 3300025295 Unclassified 935
183 Ga0209758_1000882 3300025297 Bacteria 41200
184 Ga0209758_1000928 3300025297 Bacteria 39646
185 Ga0209758_1013601 3300025297 Bacteria 4417
186 Ga0209256_1000172 3300025299 Bacteria 129025
187 Ga0209256_1000611 3300025299 Bacteria 49576
188 Ga0209256_1004068 3300025299 Bacteria 9502
189 Ga0207426_1000047 3300025302 Bacteria 417011
190 Ga0209257_1031614 3300025304 Bacteria 1690
191 Ga0209257_1053091 3300025304 Bacteria 1135
192 Ga0207656_10415086 3300025321 Unclassified 678
193 Ga0207692_10305876 3300025898 Bacteria 969
194 Ga0207710_10157147 3300025900 Bacteria 1106
195 Ga0207645_10099845 3300025907 Bacteria 1872
196 Ga0207643_10088430 3300025908 Bacteria 1803
197 Ga0207705_10436294 3300025909 Bacteria 1015
198 Ga0207654_10045028 3300025911 Bacteria 2509
199 Ga0207671_10385445 3300025914 Bacteria 1114
200 Ga0207649_10316262 3300025920 Bacteria 1146
201 Ga0207652_10819348 3300025921 Bacteria 826
202 Ga0207681_10095706 3300025923 Bacteria 2130
203 Ga0207681_10281181 3300025923 Bacteria 1310
204 Ga0207694_10619435 3300025924 Bacteria 911
205 Ga0207650_10594356 3300025925 Bacteria 930
206 Ga0207659_10252687 3300025926 Bacteria 1431
207 Ga0207687_10070307 3300025927 Bacteria 2499
208 Ga0207687_10081124 3300025927 Bacteria 2343
209 Ga0207644_10537382 3300025931 Bacteria 967
210 Ga0207709_10751886 3300025935 Unclassified 784
211 Ga0207669_10454619 3300025937 Bacteria 1015
212 Ga0207665_10132023 3300025939 Bacteria 1774
213 Ga0207711_10243405 3300025941 Bacteria 1650
214 Ga0207711_10754016 3300025941 Bacteria 907
215 Ga0207689_10032149 3300025942 Bacteria 4365
216 Ga0207689_10060188 3300025942 Bacteria 3123
217 Ga0207689_10286938 3300025942 Bacteria 1363
218 Ga0207689_10343812 3300025942 Bacteria 1239
219 Ga0207661_10195700 3300025944 Bacteria 1775
220 Ga0207679_10706317 3300025945 Bacteria 915
221 Ga0207667_11143337 3300025949 Bacteria 760
222 Ga0207651_10265610 3300025960 Bacteria 1411
223 Ga0207651_10610982 3300025960 Bacteria 954
224 Ga0207668_10255400 3300025972 Bacteria 1426
225 Ga0207668_10523636 3300025972 Bacteria 1023
226 Ga0207668_10893333 3300025972 Bacteria 790
227 Ga0207640_10215860 3300025981 Bacteria 1465
228 Ga0207677_10077800 3300026023 Bacteria 2367
229 Ga0207677_10378263 3300026023 Bacteria 1194
230 Ga0207677_10609058 3300026023 Bacteria 959
231 Ga0207703_10071585 3300026035 Bacteria 2864
232 Ga0207639_10380877 3300026041 Bacteria 1267
233 Ga0207639_10593102 3300026041 Bacteria 1021
234 Ga0207678_10032013 3300026067 Bacteria 4584
235 Ga0207678_10054458 3300026067 Bacteria 3445
236 Ga0207678_10105925 3300026067 Bacteria 2399
237 Ga0207678_10129834 3300026067 Bacteria 2149
238 Ga0207678_10141874 3300026067 Bacteria 2050
239 Ga0207678_10662138 3300026067 Bacteria 917
240 Ga0207708_10134868 3300026075 Bacteria 1933
241 Ga0207708_10187937 3300026075 Bacteria 1643
242 Ga0207702_10729825 3300026078 Bacteria 977
243 Ga0207641_10068567 3300026088 Bacteria 3042
244 Ga0207641_10881104 3300026088 Bacteria 888
245 Ga0207641_11076609 3300026088 Bacteria 802
246 Ga0207648_10040321 3300026089 Bacteria 4104
247 Ga0207648_10416449 3300026089 Bacteria 1219
248 Ga0207676_10185525 3300026095 Bacteria 1825
