F449283

General Info

Members Datasets Scaffolds Average Seq Length
464 278 928 135

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10444490|Ga0105242_104444902
Length 153
Sequence LTPRAAARASDKVQGGSCVSYPISAIAGIGPATIARLKAIGIRTTAKLLEAAKSAKARKDLAQKLDVDEHVVLRWANLADRMRIKGVREPYAQLLQDAGVDTVKELKYRNPGRLAEAMSAANQKHKRVRLLPSERRVKAWIEAAKKLDQKIKY

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
152 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
153 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
159 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
160 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
169 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
181 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
182 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
183 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
184 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
185 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
186 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
187 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
217 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
244 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
245 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
254 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
255 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
256 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
257 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
267 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
268 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
269 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
270 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
271 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
272 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
273 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
274 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
275 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
276 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
277 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.68
Nodule 0
Rhizoplane 8.41
Rhizosphere 80.82
Stem 0
Stem Tuber 0
Unclassified 10.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10444490 3300009176 Bacteria 1220
2 JGI24752J21851_1032912 3300001976 Unclassified 686
3 JGI24743J22301_10015053 3300001991 Bacteria 1430
4 JGI24742J22300_10011438 3300002244 Bacteria 1473
5 JGI24751J29686_10005206 3300002459 Bacteria 2646
6 Ga0065712_10223759 3300005290 Bacteria 1024
7 Ga0070676_10466642 3300005328 Bacteria 891
8 Ga0070683_100312551 3300005329 Bacteria 1495
9 Ga0070690_100386298 3300005330 Bacteria 1024
10 Ga0070670_100093814 3300005331 Bacteria 2581
11 Ga0070677_10025237 3300005333 Bacteria 2217
12 Ga0070677_10453023 3300005333 Bacteria 687
13 Ga0068869_100057545 3300005334 Bacteria 2839
14 Ga0070666_11294945 3300005335 Unclassified 544
15 Ga0070682_100648699 3300005337 Bacteria 840
16 Ga0068868_100549321 3300005338 Bacteria 1018
17 Ga0068868_100764668 3300005338 Bacteria 869
18 Ga0068868_100784941 3300005338 Bacteria 858
19 Ga0070689_100134533 3300005340 Bacteria 1984
20 Ga0070689_100724583 3300005340 Bacteria 870
21 Ga0070687_100292947 3300005343 Bacteria 1029
22 Ga0070669_100216843 3300005353 Bacteria 1512
23 Ga0070669_100660540 3300005353 Bacteria 880
24 Ga0070675_100194336 3300005354 Bacteria 1759
25 Ga0070675_100219058 3300005354 Bacteria 1657
26 Ga0070675_100361479 3300005354 Bacteria 1289
27 Ga0070671_100134255 3300005355 Bacteria 2086
28 Ga0070671_100160157 3300005355 Bacteria 1902
29 Ga0070674_100008072 3300005356 Bacteria 6243
30 Ga0070674_100198301 3300005356 Bacteria 1548
31 Ga0070674_100601310 3300005356 Bacteria 929
32 Ga0070674_101212604 3300005356 Bacteria 670
33 Ga0070673_100053334 3300005364 Bacteria 3175
34 Ga0070673_100312698 3300005364 Bacteria 1386
35 Ga0070688_100738716 3300005365 Bacteria 765
36 Ga0070688_100914516 3300005365 Unclassified 693
37 Ga0070659_100185796 3300005366 Bacteria 1707
38 Ga0070659_101644192 3300005366 Unclassified 574
39 Ga0070667_101010415 3300005367 Bacteria 776
40 Ga0070714_100381957 3300005435 Unclassified 1328
41 Ga0070713_100028002 3300005436 Bacteria 4444
