F449311

General Info

Members Datasets Scaffolds Average Seq Length
464 230 928 475

Family's Representative Sequence

Representative Sequence 3300025945|Ga0207679_10112483|Ga0207679_101124833
Length 516
Sequence MTSVLFPRASASRVHPNDMSEFRLYNTLTRTTESFAPADGETVLMYTCGPTVYNPAHLGNFRTFLFEDLLRRTLRLRGWRVNQVMNLTDVDDKIITRASQTGRTITQVTEPIVDIFHADRAYLRIEDAEVYPKATETIPEMIELVERLMKRGVAYLAEDGSVYFAIDRFPEYGRLSRLDTREIKSGARVAQDDYSKENAQDFALWKAAKPEDEVAGAAWDSPWGRGRPGWHLECSAMAMKYLGETLDLHCGGVDLVFPHHEDEIAQSEAATGKPFSRVWMHGEFLLTDGAKMAKRVGNVSNVKDLREQGVSAAAVRHFVYSTHYRKQLNLSGVALEASMEAVRRIGEFAARLDDATGGTPELAAAAEEAESAVKAALFDDLNAPEALGALFTFITRGNAELDRRGSDTAALERARQAFAVIDGVLDLRPHIARLTLQGEDAKWISVDGQGTRDLDLGALPSEERDLLDWGAARLRARQVARRERQFADADRIRGELEGRGFVVKDAPGGVVMERFS