249 Ga0207674_10106950 3300026116 Bacteria 2774
250 Ga0207674_10429475 3300026116 Bacteria 1277
251 Ga0207675_100026900 3300026118 Bacteria 5354
252 Ga0207675_100217978 3300026118 Bacteria 1838
253 Ga0207675_100270817 3300026118 Bacteria 1648
254 Ga0207683_10017697 3300026121 Bacteria 6077
255 Ga0207683_10019107 3300026121 Bacteria 5849
256 Ga0207683_10184785 3300026121 Bacteria 1891
257 Ga0207683_10375049 3300026121 Bacteria 1307
258 Ga0207698_10112728 3300026142 Bacteria 2283
259 Ga0207698_11270194 3300026142 Bacteria 751
260 Ga0209371_1001701 3300027312 Bacteria 13946
261 Ga0209813_10189827 3300027866 Bacteria 756
262 Ga0207428_10080622 3300027907 Bacteria 2542
263 Ga0268266_10015103 3300028379 Bacteria 6631
264 Ga0268266_10028343 3300028379 Bacteria 4760
265 Ga0268266_10028431 3300028379 Bacteria 4753
266 Ga0268266_10085986 3300028379 Bacteria 2748
267 Ga0268264_10612755 3300028381 Bacteria 1074
268 Ga0265337_1008384 3300028556 Bacteria 3762
269 Ga0307517_10241609 3300028786 Bacteria 1071
270 Ga0307515_10446032 3300028794 Bacteria 910
271 Ga0268256_1001482 3300030500 Bacteria 13946
272 Ga0307408_100797555 3300031548 Bacteria 857
273 Ga0307516_10407754 3300031730 Bacteria 1018
274 Ga0307413_10157621 3300031824 Bacteria 1591
275 Ga0307406_10041360 3300031901 Bacteria 2872
276 Ga0307406_10050001 3300031901 Bacteria 2648
277 Ga0307411_10272748 3300032005 Bacteria 1342
278 Ga0307415_100145697 3300032126 Bacteria 1815
279 Ga0307415_101189347 3300032126 Bacteria 718
280 Ga0307507_10195522 3300033179 Bacteria 1412
281 Ga0373936_0103900 3300035113 Bacteria 1201
282 Ga0395900_0154444 3300037418 Bacteria 2344
283 Ga0395900_0170778 3300037418 Bacteria 2214
284 Ga0395898_0019882 3300037466 Bacteria 6828
285 Ga0395905_0008629 3300037471 Bacteria 10041
286 Ga0395901_0080879 3300038443 Bacteria 3393
287 Ga0451807_0226762 3300041486 Bacteria 1453
288 Ga0451837_0454107 3300041494 Bacteria 1047
289 Ga0451853_1532458 3300041512 Bacteria 1033
290 Ga0450901_006600 3300042533 Bacteria 1194
291 Ga0466960_0042960 3300044901 Bacteria 2148
292 Ga0451576_0197598 3300045051 Unclassified 2101
293 Ga0495617_036366 3300046452 Bacteria 1651
294 Ga0495603_0168416 3300046455 Bacteria 1269
295 Ga0495590_0014807 3300046457 Bacteria 2842
296 Ga0495638_0028391 3300046460 Bacteria 3613
297 Ga0495638_0079128 3300046460 Bacteria 1999
298 Ga0495638_0208415 3300046460 Bacteria 1099
299 Ga0495582_0264952 3300046473 Bacteria 986
300 Ga0495584_0193495 3300046491 Bacteria 1034
301 Ga0495585_0093082 3300046492 Bacteria 1621
302 Ga0495594_0149843 3300046499 Bacteria 1324
303 Ga0495596_0036709 3300046500 Bacteria 1940
304 Ga0495583_0181004 3300046506 Bacteria 863
305 Ga0495606_0036497 3300046507 Bacteria 3347
306 Ga0495606_0102357 3300046507 Bacteria 1741
307 Ga0495610_0066794 3300046512 Bacteria 1692
308 Ga0495631_0051188 3300046518 Bacteria 1805
309 Ga0495643_0032008 3300046522 Bacteria 2922
310 Ga0495648_0100395 3300046524 Bacteria 1599
311 Ga0495648_0268749 3300046524 Bacteria 814
312 Ga0495654_0119422 3300046530 Bacteria 1195
313 Ga0495598_0025729 3300046537 Bacteria 1607
314 Ga0495609_0027153 3300046538 Bacteria 2617
315 Ga0495597_0027435 3300046542 Bacteria 2611