42 Ga0070713_101340416 3300005436 Bacteria 694
43 Ga0070713_101739689 3300005436 Bacteria 605
44 Ga0070710_10180556 3300005437 Bacteria 1321
45 Ga0070710_10332125 3300005437 Bacteria 1001
46 Ga0070701_10643863 3300005438 Unclassified 707
47 Ga0070711_100974866 3300005439 Bacteria 726
48 Ga0070711_101000310 3300005439 Unclassified 717
49 Ga0070705_100034297 3300005440 Bacteria 2836
50 Ga0070663_100565654 3300005455 Bacteria 952
51 Ga0070678_100179687 3300005456 Bacteria 1731
52 Ga0070678_100329928 3300005456 Bacteria 1305
53 Ga0070678_100434467 3300005456 Bacteria 1147
54 Ga0070662_100345372 3300005457 Bacteria 1218
55 Ga0068867_100423675 3300005459 Bacteria 1128
56 Ga0070685_10068755 3300005466 Bacteria 2093
57 Ga0070685_10096859 3300005466 Bacteria 1795
58 Ga0070685_10673015 3300005466 Unclassified 752
59 Ga0070685_11461382 3300005466 Unclassified 526
60 Ga0070672_100074332 3300005543 Bacteria 2711
61 Ga0070672_100443487 3300005543 Bacteria 1117
62 Ga0070672_100608718 3300005543 Bacteria 952
63 Ga0070686_100183202 3300005544 Bacteria 1489
64 Ga0070686_100411457 3300005544 Bacteria 1031
65 Ga0070696_100011065 3300005546 Bacteria 6039
66 Ga0070665_100712248 3300005548 Bacteria 1017
67 Ga0070704_100004754 3300005549 Bacteria 7859
68 Ga0068857_100122199 3300005577 Bacteria 2345
69 Ga0068857_101678567 3300005577 Unclassified 621
70 Ga0068852_100395767 3300005616 Bacteria 1358
71 Ga0068859_100174329 3300005617 Bacteria 2232
72 Ga0068864_100043967 3300005618 Bacteria 3826
73 Ga0068864_101471926 3300005618 Bacteria 684
74 Ga0068866_10679429 3300005718 Bacteria 704
75 Ga0068861_101167881 3300005719 Unclassified 743
76 Ga0068851_10562161 3300005834 Bacteria 690
77 Ga0068870_10119684 3300005840 Bacteria 1515
78 Ga0068863_100206907 3300005841 Bacteria 1889
79 Ga0068863_100303057 3300005841 Bacteria 1550
80 Ga0068858_100458655 3300005842 Bacteria 1229
81 Ga0068858_100490238 3300005842 Bacteria 1187
82 Ga0068860_100271338 3300005843 Bacteria 1656
83 Ga0068860_100607277 3300005843 Bacteria 1100
84 Ga0068862_100152912 3300005844 Bacteria 2055
85 Ga0068862_100777673 3300005844 Unclassified 933
86 Ga0081539_10000786 3300005985 Bacteria 61788
87 Ga0070717_10064978 3300006028 Bacteria 3032
88 Ga0070717_10305731 3300006028 Bacteria 1414
89 Ga0070717_10341026 3300006028 Bacteria 1338
90 Ga0075368_10155946 3300006042 Bacteria 955
91 Ga0075363_100011982 3300006048 Bacteria 4168
92 Ga0075364_10050038 3300006051 Bacteria 2727
93 Ga0070715_10820318 3300006163 Unclassified 566
94 Ga0070712_100470867 3300006175 Bacteria 1049
95 Ga0070712_100809489 3300006175 Bacteria 804
96 Ga0075362_10009047 3300006177 Bacteria 3834
97 Ga0075362_10034767 3300006177 Bacteria 2198
98 Ga0075367_10106634 3300006178 Bacteria 1717
99 Ga0075367_10588524 3300006178 Unclassified 707
100 Ga0075366_10039589 3300006195 Bacteria 2786
101 Ga0097621_100942580 3300006237 Bacteria 806
102 Ga0097621_101608697 3300006237 Bacteria 618
103 Ga0068871_100361660 3300006358 Bacteria 1285
104 Ga0075428_100918398 3300006844 Unclassified 928
105 Ga0075434_100210134 3300006871 Bacteria 1966
106 Ga0068865_100388558 3300006881 Unclassified 1140
107 Ga0068865_100414680 3300006881 Bacteria 1106
108 Ga0068865_101291151 3300006881 Bacteria 649
109 Ga0097620_100174353 3300006931 Bacteria 2232
110 Ga0105240_10300470 3300009093 Bacteria 1836
111 Ga0105245_10093515 3300009098 Bacteria 2770
112 Ga0105245_11216844 3300009098 Bacteria 801
113 Ga0105247_10071509 3300009101 Bacteria 2170
114 Ga0105247_10196347 3300009101 Bacteria 1353
115 Ga0105247_10218170 3300009101 Unclassified 1290
116 Ga0114129_10028305 3300009147 Bacteria 7939
117 Ga0105243_10648456 3300009148 Bacteria 1023
118 Ga0105241_10050238 3300009174 Bacteria 3178
119 Ga0105242_10030560 3300009176 Bacteria 4301
120 Ga0105242_10415562 3300009176 Bacteria 1259
121 Ga0105248_10101879 3300009177 Bacteria 3236
122 Ga0105248_10832579 3300009177 Bacteria 1041
123 Ga0105248_11564876 3300009177 Unclassified 747
124 Ga0105248_12885036 3300009177 Unclassified 548
125 Ga0105238_10023780 3300009551 Bacteria 6245
126 Ga0105238_10227291 3300009551 Bacteria 1843
127 Ga0105238_10568164 3300009551 Bacteria 1139
128 Ga0105249_10012459 3300009553 Bacteria 7496
129 Ga0105249_10328787 3300009553 Bacteria 1542
130 Ga0105249_12735723 3300009553 Unclassified 565