Samples

Sample ID Description Type Environment
1 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
144 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
145 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
217 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
229 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.29
Rhizosphere 98.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207679_10112483 3300025945 Bacteria 2152
2 Ga0058862_10288296 3300004803 Bacteria 7548
3 Ga0070658_10051285 3300005327 Bacteria 3344
4 Ga0070658_10052757 3300005327 Bacteria 3299
5 Ga0070658_10070859 3300005327 Bacteria 2854
6 Ga0070676_10000852 3300005328 Bacteria 15089
7 Ga0070676_10003397 3300005328 Bacteria 8287
8 Ga0070676_10061817 3300005328 Bacteria 2227
9 Ga0070683_100008837 3300005329 Bacteria 8573
10 Ga0070683_100017159 3300005329 Bacteria 6394
11 Ga0070683_100017633 3300005329 Bacteria 6310
12 Ga0070683_100019044 3300005329 Bacteria 6090
13 Ga0070683_100019046 3300005329 Bacteria 6090
14 Ga0070683_100035106 3300005329 Bacteria 4583
15 Ga0070683_100049199 3300005329 Bacteria 3898
16 Ga0070683_100063422 3300005329 Bacteria 3437
17 Ga0070683_100083573 3300005329 Bacteria 2990
18 Ga0070683_100193420 3300005329 Bacteria 1932
19 Ga0070690_100022653 3300005330 Bacteria 3844
20 Ga0070670_100067318 3300005331 Bacteria 3073
21 Ga0070666_10078226 3300005335 Bacteria 2257
22 Ga0070666_10088385 3300005335 Bacteria 2126
23 Ga0070680_100001830 3300005336 Bacteria 15622
24 Ga0070680_100049470 3300005336 Bacteria 3427
25 Ga0068868_100004083 3300005338 Bacteria 10193
26 Ga0068868_100055398 3300005338 Bacteria 3128
27 Ga0070660_100055380 3300005339 Bacteria 3064
28 Ga0070689_100032105 3300005340 Bacteria 3993
29 Ga0070689_100093554 3300005340 Bacteria 2372
30 Ga0070691_10001574 3300005341 Bacteria 9854
31 Ga0070691_10006752 3300005341 Bacteria 5252
32 Ga0070687_100002191 3300005343 Bacteria 7230
33 Ga0070687_100035460 3300005343 Bacteria 2477
34 Ga0070661_100016310 3300005344 Bacteria 5251
35 Ga0070661_100016381 3300005344 Bacteria 5239
36 Ga0070669_100006773 3300005353 Bacteria 8246
37 Ga0070669_100018082 3300005353 Bacteria 5035
38 Ga0070669_100053123 3300005353 Bacteria 2965
39 Ga0070675_100005319 3300005354 Bacteria 9835
40 Ga0070675_100017698 3300005354 Bacteria 5668
41 Ga0070675_100018790 3300005354 Bacteria 5502
42 Ga0070675_100019292 3300005354 Bacteria 5431
43 Ga0070675_100031007 3300005354 Bacteria 4319
44 Ga0070675_100056883 3300005354 Bacteria 3224
45 Ga0070675_100111272 3300005354 Bacteria 2317
46 Ga0070671_100084153 3300005355 Bacteria 2660
47 Ga0070673_100051492 3300005364 Bacteria 3225
48 Ga0070673_100209026 3300005364 Bacteria 1684
49 Ga0070688_100003685 3300005365 Bacteria 7916
50 Ga0070688_100087097 3300005365 Bacteria 2033
51 Ga0070659_100004941 3300005366 Bacteria 9536
52 Ga0070659_100009111 3300005366 Bacteria 7279
53 Ga0070659_100050336 3300005366 Bacteria 3275
54 Ga0070667_100020976 3300005367 Bacteria 5427
55 Ga0070709_10026161 3300005434 Bacteria 3454
56 Ga0070714_100022383 3300005435 Bacteria 5182
57 Ga0070714_100066829 3300005435 Bacteria 3099
58 Ga0070713_100000236 3300005436 Bacteria 36563
59 Ga0070713_100004407 3300005436 Bacteria 9452
60 Ga0070713_100051011 3300005436 Bacteria 3421
61 Ga0070713_100197146 3300005436 Bacteria 1817
62 Ga0070694_100040783 3300005444 Bacteria 3095
63 Ga0070708_100000077 3300005445 Bacteria 63116
64 Ga0070663_100041448 3300005455 Bacteria 3229
65 Ga0070662_100011382 3300005457 Bacteria 5873
66 Ga0070662_100041932 3300005457 Bacteria 3267
67 Ga0070662_100126694 3300005457 Bacteria 1963
68 Ga0070662_100197043 3300005457 Bacteria 1596
69 Ga0070681_10001680 3300005458 Bacteria 19775
70 Ga0070681_10003472 3300005458 Bacteria 14770
71 Ga0070681_10039796 3300005458 Bacteria 4712
72 Ga0070685_10041336 3300005466 Bacteria 2626
73 Ga0070707_100174851 3300005468 Bacteria 2093
74 Ga0070698_100010077 3300005471 Bacteria 10093
75 Ga0070698_100047603 3300005471 Bacteria 4383
76 Ga0070698_100240692 3300005471 Bacteria 1743
77 Ga0070699_100096315 3300005518 Bacteria 2592
78 Ga0070679_100018875 3300005530 Bacteria 6695
79 Ga0070679_100027822 3300005530 Bacteria 5569
80 Ga0070679_100033725 3300005530 Bacteria 5069
81 Ga0070679_100043323 3300005530 Bacteria 4482
82 Ga0070679_100125724 3300005530 Bacteria 2546
83 Ga0070679_100194336 3300005530 Bacteria 1997
84 Ga0070684_100004064 3300005535 Bacteria 11076
85 Ga0070684_100020864 3300005535 Bacteria 5439
86 Ga0070684_100023383 3300005535 Bacteria 5168
87 Ga0070684_100037346 3300005535 Bacteria 4166
88 Ga0070684_100037981 3300005535 Bacteria 4134
89 Ga0070684_100038744 3300005535 Bacteria 4096
90 Ga0070684_100041680 3300005535 Bacteria 3959
91 Ga0070684_100044530 3300005535 Bacteria 3839
92 Ga0070684_100155810 3300005535 Bacteria 2071
93 Ga0070684_100163119 3300005535 Bacteria 2022
94 Ga0070684_100241506 3300005535 Bacteria 1650
95 Ga0068853_100024727 3300005539 Bacteria 5038
96 Ga0070672_100013307 3300005543 Bacteria 5807
97 Ga0070686_100055064 3300005544 Bacteria 2546
98 Ga0070686_100134300 3300005544 Bacteria 1715
99 Ga0070695_100020002 3300005545 Bacteria 4082
100 Ga0070696_100000705 3300005546 Bacteria 21330
101 Ga0070696_100049389 3300005546 Bacteria 2922
102 Ga0070693_100032223 3300005547 Bacteria 2880
103 Ga0068855_100020190 3300005563 Bacteria 8000
104 Ga0070664_100019152 3300005564 Bacteria 5628
105 Ga0070664_100028453 3300005564 Bacteria 4649
106 Ga0070664_100054839 3300005564 Bacteria 3384
107 Ga0070664_100123442 3300005564 Bacteria 2269
108 Ga0070664_100170174 3300005564 Bacteria 1932