316 Ga0495656_0047488 3300046615 Bacteria 1821
317 Ga0495611_0341506 3300046648 Bacteria 688
318 Ga0495625_0363009 3300046660 Bacteria 912
319 Ga0495661_0126335 3300046665 Bacteria 1407
320 Ga0495661_0281628 3300046665 Bacteria 838
321 Ga0495658_0431815 3300046683 Bacteria 841
322 Ga0495670_0025405 3300046691 Bacteria 2930
323 Ga0495671_0213274 3300046692 Bacteria 935
324 Ga0495589_0149273 3300046794 Bacteria 1117
325 Ga0495581_0074733 3300047315 Bacteria 1961
326 Ga0495672_0013388 3300047320 Bacteria 5662
327 Ga0495683_0042764 3300047323 Bacteria 2284
328 Ga0495626_0207156 3300048091 Bacteria 802
329 Ga0496100_0101859 3300048903 Bacteria 1980
330 Ga0496101_0012724 3300048904 Bacteria 5624
331 Ga0496101_0505587 3300048904 Bacteria 955
332 Ga0496102_0289188 3300048905 Bacteria 1545
333 Ga0496102_0410018 3300048905 Bacteria 1273
334 Ga0496103_0010521 3300048906 Bacteria 5478
335 Ga0496104_0045947 3300048907 Bacteria 4108
336 Ga0496104_0413476 3300048907 Bacteria 1261
337 Ga0496105_0015008 3300048908 Bacteria 6164
338 Ga0496106_0035418 3300048909 Bacteria 3733
339 Ga0496106_0220873 3300048909 Bacteria 1511
340 Ga0496106_0378959 3300048909 Bacteria 1137
341 Ga0496107_0345289 3300048910 Bacteria 1107
342 Ga0496107_0608894 3300048910 Bacteria 807
343 Ga0496107_0667994 3300048910 Bacteria 765
344 Ga0496108_0270689 3300048911 Bacteria 1478
345 Ga0496109_0046895 3300048912 Bacteria 3926
346 Ga0496110_0016079 3300048913 Bacteria 6239
347 Ga0496110_0369346 3300048913 Bacteria 1307
348 Ga0496111_0039170 3300048914 Bacteria 3397
349 Ga0496112_0045416 3300048915 Bacteria 4306
350 Ga0496113_0034345 3300048916 Bacteria 3700
351 Ga0496113_0397368 3300048916 Bacteria 1107
352 Ga0496114_0075065 3300048917 Bacteria 2847
353 Ga0496114_0272544 3300048917 Bacteria 1491
354 Ga0496115_0006396 3300048918 Bacteria 8633
355 Ga0496116_0045724 3300048919 Bacteria 2960
356 Ga0496117_0052634 3300048920 Bacteria 2866
357 Ga0496118_0027691 3300048921 Bacteria 4789
358 Ga0496118_0116134 3300048921 Bacteria 1760
359 Ga0496118_0321873 3300048921 Bacteria 839
360 Ga0496119_0000016 3300048922 Bacteria 309806
361 Ga0496120_0000310 3300048923 Bacteria 81092
362 Ga0496121_0000416 3300048924 Bacteria 84469
363 Ga0496121_0010198 3300048924 Bacteria 10641
364 Ga0496121_0033109 3300048924 Bacteria 4684
365 Ga0496121_0182051 3300048924 Bacteria 1515
366 Ga0496121_0236366 3300048924 Bacteria 1276
367 Ga0496121_0311256 3300048924 Bacteria 1064
368 Ga0496122_0034510 3300048925 Bacteria 4138
369 Ga0496123_0017820 3300048926 Bacteria 5688
370 Ga0496124_0067454 3300048927 Bacteria 2977
371 Ga0496124_0246321 3300048927 Bacteria 1325
372 Ga0496124_0258726 3300048927 Bacteria 1282
373 Ga0496125_0037410 3300048928 Bacteria 4220
374 Ga0496126_0011038 3300048929 Bacteria 9392
375 Ga0496126_0075729 3300048929 Bacteria 2986
376 Ga0496126_0337353 3300048929 Bacteria 1235
377 Ga0496126_0815668 3300048929 Bacteria 714
378 Ga0501034_0087855 3300049571 Bacteria 3108
379 Ga0501034_0112453 3300049571 Bacteria 2713
380 Ga0501037_0261477 3300049573 Bacteria 1209
381 Ga0501047_0113575 3300049581 Bacteria 2591
382 Ga0501047_0127485 3300049581 Bacteria 2425
383 Ga0501067_0037137 3300049583 Bacteria 2706
384 Ga0501081_0495668 3300049743 Bacteria 910