131 Ga0105246_10055482 3300011119 Bacteria 2734
132 Ga0105246_10100232 3300011119 Bacteria 2107
133 Ga0105246_10904322 3300011119 Bacteria 792
134 Ga0157378_10325639 3300013297 Bacteria 1494
135 Ga0157378_10368596 3300013297 Bacteria 1407
136 Ga0157378_10847911 3300013297 Bacteria 942
137 Ga0157378_12006436 3300013297 Unclassified 628
138 Ga0163162_10772643 3300013306 Bacteria 1079
139 Ga0163162_10811623 3300013306 Bacteria 1052
140 Ga0163162_10868159 3300013306 Bacteria 1017
141 Ga0163162_11131656 3300013306 Bacteria 887
142 Ga0157372_10897237 3300013307 Bacteria 1028
143 Ga0157375_10835018 3300013308 Bacteria 1069
144 Ga0163163_10091198 3300014325 Bacteria 3061
145 Ga0163163_10499003 3300014325 Bacteria 1279
146 Ga0163163_10623613 3300014325 Bacteria 1142
147 Ga0163163_10707690 3300014325 Bacteria 1071
148 Ga0157380_10151639 3300014326 Bacteria 2004
149 Ga0157380_10235364 3300014326 Bacteria 1648
150 Ga0157380_11705530 3300014326 Bacteria 688
151 Ga0157377_10338415 3300014745 Bacteria 1005
152 Ga0157377_10658877 3300014745 Bacteria 754
153 Ga0157379_10423080 3300014968 Bacteria 1227
154 Ga0157379_10647140 3300014968 Bacteria 989
155 Ga0163161_10126802 3300017792 Bacteria 1922
156 Ga0163161_11121350 3300017792 Bacteria 677
157 Ga0163161_11840466 3300017792 Bacteria 539
158 Ga0206356_11221351 3300020070 Unclassified 677
159 Ga0206353_11222383 3300020082 Bacteria 556
160 Ga0213876_10053061 3300021384 Bacteria 2142
161 Ga0213876_10112181 3300021384 Bacteria 1447
162 Ga0213876_10139942 3300021384 Bacteria 1287
163 Ga0209758_1000274 3300025297 Bacteria 102644
164 Ga0207426_1092849 3300025302 Bacteria 795
165 Ga0207697_10247110 3300025315 Bacteria 789
166 Ga0207682_10000608 3300025893 Bacteria 16646
167 Ga0207642_10284241 3300025899 Bacteria 953
168 Ga0207710_10013495 3300025900 Bacteria 3437
169 Ga0207688_10011818 3300025901 Bacteria 4751
170 Ga0207688_10112487 3300025901 Bacteria 1582
171 Ga0207647_10075928 3300025904 Bacteria 2022
172 Ga0207647_10344819 3300025904 Unclassified 844
173 Ga0207645_10051534 3300025907 Bacteria 2630
174 Ga0207645_10129689 3300025907 Bacteria 1641
175 Ga0207643_10203431 3300025908 Bacteria 1206
176 Ga0207654_10050246 3300025911 Bacteria 2395
177 Ga0207695_10374990 3300025913 Bacteria 1309
178 Ga0207693_10129463 3300025915 Bacteria 1984
179 Ga0207693_10257510 3300025915 Bacteria 1368
180 Ga0207663_11055283 3300025916 Unclassified 652
181 Ga0207662_10034448 3300025918 Bacteria 2955
182 Ga0207662_10076809 3300025918 Bacteria 2030
183 Ga0207662_10490081 3300025918 Bacteria 845
184 Ga0207652_10239793 3300025921 Bacteria 1634
185 Ga0207681_10175269 3300025923 Bacteria 1629
186 Ga0207681_10510457 3300025923 Bacteria 985
187 Ga0207694_10019087 3300025924 Bacteria 5182
188 Ga0207694_10179725 3300025924 Bacteria 1715
189 Ga0207650_10433496 3300025925 Bacteria 1092
190 Ga0207650_10786601 3300025925 Unclassified 806
191 Ga0207659_10098117 3300025926 Bacteria 2202
192 Ga0207659_10114543 3300025926 Bacteria 2055
193 Ga0207659_10356362 3300025926 Bacteria 1215
194 Ga0207659_10844210 3300025926 Bacteria 787
195 Ga0207687_10094307 3300025927 Bacteria 2190
196 Ga0207687_10240702 3300025927 Bacteria 1434
197 Ga0207700_10006218 3300025928 Bacteria 7199
198 Ga0207700_10577935 3300025928 Bacteria 999
199 Ga0207644_10437319 3300025931 Bacteria 1073
200 Ga0207644_10659247 3300025931 Bacteria 871
201 Ga0207706_10247375 3300025933 Bacteria 1558
202 Ga0207686_10012299 3300025934 Bacteria 4704
203 Ga0207686_10394418 3300025934 Bacteria 1053
204 Ga0207709_10076546 3300025935 Bacteria 2142
205 Ga0207709_10328563 3300025935 Bacteria 1147
206 Ga0207709_10471887 3300025935 Bacteria 974
207 Ga0207709_11117448 3300025935 Bacteria 647
208 Ga0207709_11373725 3300025935 Bacteria 585
209 Ga0207670_10194999 3300025936 Bacteria 1535
210 Ga0207669_10009927 3300025937 Bacteria 4559
211 Ga0207669_10230262 3300025937 Bacteria 1366
212 Ga0207669_10764568 3300025937 Bacteria 799
213 Ga0207704_10154826 3300025938 Bacteria 1623
214 Ga0207704_10297522 3300025938 Unclassified 1235
215 Ga0207704_10341373 3300025938 Bacteria 1163
216 Ga0207704_11092214 3300025938 Bacteria 678
217 Ga0207665_10203366 3300025939 Bacteria 1444
218 Ga0207665_10434751 3300025939 Bacteria 1005