109 Ga0068857_100002740 3300005577 Bacteria 14470
110 Ga0068857_100043157 3300005577 Bacteria 4000
111 Ga0068857_100077038 3300005577 Bacteria 2975
112 Ga0068857_100096581 3300005577 Bacteria 2648
113 Ga0068854_100037882 3300005578 Bacteria 3387
114 Ga0068856_100021139 3300005614 Bacteria 6324
115 Ga0068856_100033841 3300005614 Bacteria 5004
116 Ga0068856_100233894 3300005614 Bacteria 1853
117 Ga0070702_100006039 3300005615 Bacteria 5702
118 Ga0068852_100009967 3300005616 Bacteria 7070
119 Ga0068852_100011090 3300005616 Bacteria 6767
120 Ga0068852_100011877 3300005616 Bacteria 6585
121 Ga0068859_100006679 3300005617 Bacteria 11711
122 Ga0068859_100050790 3300005617 Bacteria 4166
123 Ga0068864_100027365 3300005618 Bacteria 4815
124 Ga0068866_10010559 3300005718 Bacteria 3965
125 Ga0068861_100000975 3300005719 Bacteria 17448
126 Ga0068861_100020586 3300005719 Bacteria 4728
127 Ga0068870_10003802 3300005840 Bacteria 6426
128 Ga0068863_100025706 3300005841 Bacteria 5615
129 Ga0068860_100197580 3300005843 Bacteria 1948
130 Ga0068862_100000764 3300005844 Bacteria 32066
131 Ga0081539_10005565 3300005985 Bacteria 12756
132 Ga0081539_10005702 3300005985 Bacteria 12472
133 Ga0070717_10016164 3300006028 Bacteria 5782
134 Ga0075430_100001414 3300006846 Bacteria 19526
135 Ga0075430_100046767 3300006846 Bacteria 3654
136 Ga0075431_100040145 3300006847 Bacteria 4822
137 Ga0075431_100050801 3300006847 Bacteria 4275
138 Ga0075431_100073758 3300006847 Bacteria 3521
139 Ga0075434_100019742 3300006871 Bacteria 6525
140 Ga0075434_100066197 3300006871 Bacteria 3599
141 Ga0068865_100106148 3300006881 Bacteria 2064
142 Ga0097620_100006680 3300006931 Bacteria 11711
143 Ga0097620_100050793 3300006931 Bacteria 4166
144 Ga0105240_10077608 3300009093 Bacteria 4091
145 Ga0105240_10171977 3300009093 Bacteria 2565
146 Ga0111539_10012931 3300009094 Bacteria 10445
147 Ga0111539_10300558 3300009094 Bacteria 1868
148 Ga0105245_10027392 3300009098 Bacteria 5021
149 Ga0114129_10023982 3300009147 Bacteria 8646
150 Ga0114129_10179171 3300009147 Bacteria 2885
151 Ga0114129_10405370 3300009147 Bacteria 1796
152 Ga0105241_10001069 3300009174 Bacteria 20888
153 Ga0105241_10029722 3300009174 Bacteria 4079
154 Ga0105242_10013464 3300009176 Bacteria 6324
155 Ga0105242_10016096 3300009176 Bacteria 5810
156 Ga0105248_10057177 3300009177 Bacteria 4378
157 Ga0105248_10125033 3300009177 Bacteria 2901
158 Ga0105248_10205391 3300009177 Bacteria 2220
159 Ga0105237_10063899 3300009545 Bacteria 3678
160 Ga0105238_10037973 3300009551 Bacteria 4894
161 Ga0105238_10042353 3300009551 Bacteria 4611
162 Ga0105249_10000580 3300009553 Bacteria 33471
163 Ga0105249_10150789 3300009553 Bacteria 2238
164 Ga0105239_10081535 3300010375 Bacteria 3561
165 Ga0157371_10007163 3300013102 Bacteria 9060
166 Ga0157371_10010425 3300013102 Bacteria 7241
167 Ga0157371_10075513 3300013102 Bacteria 2387
168 Ga0157370_10004113 3300013104 Bacteria 16859
169 Ga0157370_10080251 3300013104 Bacteria 3072
170 Ga0157370_10228121 3300013104 Bacteria 1724
171 Ga0157369_10019492 3300013105 Bacteria 7591
172 Ga0157369_10023450 3300013105 Bacteria 6873
173 Ga0157369_10077564 3300013105 Bacteria 3561
174 Ga0157374_10008485 3300013296 Bacteria 8789
175 Ga0157374_10039243 3300013296 Bacteria 4358
176 Ga0163162_10017886 3300013306 Bacteria 6935
177 Ga0163162_10130552 3300013306 Bacteria 2621
178 Ga0163162_10247627 3300013306 Bacteria 1914
179 Ga0157372_10016296 3300013307 Bacteria 7977
180 Ga0157372_10029779 3300013307 Bacteria 5966
181 Ga0157372_10048731 3300013307 Bacteria 4709
182 Ga0157372_10072857 3300013307 Bacteria 3871
183 Ga0157372_10086559 3300013307 Bacteria 3555
184 Ga0157372_10195399 3300013307 Bacteria 2344
185 Ga0157375_10017651 3300013308 Bacteria 6446
186 Ga0157375_10036172 3300013308 Bacteria 4720
187 Ga0157375_10053035 3300013308 Bacteria 3988
188 Ga0157375_10113859 3300013308 Bacteria 2806
189 Ga0157375_10139311 3300013308 Bacteria 2552
190 Ga0163163_10063707 3300014325 Bacteria 3656
191 Ga0157380_10018920 3300014326 Bacteria 5124
192 Ga0157380_10082382 3300014326 Bacteria 2633
193 Ga0157377_10034222 3300014745 Bacteria 2779
194 Ga0213876_10055829 3300021384 Bacteria 2085
195 Ga0207697_10008426 3300025315 Bacteria 4510
196 Ga0207647_10108175 3300025904 Bacteria 1645
197 Ga0207699_10010945 3300025906 Bacteria 4568
198 Ga0207699_10029804 3300025906 Bacteria 3047
199 Ga0207645_10000909 3300025907 Bacteria 24558
200 Ga0207643_10021772 3300025908 Bacteria 3526
201 Ga0207705_10003951 3300025909 Bacteria 11274
202 Ga0207705_10058202 3300025909 Bacteria 2788
203 Ga0207705_10104983 3300025909 Bacteria 2082
204 Ga0207654_10000469 3300025911 Bacteria 23042
205 Ga0207707_10004373 3300025912 Bacteria 12489
206 Ga0207707_10022893 3300025912 Bacteria 5464
207 Ga0207707_10038045 3300025912 Bacteria 4204
208 Ga0207695_10004272 3300025913 Bacteria 19618
209 Ga0207695_10019555 3300025913 Bacteria 7792
210 Ga0207660_10005288 3300025917 Bacteria 8398
211 Ga0207660_10072777 3300025917 Bacteria 2504
212 Ga0207662_10002055 3300025918 Bacteria 9973
213 Ga0207657_10003360 3300025919 Bacteria 17098
214 Ga0207657_10039477 3300025919 Bacteria 4195
215 Ga0207657_10061891 3300025919 Bacteria 3206
216 Ga0207657_10087446 3300025919 Bacteria 2607
217 Ga0207649_10010203 3300025920 Bacteria 5156
218 Ga0207652_10011698 3300025921 Bacteria 7081
219 Ga0207652_10034682 3300025921 Bacteria 4254
220 Ga0207652_10244934 3300025921 Bacteria 1616
221 Ga0207681_10006283 3300025923 Bacteria 7293
222 Ga0207681_10008946 3300025923 Bacteria 6114
223 Ga0207650_10034121 3300025925 Bacteria 3689