385 Ga0501083_0079680 3300049744 Bacteria 2171
386 Ga0501280_001630 3300049776 Bacteria 4012
387 Ga0501044_0276755 3300049823 Bacteria 1613
388 nmdc:mga03683_140914_c1 3300050489 Bacteria 1084
389 nmdc:mga03683_30573_c1 3300050489 Bacteria 2155
390 nmdc:mga03683_83160_c1 3300050489 Bacteria 1385
391 nmdc:mga00v17_126345_c1 3300050491 Bacteria 1632
392 nmdc:mga00v17_76642_c1 3300050491 Bacteria 2080
393 nmdc:mga0yw44_1458_c1 3300050492 Bacteria 9401
394 nmdc:mga0yw44_7985_c1 3300050492 Bacteria 5246
395 nmdc:mga0k408_46558_c1 3300050493 Bacteria 2505
396 nmdc:mga06z11_20912_c1 3300050494 Bacteria 3032
397 nmdc:mga06z11_219251_c1 3300050494 Bacteria 1111
398 nmdc:mga07m45_267925_c1 3300050496 Bacteria 994
399 nmdc:mga07m45_286859_c1 3300050496 Bacteria 957
400 nmdc:mga07m45_447629_c1 3300050496 Bacteria 749
401 nmdc:mga06r32_51364_c1 3300050510 Bacteria 3945
402 nmdc:mga0n895_523317_c1 3300050512 Bacteria 1193
403 nmdc:mga0n895_95652_c1 3300050512 Bacteria 2975
404 nmdc:mga0rr50_313576_c1 3300050513 Bacteria 1314
405 nmdc:mga0a205_200454_c1 3300050515 Bacteria 1886
406 nmdc:mga0sz30_117986_c1 3300050516 Bacteria 1165
407 nmdc:mga0sz30_28154_c2 3300050516 Bacteria 1258
408 nmdc:mga0sz30_288893_c1 3300050516 Bacteria 731
409 Ga0495655_0062921 3300053083 Bacteria 1017
410 Ga0500583_0119433 3300053092 Bacteria 1303
411 Ga0500651_0068966 3300053093 Bacteria 2202
412 Ga0500651_0380878 3300053093 Bacteria 795
413 Ga0500566_0002846 3300053094 Bacteria 10302
414 Ga0500641_0005020 3300053096 Bacteria 4692
415 Ga0500641_0119369 3300053096 Bacteria 1136
416 Ga0500650_0095335 3300053098 Bacteria 1393
417 Ga0500650_0168179 3300053098 Bacteria 1009
418 Ga0500554_016383 3300053102 Bacteria 1959
419 Ga0500595_002069 3300053119 Bacteria 10248
420 Ga0500595_004656 3300053119 Bacteria 6103
421 Ga0500595_036355 3300053119 Bacteria 1613
422 Ga0500652_000023 3300053131 Bacteria 116316
423 Ga0500568_0007821 3300053139 Bacteria 5207
424 Ga0500568_0227918 3300053139 Bacteria 680
425 Ga0500588_0035893 3300053146 Bacteria 1462
426 Ga0500589_140381 3300053147 Bacteria 996
427 Ga0500604_0020385 3300053151 Bacteria 1866
428 Ga0500616_0004940 3300053153 Bacteria 9258
429 Ga0500622_0015392 3300053156 Bacteria 4095
430 Ga0500622_0041450 3300053156 Bacteria 2397
431 Ga0500634_0077516 3300053161 Bacteria 1722
432 Ga0500638_000874 3300053162 Bacteria 8475
433 Ga0500636_0003691 3300053177 Bacteria 8635
434 Ga0500637_0000171 3300053178 Bacteria 24172
435 Ga0500645_018661 3300053730 Bacteria 2164
436 Ga0500645_067589 3300053730 Bacteria 1028
437 Ga0500661_000551 3300055283 Bacteria 6991
438 Ga0501082_0198034 3300060353 Bacteria 1748
439 Ga0530510_0238025 3300061734 Bacteria 1355
440 2511200436 2510917030 Bacteria 7460662
441 2513691858 2513237101 Bacteria 7952346
442 2574430343 2574179768 Bacteria 4907129
443 2585224958 2582581298 Bacteria 7315509
444 2585547514 2585427529 Bacteria 7395659
445 2644729625 2643221733 Bacteria 5690728
446 2644737551 2643221734 Bacteria 5365412
447 2723845742 2721755755 Bacteria 8322773
448 2819243147 2818991272 Bacteria 4622173
449 2841911717 2841911363 Bacteria 6173697
450 2841917326 2841917233 Bacteria 6173500