219 Ga0207691_10014227 3300025940 Bacteria 7590
220 Ga0207711_10146610 3300025941 Bacteria 2127
221 Ga0207711_10349315 3300025941 Bacteria 1369
222 Ga0207689_10028965 3300025942 Bacteria 4629
223 Ga0207661_10119240 3300025944 Bacteria 2244
224 Ga0207679_11020118 3300025945 Bacteria 759
225 Ga0207651_10171950 3300025960 Bacteria 1709
226 Ga0207651_10750892 3300025960 Bacteria 862
227 Ga0207712_10040399 3300025961 Bacteria 3201
228 Ga0207712_10518849 3300025961 Bacteria 1021
229 Ga0207668_10400742 3300025972 Bacteria 1160
230 Ga0207658_10288311 3300025986 Bacteria 1410
231 Ga0207677_10504532 3300026023 Bacteria 1047
232 Ga0207677_10659196 3300026023 Bacteria 925
233 Ga0207677_10701445 3300026023 Bacteria 898
234 Ga0207677_10733200 3300026023 Bacteria 879
235 Ga0207703_10110528 3300026035 Bacteria 2345
236 Ga0207639_10082180 3300026041 Bacteria 2553
237 Ga0207708_10062275 3300026075 Bacteria 2850
238 Ga0207708_10548217 3300026075 Bacteria 975
239 Ga0207708_11027464 3300026075 Bacteria 717
240 Ga0207641_10079957 3300026088 Bacteria 2835
241 Ga0207641_10482499 3300026088 Bacteria 1202
242 Ga0207676_10010827 3300026095 Bacteria 6504
243 Ga0207676_10362351 3300026095 Bacteria 1344
244 Ga0207674_10135039 3300026116 Bacteria 2429
245 Ga0207674_10628272 3300026116 Unclassified 1037
246 Ga0207674_11118867 3300026116 Bacteria 757
247 Ga0207675_100240692 3300026118 Bacteria 1749
248 Ga0207675_100305362 3300026118 Bacteria 1551
249 Ga0207675_100562524 3300026118 Bacteria 1140
250 Ga0207675_101680527 3300026118 Bacteria 655
251 Ga0207683_10009855 3300026121 Bacteria 8149
252 Ga0207683_10018681 3300026121 Bacteria 5914
253 Ga0207683_10418073 3300026121 Bacteria 1234
254 Ga0207428_10010209 3300027907 Bacteria 8395
255 Ga0268266_10631121 3300028379 Bacteria 1030
256 Ga0268266_12381124 3300028379 Unclassified 500
257 Ga0268265_10297931 3300028380 Bacteria 1451
258 Ga0268265_10383592 3300028380 Bacteria 1294
259 Ga0268265_10907189 3300028380 Bacteria 866
260 Ga0268265_11123166 3300028380 Bacteria 781
261 Ga0268264_10183338 3300028381 Bacteria 1903
262 Ga0268264_10405790 3300028381 Bacteria 1311
263 Ga0265330_10026044 3300031235 Bacteria 2649
264 Ga0265325_10011613 3300031241 Bacteria 5058
265 Ga0265325_10272015 3300031241 Bacteria 761
266 Ga0265325_10321929 3300031241 Unclassified 687
267 Ga0265329_10024670 3300031242 Bacteria 1995
268 Ga0265339_10244728 3300031249 Bacteria 870
269 Ga0265339_10295870 3300031249 Bacteria 773
270 Ga0265316_10232260 3300031344 Bacteria 1358
271 Ga0307513_10581801 3300031456 Bacteria 830
272 Ga0307509_10668235 3300031507 Bacteria 707
273 Ga0265313_10077061 3300031595 Bacteria 1522
274 Ga0307508_10727432 3300031616 Unclassified 604
275 Ga0316579_10070149 3300031691 Bacteria 1659
276 Ga0265314_10007859 3300031711 Bacteria 9208
277 Ga0265342_10384306 3300031712 Unclassified 727
278 Ga0307406_10215282 3300031901 Bacteria 1424
279 Ga0307416_102382137 3300032002 Bacteria 629
280 Ga0316583_10000135 3300032133 Bacteria 17326
281 Ga0373948_0074198 3300034817 Bacteria 767
282 Ga0373949_0100792 3300035090 Bacteria 791
283 Ga0373949_0301496 3300035090 Bacteria 509
284 Ga0373923_0169135 3300035111 Bacteria 1000
285 Ga0373936_0153816 3300035113 Bacteria 998
286 Ga0373945_0151367 3300035116 Bacteria 941
287 Ga0373954_0294462 3300035118 Bacteria 800
288 Ga0373956_0341316 3300035119 Unclassified 714
289 Ga0373943_0032183 3300035170 Bacteria 2492
290 Ga0373943_0286923 3300035170 Bacteria 932
291 Ga0373946_0279347 3300035171 Bacteria 821
292 Ga0373942_0023706 3300035207 Bacteria 1569
293 Ga0373962_0083392 3300035242 Bacteria 974
294 Ga0373931_0109772 3300035691 Bacteria 1563
295 Ga0373931_1010770 3300035691 Unclassified 563
296 Ga0373935_0508264 3300035692 Bacteria 875
297 Ga0373927_0213130 3300035695 Bacteria 1269
298 Ga0373933_0169294 3300035724 Bacteria 1390
299 Ga0373947_0026478 3300035725 Bacteria 3390
300 Ga0373937_0334207 3300036401 Bacteria 1434
301 Ga0316582_0267708 3300036647 Bacteria 1172
302 Ga0373925_0071228 3300037068 Bacteria 2629
303 Ga0373925_0154634 3300037068 Bacteria 1803
304 Ga0436364_0159388 3300037853 Bacteria 1584
305 Ga0436364_0334659 3300037853 Bacteria 3192
306 Ga0436364_0468347 3300037853 Bacteria 1063
307 Ga0436365_0518881 3300039437 Bacteria 1018
308 Ga0436365_0630584 3300039437 Bacteria 2331