224 Ga0207650_10070703 3300025925 Bacteria 2624
225 Ga0207650_10175732 3300025925 Bacteria 1704
226 Ga0207659_10008724 3300025926 Bacteria 6309
227 Ga0207659_10110608 3300025926 Bacteria 2088
228 Ga0207700_10001717 3300025928 Bacteria 12440
229 Ga0207700_10025961 3300025928 Bacteria 4078
230 Ga0207700_10038594 3300025928 Bacteria 3467
231 Ga0207700_10162667 3300025928 Bacteria 1855
232 Ga0207664_10033008 3300025929 Bacteria 3973
233 Ga0207664_10084256 3300025929 Bacteria 2593
234 Ga0207690_10010146 3300025932 Bacteria 5595
235 Ga0207690_10024219 3300025932 Bacteria 3799
236 Ga0207706_10002035 3300025933 Bacteria 19832
237 Ga0207706_10042210 3300025933 Bacteria 4043
238 Ga0207706_10058141 3300025933 Bacteria 3406
239 Ga0207706_10064260 3300025933 Bacteria 3231
240 Ga0207706_10126067 3300025933 Bacteria 2252
241 Ga0207706_10211494 3300025933 Bacteria 1700
242 Ga0207686_10041303 3300025934 Bacteria 2811
243 Ga0207670_10021071 3300025936 Bacteria 4015
244 Ga0207670_10046200 3300025936 Bacteria 2891
245 Ga0207670_10046203 3300025936 Bacteria 2891
246 Ga0207704_10003676 3300025938 Bacteria 6974
247 Ga0207691_10018044 3300025940 Bacteria 6681
248 Ga0207691_10024974 3300025940 Bacteria 5615
249 Ga0207691_10063410 3300025940 Bacteria 3352
250 Ga0207691_10169051 3300025940 Bacteria 1915
251 Ga0207691_10182015 3300025940 Bacteria 1836
252 Ga0207711_10068311 3300025941 Bacteria 3078
253 Ga0207689_10002271 3300025942 Bacteria 18009
254 Ga0207661_10011516 3300025944 Bacteria 6411
255 Ga0207661_10019031 3300025944 Bacteria 5111
256 Ga0207661_10021271 3300025944 Bacteria 4859
257 Ga0207661_10026612 3300025944 Bacteria 4410
258 Ga0207661_10038183 3300025944 Bacteria 3762
259 Ga0207661_10039655 3300025944 Bacteria 3698
260 Ga0207661_10062886 3300025944 Bacteria 3004
261 Ga0207661_10121642 3300025944 Bacteria 2223
262 Ga0207661_10224733 3300025944 Bacteria 1660
263 Ga0207679_10000582 3300025945 Bacteria 24408
264 Ga0207679_10001347 3300025945 Bacteria 15488
265 Ga0207679_10002943 3300025945 Bacteria 10549
266 Ga0207679_10121065 3300025945 Bacteria 2083
267 Ga0207667_10059698 3300025949 Bacteria 3993
268 Ga0207667_10086535 3300025949 Bacteria 3243
269 Ga0207651_10150780 3300025960 Bacteria 1809
270 Ga0207712_10000596 3300025961 Bacteria 28910
271 Ga0207712_10015548 3300025961 Bacteria 4913
272 Ga0207639_10058547 3300026041 Bacteria 2964
273 Ga0207678_10000124 3300026067 Bacteria 64383
274 Ga0207702_10075506 3300026078 Bacteria 2912
275 Ga0207702_10089697 3300026078 Bacteria 2689
276 Ga0207641_10099248 3300026088 Bacteria 2562
277 Ga0207648_10155123 3300026089 Bacteria 2021
278 Ga0207676_10003341 3300026095 Bacteria 11375
279 Ga0207674_10000393 3300026116 Bacteria 56512
280 Ga0207674_10008639 3300026116 Bacteria 11736
281 Ga0207674_10019696 3300026116 Bacteria 7304
282 Ga0207674_10072058 3300026116 Bacteria 3471
283 Ga0207674_10116087 3300026116 Bacteria 2648
284 Ga0207675_100002519 3300026118 Bacteria 18126
285 Ga0207675_100038826 3300026118 Bacteria 4443
286 Ga0207698_10003179 3300026142 Bacteria 9853
287 Ga0207698_10111153 3300026142 Bacteria 2297
288 Ga0207698_10125503 3300026142 Bacteria 2182
289 Ga0268266_10129214 3300028379 Bacteria 2258
290 Ga0268265_10004276 3300028380 Bacteria 9964
291 Ga0268265_10007876 3300028380 Bacteria 7188
292 Ga0268265_10027963 3300028380 Bacteria 4033
293 Ga0268265_10042562 3300028380 Bacteria 3371
294 Ga0265332_10000774 3300031238 Bacteria 19607
295 Ga0265327_10004242 3300031251 Bacteria 12852
296 Ga0307408_100002257 3300031548 Bacteria 13743
297 Ga0307408_100071772 3300031548 Bacteria 2561
298 Ga0307408_100105991 3300031548 Bacteria 2150
299 Ga0265314_10003494 3300031711 Bacteria 15169
300 Ga0265314_10035562 3300031711 Bacteria 3629
301 Ga0307405_10000834 3300031731 Bacteria 12135
302 Ga0307405_10009201 3300031731 Bacteria 5052
303 Ga0307405_10034902 3300031731 Bacteria 2998
304 Ga0307413_10001244 3300031824 Bacteria 9481
305 Ga0307413_10032114 3300031824 Bacteria 2971
306 Ga0307410_10049054 3300031852 Bacteria 2832
307 Ga0307410_10068143 3300031852 Bacteria 2456
308 Ga0307406_10057633 3300031901 Bacteria 2492
309 Ga0307406_10123350 3300031901 Bacteria 1805
310 Ga0307406_10152800 3300031901 Bacteria 1649
311 Ga0307407_10029994 3300031903 Bacteria 2928
312 Ga0307407_10043315 3300031903 Bacteria 2529
313 Ga0307407_10060889 3300031903 Bacteria 2204
314 Ga0307409_100010181 3300031995 Bacteria 5828
315 Ga0307409_100171757 3300031995 Bacteria 1909
316 Ga0307409_100190861 3300031995 Bacteria 1823
317 Ga0307416_100001472 3300032002 Bacteria 12830
318 Ga0307416_100021518 3300032002 Bacteria 4633
319 Ga0307416_100024851 3300032002 Bacteria 4380
320 Ga0307416_100090713 3300032002 Bacteria 2622
321 Ga0307416_100197031 3300032002 Bacteria 1906
322 Ga0307414_10060324 3300032004 Bacteria 2682
323 Ga0307414_10109925 3300032004 Bacteria 2095
324 Ga0307411_10004538 3300032005 Bacteria 6667
325 Ga0307411_10004842 3300032005 Bacteria 6531
326 Ga0307411_10007064 3300032005 Bacteria 5681
327 Ga0307411_10137014 3300032005 Bacteria 1799
328 Ga0307415_100001337 3300032126 Bacteria 11702
329 Ga0307415_100055539 3300032126 Bacteria 2710
330 Ga0307415_100192070 3300032126 Bacteria 1612
331 Ga0373926_0005693 3300035083 Bacteria 4112
332 Ga0373934_0003191 3300035086 Bacteria 5993
333 Ga0373934_0016465 3300035086 Bacteria 2811
334 Ga0373923_0001776 3300035111 Bacteria 6353
335 Ga0373936_0007529 3300035113 Bacteria 4096
336 Ga0373953_0000508 3300035117 Bacteria 10822
337 Ga0373954_0012056 3300035118 Bacteria 3840
338 Ga0373956_0003466 3300035119 Bacteria 6347
339 Ga0373956_0047357 3300035119 Bacteria 1923