451 2874609640 2874604998 Bacteria 7834745
452 2876809490 2876808645 Bacteria 8824342
453 2879118497 2879110137 Bacteria 8907982
454 2894773849 2894772417 Bacteria 5305674
455 2904428221 2904424332 Bacteria 7633521
456 2919104390 2919100787 Bacteria 7710546
457 2919156316 2919155634 Bacteria 4860545
458 2919509080 2919506607 Bacteria 3392955
459 2920114229 2920107658 Bacteria 10042636
460 2922392420 2922386360 Bacteria 7017218
461 3005511905 3005506211 Bacteria 6943378
462 8006967382 8006964411 Bacteria 8966052
463 8006997698 8006994254 Bacteria 8309700
464 8056674487 8056673599 Bacteria 7871253
465 Ga0307414_10011533
466 JGI25158J39367_1000176
467 JGI25152J39213_1003572
468 JGI25152J39213_1005999
469 JGI25150J39212_1020280
470 JGI25159J45721_1000724
471 JGI25151J46595_10000030
472 JGI25406J46586_10002011
473 JGI25153J46596_10011885
474 JGI25153J46596_10013733
475 rootH2_10171214
476 rootL2_10142571
477 JGI25160J50197_1005712
478 JGI25161J50226_1000104
479 Ga0055526_1000242
480 Ga0055526_1002235
481 Ga0055524_1000069
482 Ga0055524_1041126
483 Ga0055534_1019540
484 Ga0055528_1002926
485 Ga0055528_1036697
486 Ga0055540_1007048
487 Ga0055543_1000280
488 Ga0065165_1005059
489 Ga0065165_1043826
490 Ga0070658_10060332
491 Ga0070658_10384749
492 Ga0070676_10080895
493 Ga0070676_10530670
494 Ga0070690_100148775
495 Ga0070670_100159623
496 Ga0070670_100468849
497 Ga0068869_100072135
498 Ga0068869_100120816
499 Ga0068869_100234632
500 Ga0070666_10621740
501 Ga0070682_100021597
502 Ga0068868_100018772
503 Ga0068868_100724518
504 Ga0070689_100181952
505 Ga0070689_100377681
506 Ga0070668_100062405
507 Ga0070668_100575846
508 Ga0070669_100072806
509 Ga0070669_100365145
510 Ga0070669_100673135
511 Ga0070675_100624214
512 Ga0070674_100031516
513 Ga0070673_100167771
514 Ga0070673_100291603
515 Ga0070673_100471579
516 Ga0070710_10218573
517 Ga0070711_100102314
518 Ga0070700_100465815
519 Ga0070700_100670904
520 Ga0070663_101056484
521 Ga0070678_100009855
522 Ga0070678_100028625
523 Ga0070678_100368647
524 Ga0070678_100410919
525 Ga0070707_100289068
526 Ga0070684_100192396
527 Ga0068853_100186538
528 Ga0068853_100424134
529 Ga0068853_100651375
530 Ga0070693_100058738
531 Ga0070665_100060805
532 Ga0070665_100177360
533 Ga0070665_100720514
534 Ga0070664_100133946
535 Ga0068857_100163811
536 Ga0068857_100225243
537 Ga0068856_100024894
538 Ga0068859_100111658
539 Ga0068859_100830529
540 Ga0068864_100010493
541 Ga0068864_100172287
542 Ga0068864_100459618
543 Ga0068861_100066683
544 Ga0068861_100096748
545 Ga0068851_10086373
546 Ga0068863_100147541
547 Ga0068863_100305433
548 Ga0068863_100319237
549 Ga0068858_100132231
550 Ga0068858_100386651
551 Ga0068862_100046924
552 Ga0068862_100075304
553 Ga0068862_100942960
554 Ga0081455_10009559
555 Ga0081455_10024376
556 Ga0081455_10032712
557 Ga0081540_1012609
558 Ga0081540_1014738
559 Ga0081540_1103789
560 Ga0081539_10000626
561 Ga0075365_10474852
562 Ga0075365_10570550
563 Ga0075368_10084040
564 Ga0075363_100323519
565 Ga0075364_10232252
566 Ga0075364_10370361
567 Ga0070716_100121137
568 Ga0075362_10140257
569 Ga0075362_10347611
570 Ga0075367_10013817
571 Ga0075367_10090079
572 Ga0075367_10207026
573 Ga0075369_10144163
574 Ga0075369_10343492