309 Ga0436365_0703801 3300039437 Bacteria 11672
310 Ga0436365_0804189 3300039437 Bacteria 819
311 Ga0436365_0923614 3300039437 Bacteria 8828
312 Ga0436365_1282913 3300039437 Bacteria 582
313 Ga0436365_1655356 3300039437 Bacteria 3839
314 Ga0436365_1802759 3300039437 Bacteria 1758
315 Ga0436360_0655213 3300039438 Unclassified 896
316 Ga0436360_0961864 3300039438 Bacteria 1349
317 Ga0436361_0018329 3300039447 Bacteria 1695
318 Ga0436361_0417787 3300039447 Bacteria 1087
319 Ga0436361_1065236 3300039447 Unclassified 594
320 Ga0436363_1128884 3300039450 Unclassified 613
321 Ga0436363_1166359 3300039450 Bacteria 1334
322 Ga0436362_0061978 3300039453 Bacteria 640
323 Ga0439453_0003109 3300041408 Bacteria 2356
324 Ga0451793_1358275 3300041452 Bacteria 686
325 Ga0439454_089030 3300042011 Unclassified 568
326 Ga0439456_041967 3300042013 Bacteria 992
327 Ga0495592_0059715 3300046454 Bacteria 2807
328 Ga0495603_0569191 3300046455 Bacteria 649
329 Ga0495629_1013803 3300046459 Bacteria 540
330 Ga0495651_0418646 3300046462 Bacteria 871
331 Ga0495653_0655172 3300046463 Unclassified 641
332 Ga0495580_0383691 3300046472 Unclassified 949
333 Ga0495582_0725280 3300046473 Bacteria 575
334 Ga0495605_0048474 3300046474 Bacteria 2079
335 Ga0495664_0072894 3300046477 Bacteria 2053
336 Ga0495628_0135637 3300046516 Bacteria 1881
337 Ga0495628_0228368 3300046516 Bacteria 1396
338 Ga0495628_0472517 3300046516 Bacteria 908
339 Ga0495630_0154643 3300046517 Bacteria 1746
340 Ga0495630_0175960 3300046517 Bacteria 1631
341 Ga0495643_0279125 3300046522 Bacteria 769
342 Ga0495652_0095799 3300046529 Bacteria 2418
343 Ga0495652_0105824 3300046529 Bacteria 2273
344 Ga0495665_0227282 3300046531 Bacteria 964
345 Ga0495640_0112127 3300046533 Bacteria 1781
346 Ga0495621_0034833 3300046539 Bacteria 1741
347 Ga0495668_0166626 3300046616 Bacteria 1207
348 Ga0495634_0797427 3300046642 Bacteria 539
349 Ga0495625_0373878 3300046660 Bacteria 896
350 Ga0495635_0297812 3300046663 Bacteria 1082
351 Ga0495623_0568181 3300046679 Unclassified 592
352 Ga0495646_0515282 3300046680 Bacteria 613
353 Ga0495658_0960757 3300046683 Bacteria 546
354 Ga0495613_0138773 3300046689 Bacteria 1738
355 Ga0495624_0113671 3300046690 Bacteria 1664
356 Ga0495600_0059844 3300046809 Bacteria 2488
357 Ga0495600_0271895 3300046809 Bacteria 1074
358 Ga0495604_0186042 3300047317 Bacteria 1450
359 Ga0495674_0053333 3300047319 Bacteria 3555
360 Ga0495674_0244775 3300047319 Bacteria 1477
361 Ga0495674_0350445 3300047319 Bacteria 1199
362 Ga0495680_0292851 3300047322 Bacteria 1145
363 Ga0495680_0385147 3300047322 Bacteria 971
364 Ga0495675_0210283 3300047444 Bacteria 1181
365 Ga0495684_0229469 3300047471 Bacteria 1358
366 Ga0495602_0279990 3300048088 Bacteria 1229
367 Ga0496100_0205910 3300048903 Bacteria 1436
368 Ga0496100_0462393 3300048903 Bacteria 974
369 Ga0496100_1338607 3300048903 Unclassified 565
370 Ga0496101_0025166 3300048904 Bacteria 4126
371 Ga0496102_0170667 3300048905 Bacteria 2048
372 Ga0496102_0431383 3300048905 Bacteria 1237
373 Ga0496104_0006600 3300048907 Bacteria 10204
374 Ga0496104_0006960 3300048907 Bacteria 9971
375 Ga0496104_0232020 3300048907 Bacteria 1757
376 Ga0496105_0008204 3300048908 Bacteria 8119
377 Ga0496105_0194998 3300048908 Bacteria 1655
378 Ga0496105_0795234 3300048908 Bacteria 719
379 Ga0496106_0022485 3300048909 Bacteria 4685
380 Ga0496106_0418956 3300048909 Bacteria 1076
381 Ga0496107_0057875 3300048910 Bacteria 2802
382 Ga0496107_0163365 3300048910 Bacteria 1651
383 Ga0496108_0170073 3300048911 Bacteria 1885
384 Ga0496108_1211622 3300048911 Bacteria 638
385 Ga0496109_0018604 3300048912 Bacteria 6104
386 Ga0496110_0008874 3300048913 Bacteria 8104
387 Ga0496110_0118245 3300048913 Bacteria 2387
388 Ga0496110_0610141 3300048913 Unclassified 989
389 Ga0496111_0159884 3300048914 Viruses 1672
390 Ga0496111_0335575 3300048914 Bacteria 1119
391 Ga0496112_0036361 3300048915 Bacteria 4804
392 Ga0496112_0175154 3300048915 Bacteria 2110
393 Ga0496112_0646589 3300048915 Bacteria 987
394 Ga0496112_1770441 3300048915 Unclassified 530
395 Ga0496113_0098502 3300048916 Bacteria 2263
396 Ga0496114_0008731 3300048917 Bacteria 8030
397 Ga0496114_0053519 3300048917 Bacteria 3365
398 Ga0496114_0193653 3300048917 Bacteria 1779