340 Ga0373955_0009545 3300035172 Bacteria 4550
341 Ga0373931_0015459 3300035691 Bacteria 3744
342 Ga0373935_0001207 3300035692 Bacteria 14241
343 Ga0373927_0051421 3300035695 Bacteria 2664
344 Ga0373933_0000104 3300035724 Bacteria 53573
345 Ga0373933_0011000 3300035724 Bacteria 4971
346 Ga0373933_0013114 3300035724 Bacteria 4590
347 Ga0373947_0000102 3300035725 Bacteria 42788
348 Ga0373947_0082422 3300035725 Bacteria 1993
349 Ga0373937_0000161 3300036401 Bacteria 64761
350 Ga0373937_0016769 3300036401 Bacteria 6511
351 Ga0373925_0000385 3300037068 Bacteria 45502
352 Ga0373925_0051228 3300037068 Bacteria 3081
353 Ga0395900_0066440 3300037418 Bacteria 3705
354 Ga0395905_0012654 3300037471 Bacteria 8118
355 Ga0395905_0022348 3300037471 Bacteria 5984
356 Ga0395905_0205524 3300037471 Bacteria 1846
357 Ga0395901_0013649 3300038443 Bacteria 8258
358 Ga0436365_0215252 3300039437 Bacteria 1622
359 Ga0439462_0019381 3300042015 Bacteria 1771
360 Ga0451577_0000001 3300042876 Bacteria 2461803
361 Ga0453684_0088795 3300044712 Bacteria 3826
362 Ga0466959_0075712 3300045049 Bacteria 2431
363 Ga0451576_0281398 3300045051 Bacteria 1739
364 Ga0451576_0488653 3300045051 Bacteria 1293
365 Ga0466967_0351830 3300045976 Bacteria 1426
366 Ga0495592_0001510 3300046454 Bacteria 16209
367 Ga0495603_0000774 3300046455 Bacteria 18264
368 Ga0495629_0011138 3300046459 Bacteria 6534
369 Ga0495629_0014859 3300046459 Bacteria 5601
370 Ga0495629_0029943 3300046459 Bacteria 3859
371 Ga0495651_0000077 3300046462 Bacteria 71891
372 Ga0495651_0001379 3300046462 Bacteria 18839
373 Ga0495653_0000153 3300046463 Bacteria 57262
374 Ga0495653_0016079 3300046463 Bacteria 6099
375 Ga0495580_0000048 3300046472 Bacteria 68571
376 Ga0495582_0000179 3300046473 Bacteria 34488
377 Ga0495582_0025920 3300046473 Bacteria 3213
378 Ga0495639_0000917 3300046475 Bacteria 13315
379 Ga0495639_0019437 3300046475 Bacteria 2965
380 Ga0495639_0066511 3300046475 Bacteria 1659
381 Ga0495664_0008013 3300046477 Bacteria 5882
382 Ga0495594_0008321 3300046499 Bacteria 5343
383 Ga0495594_0092301 3300046499 Bacteria 1697
384 Ga0495608_0001077 3300046511 Bacteria 19255
385 Ga0495618_0027889 3300046514 Bacteria 3517
386 Ga0495628_0000243 3300046516 Bacteria 48123
387 Ga0495628_0095338 3300046516 Bacteria 2299
388 Ga0495630_0004558 3300046517 Bacteria 9711
389 Ga0495630_0047953 3300046517 Bacteria 3196
390 Ga0495630_0104271 3300046517 Bacteria 2146
391 Ga0495630_0106763 3300046517 Bacteria 2121
392 Ga0495652_0002587 3300046529 Bacteria 18520
393 Ga0495652_0002951 3300046529 Bacteria 17113
394 Ga0495665_0000002 3300046531 Bacteria 128983
395 Ga0495665_0035879 3300046531 Bacteria 2647
396 Ga0495640_0084240 3300046533 Bacteria 2109
397 Ga0495586_0010326 3300046535 Bacteria 4964
398 Ga0495586_0012544 3300046535 Bacteria 4496
399 Ga0495587_0000452 3300046536 Bacteria 28656
400 Ga0495587_0003021 3300046536 Bacteria 11247
401 Ga0495645_0004021 3300046543 Bacteria 10042
402 Ga0495645_0004375 3300046543 Bacteria 9647
403 Ga0495645_0006938 3300046543 Bacteria 7870
404 Ga0495667_0001003 3300046559 Bacteria 18295
405 Ga0495667_0029094 3300046559 Bacteria 3718
406 Ga0495667_0081747 3300046559 Bacteria 2099
407 Ga0495634_0022470 3300046642 Bacteria 4444
408 Ga0495635_0000048 3300046663 Bacteria 79393
409 Ga0495588_0000464 3300046674 Bacteria 20343
410 Ga0495657_0001010 3300046675 Bacteria 24781
411 Ga0495599_0004988 3300046678 Bacteria 7895
412 Ga0495623_0000961 3300046679 Bacteria 19433
413 Ga0495623_0009437 3300046679 Bacteria 6334
414 Ga0495646_0008753 3300046680 Bacteria 6430
415 Ga0495658_0000017 3300046683 Bacteria 93346
416 Ga0495658_0017649 3300046683 Bacteria 3692
417 Ga0495658_0018274 3300046683 Bacteria 3642
418 Ga0495613_0048910 3300046689 Bacteria 3121
419 Ga0495600_0000158 3300046809 Bacteria 39122
420 Ga0495600_0040952 3300046809 Bacteria 3019
421 Ga0495581_0000312 3300047315 Bacteria 23854
422 Ga0495581_0024396 3300047315 Bacteria 3504
423 Ga0495604_0000017 3300047317 Bacteria 192029
424 Ga0495674_0004269 3300047319 Bacteria 13758
425 Ga0495674_0024914 3300047319 Bacteria 5491
426 Ga0495674_0206953 3300047319 Bacteria 1626
427 Ga0495674_0207982 3300047319 Bacteria 1622
428 Ga0495672_0003004 3300047320 Bacteria 14831
429 Ga0495675_0002210 3300047444 Bacteria 11607
430 Ga0495675_0032179 3300047444 Bacteria 3346
431 Ga0495684_0000118 3300047471 Bacteria 57785
432 Ga0495593_0000009 3300047673 Bacteria 85608
433 Ga0495602_0000891 3300048088 Bacteria 28810
434 Ga0495602_0029816 3300048088 Bacteria 5186
435 Ga0495614_0000005 3300048089 Bacteria 74692
436 Ga0496108_0079275 3300048911 Bacteria 2780
437 Ga0496110_0238995 3300048913 Bacteria 1653
438 Ga0496112_0011512 3300048915 Bacteria 8082
439 Ga0496112_0080000 3300048915 Bacteria 3232
440 Ga0496113_0007671 3300048916 Bacteria 6962
441 Ga0496113_0026825 3300048916 Bacteria 4123
442 Ga0501032_0046085 3300049569 Bacteria 2947
443 Ga0501033_0003020 3300049570 Bacteria 14044
444 Ga0501037_0027960 3300049573 Bacteria 4167
445 Ga0501047_0202464 3300049581 Bacteria 1846
446 Ga0501225_0010742 3300049705 Bacteria 2589
447 Ga0501234_006658 3300049707 Bacteria 1806
448 Ga0501035_0048901 3300049822 Bacteria 3791
449 Ga0501204_004116 3300049850 Bacteria 1557
450 nmdc:mga05p37_353186_c1 3300050507 Bacteria 1730
451 nmdc:mga05p37_58133_c1 3300050507 Bacteria 4762
452 nmdc:mga05p37_69400_c2 3300050507 Bacteria 2871
453 nmdc:mga09592_52114_c1 3300050508 Bacteria 3453
454 nmdc:mga0qj67_18360_c1 3300050509 Bacteria 5330
455 nmdc:mga06r32_26386_c1 3300050510 Bacteria 5415
456 nmdc:mga06r32_77445_c1 3300050510 Bacteria 3230