575 Ga0068871_100360452
576 Ga0075428_100103367
577 Ga0075431_100125628
578 Ga0075433_10432944
579 Ga0075434_100090325
580 Ga0097620_100111660
581 Ga0097620_100830541
582 Ga0111539_10188143
583 Ga0105245_10017389
584 Ga0105245_10100501
585 Ga0105245_10623434
586 Ga0105247_10157273
587 Ga0105247_10339304
588 Ga0105247_10346397
589 Ga0105243_10236464
590 Ga0105243_10413284
591 Ga0105241_10131618
592 Ga0105241_10395676
593 Ga0105241_10788769
594 Ga0105248_10132660
595 Ga0105248_10206774
596 Ga0105248_10266903
597 Ga0105237_10050647
598 Ga0105238_10703468
599 Ga0105249_10347747
600 Ga0105249_11031822
601 Ga0105239_10094908
602 Ga0105239_10192647
603 Ga0105239_10224669
604 Ga0105246_10081306
605 Ga0105246_10093735
606 Ga0105246_10099947
607 Ga0157371_10031659
608 Ga0157374_10076644
609 Ga0157378_10246332
610 Ga0157378_10265958
611 Ga0157378_10973761
612 Ga0163162_10029891
613 Ga0163162_10191599
614 Ga0163162_10630676
615 Ga0157372_10006513
616 Ga0157375_10402706
617 Ga0157375_10535645
618 Ga0163163_10118688
619 Ga0163163_10575311
620 Ga0163163_10630356
621 Ga0157380_10089291
622 Ga0157377_10071443
623 Ga0157379_10087069
624 Ga0157379_10146070
625 Ga0157376_10060648
626 Ga0157376_10272855
627 Ga0157376_10983293
628 Ga0163161_10857133
629 Ga0209436_100023
630 Ga0209436_100027
631 Ga0207425_1004962
632 Ga0207425_1019849
633 Ga0209129_1000952
634 Ga0209129_1002503
635 Ga0209673_1001918
636 Ga0209673_1017891
637 Ga0209673_1027530
638 Ga0209130_1000173
639 Ga0209675_1011034
640 Ga0209676_1033789
641 Ga0209025_1000063
642 Ga0209025_1009819
643 Ga0209564_1000043
644 Ga0209564_1000052
645 Ga0209564_1001125
646 Ga0209564_1054993
647 Ga0209758_1000882
648 Ga0209758_1000928
649 Ga0209758_1013601
650 Ga0209256_1000172
651 Ga0209256_1000611
652 Ga0209256_1004068
653 Ga0207426_1000047
654 Ga0209257_1031614
655 Ga0209257_1053091
656 Ga0207656_10415086
657 Ga0207692_10305876
658 Ga0207710_10157147
659 Ga0207645_10099845
660 Ga0207643_10088430
661 Ga0207705_10436294
662 Ga0207654_10045028
663 Ga0207671_10385445
664 Ga0207649_10316262
665 Ga0207652_10819348
666 Ga0207681_10095706
667 Ga0207681_10281181
668 Ga0207694_10619435
669 Ga0207650_10594356
670 Ga0207659_10252687
671 Ga0207687_10070307
672 Ga0207687_10081124
673 Ga0207644_10537382
674 Ga0207709_10751886
675 Ga0207669_10454619
676 Ga0207665_10132023
677 Ga0207711_10243405
678 Ga0207711_10754016
679 Ga0207689_10032149
680 Ga0207689_10060188
681 Ga0207689_10286938
682 Ga0207689_10343812
683 Ga0207661_10195700
684 Ga0207679_10706317
685 Ga0207667_11143337
686 Ga0207651_10265610
687 Ga0207651_10610982
688 Ga0207668_10255400
689 Ga0207668_10523636
690 Ga0207668_10893333
691 Ga0207640_10215860
692 Ga0207677_10077800
693 Ga0207677_10378263
694 Ga0207677_10609058
695 Ga0207703_10071585
696 Ga0207639_10380877
697 Ga0207639_10593102
698 Ga0207678_10032013
699 Ga0207678_10054458
700 Ga0207678_10105925
701 Ga0207678_10129834
702 Ga0207678_10141874
703 Ga0207678_10662138
704 Ga0207708_10134868
705 Ga0207708_10187937
706 Ga0207702_10729825
707 Ga0207641_10068567
708 Ga0207641_10881104
709 Ga0207641_11076609
710 Ga0207648_10040321
711 Ga0207648_10416449
712 Ga0207676_10185525
713 Ga0207674_10106950