399 Ga0496114_0706150 3300048917 Bacteria 884
400 Ga0496114_0943013 3300048917 Unclassified 745
401 Ga0496115_0022194 3300048918 Bacteria 4914
402 Ga0496115_0223166 3300048918 Bacteria 1555
403 Ga0496115_0428601 3300048918 Unclassified 1071
404 Ga0496115_1161405 3300048918 Unclassified 582
405 Ga0501031_1117653 3300049568 Unclassified 503
406 Ga0501032_0139952 3300049569 Bacteria 1594
407 Ga0501034_0000850 3300049571 Bacteria 45243
408 Ga0501034_0023602 3300049571 Bacteria 6266
409 Ga0501036_0030054 3300049572 Bacteria 4589
410 Ga0501036_0676792 3300049572 Bacteria 853
411 Ga0501037_0074628 3300049573 Bacteria 2464
412 Ga0501043_0001850 3300049579 Bacteria 18123
413 Ga0501047_0000455 3300049581 Bacteria 45200
414 Ga0501048_0001113 3300049582 Bacteria 20168
415 Ga0501067_0636721 3300049583 Bacteria 598
416 Ga0501068_0194005 3300049584 Bacteria 1287
417 Ga0501069_0229279 3300049585 Bacteria 1081
418 Ga0501070_0017466 3300049586 Bacteria 6024
419 Ga0501071_0296742 3300049587 Bacteria 1225
420 Ga0501079_0221920 3300049741 Bacteria 1477
421 Ga0501080_0006633 3300049742 Bacteria 10411
422 Ga0501080_0034683 3300049742 Bacteria 4712
423 Ga0501083_0000437 3300049744 Bacteria 26753
424 Ga0501083_0143972 3300049744 Bacteria 1560
425 Ga0501035_0122087 3300049822 Bacteria 2277
426 Ga0501044_0015853 3300049823 Bacteria 8108
427 Ga0501044_0065969 3300049823 Bacteria 3691
428 nmdc:mga03683_273359_c1 3300050489 Bacteria 788
429 nmdc:mga03683_34742_c1 3300050489 Bacteria 2041
430 nmdc:mga03683_51522_c1 3300050489 Bacteria 1719
431 nmdc:mga03683_69857_c1 3300050489 Bacteria 1499
432 nmdc:mga03n38_179909_c1 3300050490 Bacteria 1083
433 nmdc:mga00v17_18285_c1 3300050491 Bacteria 3978
434 nmdc:mga0yw44_392612_c1 3300050492 Bacteria 937
435 nmdc:mga0k408_14806_c2 3300050493 Bacteria 2171
436 nmdc:mga0k408_27982_c1 3300050493 Bacteria 3204
437 nmdc:mga06z11_129494_c1 3300050494 Bacteria 1416
438 nmdc:mga06z11_302542_c1 3300050494 Bacteria 951
439 nmdc:mga07m45_864609_c1 3300050496 Unclassified 517
440 nmdc:mga05p37_1176884_c1 3300050507 Unclassified 795
441 nmdc:mga05p37_232541_c1 3300050507 Bacteria 2220
442 nmdc:mga0qj67_420094_c1 3300050509 Bacteria 1078
443 nmdc:mga08y16_110879_c1 3300050511 Bacteria 2857
444 nmdc:mga08y16_1192027_c1 3300050511 Bacteria 732
445 nmdc:mga08x19_341799_c1 3300050514 Unclassified 1044
446 nmdc:mga0sz30_272815_c1 3300050516 Bacteria 753
447 Ga0495601_0087291 3300053077 Bacteria 2005
448 Ga0495601_0128612 3300053077 Bacteria 1649
449 Ga0495601_0185317 3300053077 Bacteria 1360
450 Ga0495612_0009416 3300053078 Bacteria 3963
451 Ga0495612_0247028 3300053078 Unclassified 793
452 Ga0495655_0091262 3300053083 Bacteria 888
453 Ga0495595_0009338 3300053084 Bacteria 4054
454 Ga0495619_0090827 3300053085 Bacteria 2067
455 Ga0495619_0179601 3300053085 Bacteria 1464
456 Ga0500651_0258163 3300053093 Bacteria 1011
457 Ga0500595_082170 3300053119 Bacteria 941
458 Ga0500658_0044563 3300053134 Bacteria 1791
459 Ga0500568_0073764 3300053139 Bacteria 1303
460 Ga0500577_0164236 3300053142 Bacteria 947
461 Ga0500604_0007457 3300053151 Bacteria 2898
462 Ga0500616_0060374 3300053153 Bacteria 1966
463 Ga0500645_102700 3300053730 Bacteria 806
464 Ga0501082_0218692 3300060353 Bacteria 1657
465 Ga0105242_10444490
466 JGI24752J21851_1032912
467 JGI24743J22301_10015053
468 JGI24742J22300_10011438
469 JGI24751J29686_10005206
470 Ga0065712_10223759
471 Ga0070676_10466642
472 Ga0070683_100312551
473 Ga0070690_100386298
474 Ga0070670_100093814
475 Ga0070677_10025237
476 Ga0070677_10453023
477 Ga0068869_100057545
478 Ga0070666_11294945
479 Ga0070682_100648699
480 Ga0068868_100549321
481 Ga0068868_100764668
482 Ga0068868_100784941
483 Ga0070689_100134533
484 Ga0070689_100724583
485 Ga0070687_100292947
486 Ga0070669_100216843
487 Ga0070669_100660540
488 Ga0070675_100194336
489 Ga0070675_100219058
490 Ga0070675_100361479
491 Ga0070671_100134255
492 Ga0070671_100160157
493 Ga0070674_100008072
494 Ga0070674_100198301
495 Ga0070674_100601310
496 Ga0070674_101212604
497 Ga0070673_100053334
498 Ga0070673_100312698
499 Ga0070688_100738716
500 Ga0070688_100914516
501 Ga0070659_100185796
502 Ga0070659_101644192
503 Ga0070667_101010415
504 Ga0070714_100381957
505 Ga0070713_100028002
506 Ga0070713_101340416