457 nmdc:mga08y16_186536_c1 3300050511 Bacteria 2152
458 nmdc:mga0n895_45213_c1 3300050512 Bacteria 4296
459 nmdc:mga0n895_57825_c1 3300050512 Bacteria 3823
460 nmdc:mga0a205_22387_c1 3300050515 Bacteria 5985
461 Ga0495601_0005535 3300053077 Bacteria 7368
462 Ga0495612_0002431 3300053078 Bacteria 7674
463 Ga0495595_0030623 3300053084 Bacteria 2415
464 Ga0495619_0002005 3300053085 Bacteria 13547
465 Ga0207679_10112483
466 Ga0058862_10288296
467 Ga0070658_10051285
468 Ga0070658_10052757
469 Ga0070658_10070859
470 Ga0070676_10000852
471 Ga0070676_10003397
472 Ga0070676_10061817
473 Ga0070683_100008837
474 Ga0070683_100017159
475 Ga0070683_100017633
476 Ga0070683_100019044
477 Ga0070683_100019046
478 Ga0070683_100035106
479 Ga0070683_100049199
480 Ga0070683_100063422
481 Ga0070683_100083573
482 Ga0070683_100193420
483 Ga0070690_100022653
484 Ga0070670_100067318
485 Ga0070666_10078226
486 Ga0070666_10088385
487 Ga0070680_100001830
488 Ga0070680_100049470
489 Ga0068868_100004083
490 Ga0068868_100055398
491 Ga0070660_100055380
492 Ga0070689_100032105
493 Ga0070689_100093554
494 Ga0070691_10001574
495 Ga0070691_10006752
496 Ga0070687_100002191
497 Ga0070687_100035460
498 Ga0070661_100016310
499 Ga0070661_100016381
500 Ga0070669_100006773
501 Ga0070669_100018082
502 Ga0070669_100053123
503 Ga0070675_100005319
504 Ga0070675_100017698
505 Ga0070675_100018790
506 Ga0070675_100019292
507 Ga0070675_100031007
508 Ga0070675_100056883
509 Ga0070675_100111272
510 Ga0070671_100084153
511 Ga0070673_100051492
512 Ga0070673_100209026
513 Ga0070688_100003685
514 Ga0070688_100087097
515 Ga0070659_100004941
516 Ga0070659_100009111
517 Ga0070659_100050336
518 Ga0070667_100020976
519 Ga0070709_10026161
520 Ga0070714_100022383
521 Ga0070714_100066829
522 Ga0070713_100000236
523 Ga0070713_100004407
524 Ga0070713_100051011
525 Ga0070713_100197146
526 Ga0070694_100040783
527 Ga0070708_100000077
528 Ga0070663_100041448
529 Ga0070662_100011382
530 Ga0070662_100041932
531 Ga0070662_100126694
532 Ga0070662_100197043
533 Ga0070681_10001680
534 Ga0070681_10003472
535 Ga0070681_10039796
536 Ga0070685_10041336
537 Ga0070707_100174851
538 Ga0070698_100010077
539 Ga0070698_100047603
540 Ga0070698_100240692
541 Ga0070699_100096315
542 Ga0070679_100018875
543 Ga0070679_100027822
544 Ga0070679_100033725
545 Ga0070679_100043323
546 Ga0070679_100125724
547 Ga0070679_100194336
548 Ga0070684_100004064
549 Ga0070684_100020864
550 Ga0070684_100023383
551 Ga0070684_100037346
552 Ga0070684_100037981
553 Ga0070684_100038744
554 Ga0070684_100041680
555 Ga0070684_100044530
556 Ga0070684_100155810
557 Ga0070684_100163119
558 Ga0070684_100241506
559 Ga0068853_100024727
560 Ga0070672_100013307
561 Ga0070686_100055064
562 Ga0070686_100134300
563 Ga0070695_100020002
564 Ga0070696_100000705
565 Ga0070696_100049389
566 Ga0070693_100032223
567 Ga0068855_100020190
568 Ga0070664_100019152
569 Ga0070664_100028453
570 Ga0070664_100054839
571 Ga0070664_100123442
572 Ga0070664_100170174
573 Ga0068857_100002740
574 Ga0068857_100043157
575 Ga0068857_100077038
576 Ga0068857_100096581
577 Ga0068854_100037882
578 Ga0068856_100021139
579 Ga0068856_100033841
580 Ga0068856_100233894
581 Ga0070702_100006039
582 Ga0068852_100009967
583 Ga0068852_100011090
584 Ga0068852_100011877
585 Ga0068859_100006679
586 Ga0068859_100050790
587 Ga0068864_100027365
588 Ga0068866_10010559
589 Ga0068861_100000975
590 Ga0068861_100020586
591 Ga0068870_10003802
592 Ga0068863_100025706
593 Ga0068860_100197580
594 Ga0068862_100000764
595 Ga0081539_10005565
596 Ga0081539_10005702
597 Ga0070717_10016164
598 Ga0075430_100001414
599 Ga0075430_100046767
600 Ga0075431_100040145
601 Ga0075431_100050801
602 Ga0075431_100073758
603 Ga0075434_100019742
604 Ga0075434_100066197
605 Ga0068865_100106148
606 Ga0097620_100006680
607 Ga0097620_100050793
608 Ga0105240_10077608
609 Ga0105240_10171977
610 Ga0111539_10012931
611 Ga0111539_10300558
612 Ga0105245_10027392
613 Ga0114129_10023982
614 Ga0114129_10179171
615 Ga0114129_10405370
616 Ga0105241_10001069
617 Ga0105241_10029722
618 Ga0105242_10013464
619 Ga0105242_10016096
620 Ga0105248_10057177
621 Ga0105248_10125033
622 Ga0105248_10205391
623 Ga0105237_10063899
624 Ga0105238_10037973
625 Ga0105238_10042353
626 Ga0105249_10000580
627 Ga0105249_10150789
628 Ga0105239_10081535
629 Ga0157371_10007163
630 Ga0157371_10010425
631 Ga0157371_10075513
632 Ga0157370_10004113
633 Ga0157370_10080251
634 Ga0157370_10228121
635 Ga0157369_10019492
636 Ga0157369_10023450
637 Ga0157369_10077564
638 Ga0157374_10008485
639 Ga0157374_10039243
640 Ga0163162_10017886
641 Ga0163162_10130552
642 Ga0163162_10247627
643 Ga0157372_10016296
644 Ga0157372_10029779
645 Ga0157372_10048731
646 Ga0157372_10072857
647 Ga0157372_10086559
648 Ga0157372_10195399
649 Ga0157375_10017651
650 Ga0157375_10036172
651 Ga0157375_10053035
652 Ga0157375_10113859
653 Ga0157375_10139311
654 Ga0163163_10063707
655 Ga0157380_10018920
656 Ga0157380_10082382
657 Ga0157377_10034222
658 Ga0213876_10055829
659 Ga0207697_10008426
660 Ga0207647_10108175
661 Ga0207699_10010945
662 Ga0207699_10029804
663 Ga0207645_10000909
664 Ga0207643_10021772
665 Ga0207705_10003951
666 Ga0207705_10058202
667 Ga0207705_10104983
668 Ga0207654_10000469
669 Ga0207707_10004373
670 Ga0207707_10022893
671 Ga0207707_10038045
672 Ga0207695_10004272
673 Ga0207695_10019555
674 Ga0207660_10005288
675 Ga0207660_10072777
676 Ga0207662_10002055
677 Ga0207657_10003360
678 Ga0207657_10039477
679 Ga0207657_10061891
680 Ga0207657_10087446
681 Ga0207649_10010203
682 Ga0207652_10011698
683 Ga0207652_10034682