714 Ga0207674_10429475
715 Ga0207675_100026900
716 Ga0207675_100217978
717 Ga0207675_100270817
718 Ga0207683_10017697
719 Ga0207683_10019107
720 Ga0207683_10184785
721 Ga0207683_10375049
722 Ga0207698_10112728
723 Ga0207698_11270194
724 Ga0209371_1001701
725 Ga0209813_10189827
726 Ga0207428_10080622
727 Ga0268266_10015103
728 Ga0268266_10028343
729 Ga0268266_10028431
730 Ga0268266_10085986
731 Ga0268264_10612755
732 Ga0265337_1008384
733 Ga0307517_10241609
734 Ga0307515_10446032
735 Ga0268256_1001482
736 Ga0307408_100797555
737 Ga0307516_10407754
738 Ga0307413_10157621
739 Ga0307406_10041360
740 Ga0307406_10050001
741 Ga0307411_10272748
742 Ga0307415_100145697
743 Ga0307415_101189347
744 Ga0307507_10195522
745 Ga0373936_0103900
746 Ga0395900_0154444
747 Ga0395900_0170778
748 Ga0395898_0019882
749 Ga0395905_0008629
750 Ga0395901_0080879
751 Ga0451807_0226762
752 Ga0451837_0454107
753 Ga0451853_1532458
754 Ga0450901_006600
755 Ga0466960_0042960
756 Ga0451576_0197598
757 Ga0495617_036366
758 Ga0495603_0168416
759 Ga0495590_0014807
760 Ga0495638_0028391
761 Ga0495638_0079128
762 Ga0495638_0208415
763 Ga0495582_0264952
764 Ga0495584_0193495
765 Ga0495585_0093082
766 Ga0495594_0149843
767 Ga0495596_0036709
768 Ga0495583_0181004
769 Ga0495606_0036497
770 Ga0495606_0102357
771 Ga0495610_0066794
772 Ga0495631_0051188
773 Ga0495643_0032008
774 Ga0495648_0100395
775 Ga0495648_0268749
776 Ga0495654_0119422
777 Ga0495598_0025729
778 Ga0495609_0027153
779 Ga0495597_0027435
780 Ga0495656_0047488
781 Ga0495611_0341506
782 Ga0495625_0363009
783 Ga0495661_0126335
784 Ga0495661_0281628
785 Ga0495658_0431815
786 Ga0495670_0025405
787 Ga0495671_0213274
788 Ga0495589_0149273
789 Ga0495581_0074733
790 Ga0495672_0013388
791 Ga0495683_0042764
792 Ga0495626_0207156
793 Ga0496100_0101859
794 Ga0496101_0012724
795 Ga0496101_0505587
796 Ga0496102_0289188
797 Ga0496102_0410018
798 Ga0496103_0010521
799 Ga0496104_0045947
800 Ga0496104_0413476
801 Ga0496105_0015008
802 Ga0496106_0035418
803 Ga0496106_0220873
804 Ga0496106_0378959
805 Ga0496107_0345289
806 Ga0496107_0608894
807 Ga0496107_0667994
808 Ga0496108_0270689
809 Ga0496109_0046895
810 Ga0496110_0016079
811 Ga0496110_0369346
812 Ga0496111_0039170
813 Ga0496112_0045416
814 Ga0496113_0034345
815 Ga0496113_0397368
816 Ga0496114_0075065
817 Ga0496114_0272544
818 Ga0496115_0006396
819 Ga0496116_0045724
820 Ga0496117_0052634
821 Ga0496118_0027691
822 Ga0496118_0116134
823 Ga0496118_0321873
824 Ga0496119_0000016
825 Ga0496120_0000310
826 Ga0496121_0000416
827 Ga0496121_0010198
828 Ga0496121_0033109
829 Ga0496121_0182051
830 Ga0496121_0236366
831 Ga0496121_0311256
832 Ga0496122_0034510
833 Ga0496123_0017820
834 Ga0496124_0067454
835 Ga0496124_0246321
836 Ga0496124_0258726
837 Ga0496125_0037410
838 Ga0496126_0011038
839 Ga0496126_0075729
840 Ga0496126_0337353
841 Ga0496126_0815668
842 Ga0501034_0087855
843 Ga0501034_0112453
844 Ga0501037_0261477
845 Ga0501047_0113575
846 Ga0501047_0127485
847 Ga0501067_0037137
848 Ga0501081_0495668
849 Ga0501083_0079680
850 Ga0501280_001630
851 Ga0501044_0276755
852 nmdc:mga03683_140914_c1
853 nmdc:mga03683_30573_c1
854 nmdc:mga03683_83160_c1
855 nmdc:mga00v17_126345_c1
856 nmdc:mga00v17_76642_c1