507 Ga0070713_101739689
508 Ga0070710_10180556
509 Ga0070710_10332125
510 Ga0070701_10643863
511 Ga0070711_100974866
512 Ga0070711_101000310
513 Ga0070705_100034297
514 Ga0070663_100565654
515 Ga0070678_100179687
516 Ga0070678_100329928
517 Ga0070678_100434467
518 Ga0070662_100345372
519 Ga0068867_100423675
520 Ga0070685_10068755
521 Ga0070685_10096859
522 Ga0070685_10673015
523 Ga0070685_11461382
524 Ga0070672_100074332
525 Ga0070672_100443487
526 Ga0070672_100608718
527 Ga0070686_100183202
528 Ga0070686_100411457
529 Ga0070696_100011065
530 Ga0070665_100712248
531 Ga0070704_100004754
532 Ga0068857_100122199
533 Ga0068857_101678567
534 Ga0068852_100395767
535 Ga0068859_100174329
536 Ga0068864_100043967
537 Ga0068864_101471926
538 Ga0068866_10679429
539 Ga0068861_101167881
540 Ga0068851_10562161
541 Ga0068870_10119684
542 Ga0068863_100206907
543 Ga0068863_100303057
544 Ga0068858_100458655
545 Ga0068858_100490238
546 Ga0068860_100271338
547 Ga0068860_100607277
548 Ga0068862_100152912
549 Ga0068862_100777673
550 Ga0081539_10000786
551 Ga0070717_10064978
552 Ga0070717_10305731
553 Ga0070717_10341026
554 Ga0075368_10155946
555 Ga0075363_100011982
556 Ga0075364_10050038
557 Ga0070715_10820318
558 Ga0070712_100470867
559 Ga0070712_100809489
560 Ga0075362_10009047
561 Ga0075362_10034767
562 Ga0075367_10106634
563 Ga0075367_10588524
564 Ga0075366_10039589
565 Ga0097621_100942580
566 Ga0097621_101608697
567 Ga0068871_100361660
568 Ga0075428_100918398
569 Ga0075434_100210134
570 Ga0068865_100388558
571 Ga0068865_100414680
572 Ga0068865_101291151
573 Ga0097620_100174353
574 Ga0105240_10300470
575 Ga0105245_10093515
576 Ga0105245_11216844
577 Ga0105247_10071509
578 Ga0105247_10196347
579 Ga0105247_10218170
580 Ga0114129_10028305
581 Ga0105243_10648456
582 Ga0105241_10050238
583 Ga0105242_10030560
584 Ga0105242_10415562
585 Ga0105248_10101879
586 Ga0105248_10832579
587 Ga0105248_11564876
588 Ga0105248_12885036
589 Ga0105238_10023780
590 Ga0105238_10227291
591 Ga0105238_10568164
592 Ga0105249_10012459
593 Ga0105249_10328787
594 Ga0105249_12735723
595 Ga0105246_10055482
596 Ga0105246_10100232
597 Ga0105246_10904322
598 Ga0157378_10325639
599 Ga0157378_10368596
600 Ga0157378_10847911
601 Ga0157378_12006436
602 Ga0163162_10772643
603 Ga0163162_10811623
604 Ga0163162_10868159
605 Ga0163162_11131656
606 Ga0157372_10897237
607 Ga0157375_10835018
608 Ga0163163_10091198
609 Ga0163163_10499003
610 Ga0163163_10623613
611 Ga0163163_10707690
612 Ga0157380_10151639
613 Ga0157380_10235364
614 Ga0157380_11705530
615 Ga0157377_10338415
616 Ga0157377_10658877
617 Ga0157379_10423080
618 Ga0157379_10647140
619 Ga0163161_10126802
620 Ga0163161_11121350
621 Ga0163161_11840466
622 Ga0206356_11221351
623 Ga0206353_11222383
624 Ga0213876_10053061
625 Ga0213876_10112181
626 Ga0213876_10139942
627 Ga0209758_1000274
628 Ga0207426_1092849
629 Ga0207697_10247110
630 Ga0207682_10000608
631 Ga0207642_10284241
632 Ga0207710_10013495
633 Ga0207688_10011818
634 Ga0207688_10112487
635 Ga0207647_10075928
636 Ga0207647_10344819
637 Ga0207645_10051534
638 Ga0207645_10129689
639 Ga0207643_10203431
640 Ga0207654_10050246
641 Ga0207695_10374990
642 Ga0207693_10129463
643 Ga0207693_10257510
644 Ga0207663_11055283
645 Ga0207662_10034448
646 Ga0207662_10076809
647 Ga0207662_10490081
648 Ga0207652_10239793
649 Ga0207681_10175269
650 Ga0207681_10510457
651 Ga0207694_10019087
652 Ga0207694_10179725
653 Ga0207650_10433496
654 Ga0207650_10786601
655 Ga0207659_10098117
656 Ga0207659_10114543
657 Ga0207659_10356362
658 Ga0207659_10844210
659 Ga0207687_10094307
660 Ga0207687_10240702
661 Ga0207700_10006218
662 Ga0207700_10577935
663 Ga0207644_10437319
664 Ga0207644_10659247
665 Ga0207706_10247375
666 Ga0207686_10012299
667 Ga0207686_10394418
668 Ga0207709_10076546
669 Ga0207709_10328563
670 Ga0207709_10471887
671 Ga0207709_11117448
672 Ga0207709_11373725
673 Ga0207670_10194999
674 Ga0207669_10009927
675 Ga0207669_10230262
676 Ga0207669_10764568
677 Ga0207704_10154826
678 Ga0207704_10297522
679 Ga0207704_10341373
680 Ga0207704_11092214
681 Ga0207665_10203366
682 Ga0207665_10434751
683 Ga0207691_10014227
684 Ga0207711_10146610
685 Ga0207711_10349315
686 Ga0207689_10028965
687 Ga0207661_10119240
688 Ga0207679_11020118
689 Ga0207651_10171950