684 Ga0207652_10244934
685 Ga0207681_10006283
686 Ga0207681_10008946
687 Ga0207650_10034121
688 Ga0207650_10070703
689 Ga0207650_10175732
690 Ga0207659_10008724
691 Ga0207659_10110608
692 Ga0207700_10001717
693 Ga0207700_10025961
694 Ga0207700_10038594
695 Ga0207700_10162667
696 Ga0207664_10033008
697 Ga0207664_10084256
698 Ga0207690_10010146
699 Ga0207690_10024219
700 Ga0207706_10002035
701 Ga0207706_10042210
702 Ga0207706_10058141
703 Ga0207706_10064260
704 Ga0207706_10126067
705 Ga0207706_10211494
706 Ga0207686_10041303
707 Ga0207670_10021071
708 Ga0207670_10046200
709 Ga0207670_10046203
710 Ga0207704_10003676
711 Ga0207691_10018044
712 Ga0207691_10024974
713 Ga0207691_10063410
714 Ga0207691_10169051
715 Ga0207691_10182015
716 Ga0207711_10068311
717 Ga0207689_10002271
718 Ga0207661_10011516
719 Ga0207661_10019031
720 Ga0207661_10021271
721 Ga0207661_10026612
722 Ga0207661_10038183
723 Ga0207661_10039655
724 Ga0207661_10062886
725 Ga0207661_10121642
726 Ga0207661_10224733
727 Ga0207679_10000582
728 Ga0207679_10001347
729 Ga0207679_10002943
730 Ga0207679_10121065
731 Ga0207667_10059698
732 Ga0207667_10086535
733 Ga0207651_10150780
734 Ga0207712_10000596
735 Ga0207712_10015548
736 Ga0207639_10058547
737 Ga0207678_10000124
738 Ga0207702_10075506
739 Ga0207702_10089697
740 Ga0207641_10099248
741 Ga0207648_10155123
742 Ga0207676_10003341
743 Ga0207674_10000393
744 Ga0207674_10008639
745 Ga0207674_10019696
746 Ga0207674_10072058
747 Ga0207674_10116087
748 Ga0207675_100002519
749 Ga0207675_100038826
750 Ga0207698_10003179
751 Ga0207698_10111153
752 Ga0207698_10125503
753 Ga0268266_10129214
754 Ga0268265_10004276
755 Ga0268265_10007876
756 Ga0268265_10027963
757 Ga0268265_10042562
758 Ga0265332_10000774
759 Ga0265327_10004242
760 Ga0307408_100002257
761 Ga0307408_100071772
762 Ga0307408_100105991
763 Ga0265314_10003494
764 Ga0265314_10035562
765 Ga0307405_10000834
766 Ga0307405_10009201
767 Ga0307405_10034902
768 Ga0307413_10001244
769 Ga0307413_10032114
770 Ga0307410_10049054
771 Ga0307410_10068143
772 Ga0307406_10057633
773 Ga0307406_10123350
774 Ga0307406_10152800
775 Ga0307407_10029994
776 Ga0307407_10043315
777 Ga0307407_10060889
778 Ga0307409_100010181
779 Ga0307409_100171757
780 Ga0307409_100190861
781 Ga0307416_100001472
782 Ga0307416_100021518
783 Ga0307416_100024851
784 Ga0307416_100090713
785 Ga0307416_100197031
786 Ga0307414_10060324
787 Ga0307414_10109925
788 Ga0307411_10004538
789 Ga0307411_10004842
790 Ga0307411_10007064
791 Ga0307411_10137014
792 Ga0307415_100001337
793 Ga0307415_100055539
794 Ga0307415_100192070
795 Ga0373926_0005693
796 Ga0373934_0003191
797 Ga0373934_0016465
798 Ga0373923_0001776
799 Ga0373936_0007529
800 Ga0373953_0000508
801 Ga0373954_0012056
802 Ga0373956_0003466
803 Ga0373956_0047357
804 Ga0373955_0009545
805 Ga0373931_0015459
806 Ga0373935_0001207
807 Ga0373927_0051421
808 Ga0373933_0000104
809 Ga0373933_0011000
810 Ga0373933_0013114
811 Ga0373947_0000102
812 Ga0373947_0082422
813 Ga0373937_0000161
814 Ga0373937_0016769
815 Ga0373925_0000385
816 Ga0373925_0051228
817 Ga0395900_0066440
818 Ga0395905_0012654
819 Ga0395905_0022348
820 Ga0395905_0205524
821 Ga0395901_0013649
822 Ga0436365_0215252
823 Ga0439462_0019381
824 Ga0451577_0000001
825 Ga0453684_0088795
826 Ga0466959_0075712
827 Ga0451576_0281398
828 Ga0451576_0488653
829 Ga0466967_0351830
830 Ga0495592_0001510
831 Ga0495603_0000774
832 Ga0495629_0011138
833 Ga0495629_0014859
834 Ga0495629_0029943
835 Ga0495651_0000077
836 Ga0495651_0001379
837 Ga0495653_0000153
838 Ga0495653_0016079
839 Ga0495580_0000048
840 Ga0495582_0000179
841 Ga0495582_0025920
842 Ga0495639_0000917
843 Ga0495639_0019437
844 Ga0495639_0066511
845 Ga0495664_0008013
846 Ga0495594_0008321
847 Ga0495594_0092301
848 Ga0495608_0001077
849 Ga0495618_0027889
850 Ga0495628_0000243
851 Ga0495628_0095338
852 Ga0495630_0004558
853 Ga0495630_0047953
854 Ga0495630_0104271
855 Ga0495630_0106763
856 Ga0495652_0002587
857 Ga0495652_0002951
858 Ga0495665_0000002
859 Ga0495665_0035879
860 Ga0495640_0084240
861 Ga0495586_0010326
862 Ga0495586_0012544
863 Ga0495587_0000452
864 Ga0495587_0003021
865 Ga0495645_0004021
866 Ga0495645_0004375
867 Ga0495645_0006938
868 Ga0495667_0001003
869 Ga0495667_0029094
870 Ga0495667_0081747
871 Ga0495634_0022470
872 Ga0495635_0000048
873 Ga0495588_0000464
874 Ga0495657_0001010
875 Ga0495599_0004988
876 Ga0495623_0000961
877 Ga0495623_0009437
878 Ga0495646_0008753
879 Ga0495658_0000017
880 Ga0495658_0017649
881 Ga0495658_0018274
882 Ga0495613_0048910
883 Ga0495600_0000158
884 Ga0495600_0040952
885 Ga0495581_0000312
886 Ga0495581_0024396
887 Ga0495604_0000017
888 Ga0495674_0004269
889 Ga0495674_0024914
890 Ga0495674_0206953
891 Ga0495674_0207982
892 Ga0495672_0003004
893 Ga0495675_0002210
894 Ga0495675_0032179
895 Ga0495684_0000118
896 Ga0495593_0000009
897 Ga0495602_0000891
898 Ga0495602_0029816
899 Ga0495614_0000005
900 Ga0496108_0079275
901 Ga0496110_0238995
902 Ga0496112_0011512
903 Ga0496112_0080000
904 Ga0496113_0007671
905 Ga0496113_0026825
906 Ga0501032_0046085
907 Ga0501033_0003020
908 Ga0501037_0027960
909 Ga0501047_0202464
910 Ga0501225_0010742
911 Ga0501234_006658
912 Ga0501035_0048901
913 Ga0501204_004116
914 nmdc:mga05p37_353186_c1
915 nmdc:mga05p37_58133_c1
916 nmdc:mga05p37_69400_c2
917 nmdc:mga09592_52114_c1
918 nmdc:mga0qj67_18360_c1
919 nmdc:mga06r32_26386_c1
920 nmdc:mga06r32_77445_c1
921 nmdc:mga08y16_186536_c1
922 nmdc:mga0n895_45213_c1
923 nmdc:mga0n895_57825_c1
924 nmdc:mga0a205_22387_c1
925 Ga0495601_0005535
926 Ga0495612_0002431
927 Ga0495595_0030623
928 Ga0495619_0002005