857 nmdc:mga0yw44_1458_c1
858 nmdc:mga0yw44_7985_c1
859 nmdc:mga0k408_46558_c1
860 nmdc:mga06z11_20912_c1
861 nmdc:mga06z11_219251_c1
862 nmdc:mga07m45_267925_c1
863 nmdc:mga07m45_286859_c1
864 nmdc:mga07m45_447629_c1
865 nmdc:mga06r32_51364_c1
866 nmdc:mga0n895_523317_c1
867 nmdc:mga0n895_95652_c1
868 nmdc:mga0rr50_313576_c1
869 nmdc:mga0a205_200454_c1
870 nmdc:mga0sz30_117986_c1
871 nmdc:mga0sz30_28154_c2
872 nmdc:mga0sz30_288893_c1
873 Ga0495655_0062921
874 Ga0500583_0119433
875 Ga0500651_0068966
876 Ga0500651_0380878
877 Ga0500566_0002846
878 Ga0500641_0005020
879 Ga0500641_0119369
880 Ga0500650_0095335
881 Ga0500650_0168179
882 Ga0500554_016383
883 Ga0500595_002069
884 Ga0500595_004656
885 Ga0500595_036355
886 Ga0500652_000023
887 Ga0500568_0007821
888 Ga0500568_0227918
889 Ga0500588_0035893
890 Ga0500589_140381
891 Ga0500604_0020385
892 Ga0500616_0004940
893 Ga0500622_0015392
894 Ga0500622_0041450
895 Ga0500634_0077516
896 Ga0500638_000874
897 Ga0500636_0003691
898 Ga0500637_0000171
899 Ga0500645_018661
900 Ga0500645_067589
901 Ga0500661_000551
902 Ga0501082_0198034
903 Ga0530510_0238025
904 2511200436
905 2513691858
906 2574430343
907 2585224958
908 2585547514
909 2644729625
910 2644737551
911 2723845742
912 2819243147
913 2841911717
914 2841917326
915 2874609640
916 2876809490
917 2879118497
918 2894773849
919 2904428221
920 2919104390
921 2919156316
922 2919509080
923 2920114229
924 2922392420
925 3005511905
926 8006967382
927 8006997698
928 8056674487

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

55

140

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dnk-assembly1.cif.gz_B the structure of pkmt1 from rickettsia prowazekii in complex with adohcy 0.8226 39 150
2avn-assembly1.cif.gz_A crystal structure of a ubiquinone/menaquinone biosynthesis methyltransferase-related protein (tm1389) from thermotoga maritima msb8 at 2.35 a resolution 0.8209 13 203
2zbr-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methyltransferase from thermus thermophilus in complex with s-adenosyl-ornithine 0.8206 33 202
5dnk-assembly1.cif.gz_A the structure of pkmt1 from rickettsia prowazekii in complex with adohcy 0.8201 36 146
3grz-assembly1.cif.gz_B crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.8139 31 203
ID Description Score Start End Superfamily
af_I1JDM5_91_303_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8767 47 143 3.40.50.150
af_P9WK01_14_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8637 37 143 3.40.50.150
af_P71794_42_196_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8484 29 136 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8474 43 97 3.40.50.150
af_A0A1D6GTC0_4_255_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8409 28 143 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1Z9YTM7-F1-model_v4 SAM-dependent methyltransferase 0.9912 1 202 GO:0008168
GO:0032259
AF-A0A5B0D5H1-F1-model_v4 Class I SAM-dependent methyltransferase 0.9886 7 203 GO:0008168
GO:0032259
AF-A0A8B5UTS9-F1-model_v4 deleted 0.9868 7 203
AF-A0A100W948-F1-model_v4 Methyltransferase 0.9863 7 203 GO:0008168
GO:0032259
AF-A0A2I8DS93-F1-model_v4 SAM-dependent methyltransferase 0.982 7 202 GO:0008168
GO:0032259

Map