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01406

tRNA-synt_1e

tRNA synthetases class I (C) catalytic domain

34

340

0.96

PF23493

471

510

0.94

PF09190

DALR_2

DALR domain

372

427

0.93

PF00133

tRNA-synt_1

tRNA synthetases class I (I, L, M and V)

230

331

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1li7-assembly1.cif.gz_A crystal structure of cysteinyl-trna synthetase with cysteine substrate bound 0.9075 4 407
1li7-assembly2.cif.gz_B crystal structure of cysteinyl-trna synthetase with cysteine substrate bound 0.9065 4 410
3tqo-assembly1.cif.gz_A structure of the cysteinyl-trna synthetase (cyss) from coxiella burnetii. 0.905 1 407
1li5-assembly2.cif.gz_B crystal structure of cysteinyl-trna synthetase 0.9025 4 407
8qhp-assembly1.cif.gz_B cysteine trna ligase homodimer 0.9002 3 409
ID Description Score Start End Superfamily
1li7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9237 24 313 3.40.50.620
3sp1A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9226 3 313 3.40.50.620
3sp1A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9159 3 313 3.40.50.620
1li7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9042 24 313 3.40.50.620
af_A0A0G2JZH2_37_194_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8967 23 139 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A3N5XEF4-F1-model_v4 Cysteine--tRNA ligase 0.986 5 139 GO:0004817
GO:0005524
GO:0005829
GO:0006423
AF-J1F6D8-F1-model_v4 Cysteinyl-tRNA synthetase 0.9824 5 134 GO:0004817
GO:0005524
GO:0005829
GO:0006423
AF-A0A7X7A0U5-F1-model_v4 Class I tRNA ligase family protein 0.9804 5 140 GO:0004817
GO:0005524
GO:0005829
GO:0006423
AF-X1GQ62-F1-model_v4 tRNA synthetases class I catalytic domain-containing protein 0.9796 5 124 GO:0004817
GO:0005524
GO:0005737
GO:0006423
AF-A0A6V8EFV5-F1-model_v4 deleted 0.9777 3 149

Map