690 Ga0207651_10750892
691 Ga0207712_10040399
692 Ga0207712_10518849
693 Ga0207668_10400742
694 Ga0207658_10288311
695 Ga0207677_10504532
696 Ga0207677_10659196
697 Ga0207677_10701445
698 Ga0207677_10733200
699 Ga0207703_10110528
700 Ga0207639_10082180
701 Ga0207708_10062275
702 Ga0207708_10548217
703 Ga0207708_11027464
704 Ga0207641_10079957
705 Ga0207641_10482499
706 Ga0207676_10010827
707 Ga0207676_10362351
708 Ga0207674_10135039
709 Ga0207674_10628272
710 Ga0207674_11118867
711 Ga0207675_100240692
712 Ga0207675_100305362
713 Ga0207675_100562524
714 Ga0207675_101680527
715 Ga0207683_10009855
716 Ga0207683_10018681
717 Ga0207683_10418073
718 Ga0207428_10010209
719 Ga0268266_10631121
720 Ga0268266_12381124
721 Ga0268265_10297931
722 Ga0268265_10383592
723 Ga0268265_10907189
724 Ga0268265_11123166
725 Ga0268264_10183338
726 Ga0268264_10405790
727 Ga0265330_10026044
728 Ga0265325_10011613
729 Ga0265325_10272015
730 Ga0265325_10321929
731 Ga0265329_10024670
732 Ga0265339_10244728
733 Ga0265339_10295870
734 Ga0265316_10232260
735 Ga0307513_10581801
736 Ga0307509_10668235
737 Ga0265313_10077061
738 Ga0307508_10727432
739 Ga0316579_10070149
740 Ga0265314_10007859
741 Ga0265342_10384306
742 Ga0307406_10215282
743 Ga0307416_102382137
744 Ga0316583_10000135
745 Ga0373948_0074198
746 Ga0373949_0100792
747 Ga0373949_0301496
748 Ga0373923_0169135
749 Ga0373936_0153816
750 Ga0373945_0151367
751 Ga0373954_0294462
752 Ga0373956_0341316
753 Ga0373943_0032183
754 Ga0373943_0286923
755 Ga0373946_0279347
756 Ga0373942_0023706
757 Ga0373962_0083392
758 Ga0373931_0109772
759 Ga0373931_1010770
760 Ga0373935_0508264
761 Ga0373927_0213130
762 Ga0373933_0169294
763 Ga0373947_0026478
764 Ga0373937_0334207
765 Ga0316582_0267708
766 Ga0373925_0071228
767 Ga0373925_0154634
768 Ga0436364_0159388
769 Ga0436364_0334659
770 Ga0436364_0468347
771 Ga0436365_0518881
772 Ga0436365_0630584
773 Ga0436365_0703801
774 Ga0436365_0804189
775 Ga0436365_0923614
776 Ga0436365_1282913
777 Ga0436365_1655356
778 Ga0436365_1802759
779 Ga0436360_0655213
780 Ga0436360_0961864
781 Ga0436361_0018329
782 Ga0436361_0417787
783 Ga0436361_1065236
784 Ga0436363_1128884
785 Ga0436363_1166359
786 Ga0436362_0061978
787 Ga0439453_0003109
788 Ga0451793_1358275
789 Ga0439454_089030
790 Ga0439456_041967
791 Ga0495592_0059715
792 Ga0495603_0569191
793 Ga0495629_1013803
794 Ga0495651_0418646
795 Ga0495653_0655172
796 Ga0495580_0383691
797 Ga0495582_0725280
798 Ga0495605_0048474
799 Ga0495664_0072894
800 Ga0495628_0135637
801 Ga0495628_0228368
802 Ga0495628_0472517
803 Ga0495630_0154643
804 Ga0495630_0175960
805 Ga0495643_0279125
806 Ga0495652_0095799
807 Ga0495652_0105824
808 Ga0495665_0227282
809 Ga0495640_0112127
810 Ga0495621_0034833
811 Ga0495668_0166626
812 Ga0495634_0797427
813 Ga0495625_0373878
814 Ga0495635_0297812
815 Ga0495623_0568181
816 Ga0495646_0515282
817 Ga0495658_0960757
818 Ga0495613_0138773
819 Ga0495624_0113671
820 Ga0495600_0059844
821 Ga0495600_0271895
822 Ga0495604_0186042
823 Ga0495674_0053333
824 Ga0495674_0244775
825 Ga0495674_0350445
826 Ga0495680_0292851
827 Ga0495680_0385147
828 Ga0495675_0210283
829 Ga0495684_0229469
830 Ga0495602_0279990
831 Ga0496100_0205910
832 Ga0496100_0462393
833 Ga0496100_1338607
834 Ga0496101_0025166
835 Ga0496102_0170667
836 Ga0496102_0431383
837 Ga0496104_0006600
838 Ga0496104_0006960
839 Ga0496104_0232020
840 Ga0496105_0008204
841 Ga0496105_0194998
842 Ga0496105_0795234
843 Ga0496106_0022485
844 Ga0496106_0418956
845 Ga0496107_0057875
846 Ga0496107_0163365
847 Ga0496108_0170073
848 Ga0496108_1211622
849 Ga0496109_0018604
850 Ga0496110_0008874
851 Ga0496110_0118245
852 Ga0496110_0610141
853 Ga0496111_0159884
854 Ga0496111_0335575
855 Ga0496112_0036361
856 Ga0496112_0175154
857 Ga0496112_0646589
858 Ga0496112_1770441
859 Ga0496113_0098502
860 Ga0496114_0008731
861 Ga0496114_0053519
862 Ga0496114_0193653
863 Ga0496114_0706150
864 Ga0496114_0943013
865 Ga0496115_0022194
866 Ga0496115_0223166
867 Ga0496115_0428601
868 Ga0496115_1161405
869 Ga0501031_1117653
870 Ga0501032_0139952
871 Ga0501034_0000850
872 Ga0501034_0023602
873 Ga0501036_0030054
874 Ga0501036_0676792
875 Ga0501037_0074628
876 Ga0501043_0001850
877 Ga0501047_0000455
878 Ga0501048_0001113
879 Ga0501067_0636721
880 Ga0501068_0194005
881 Ga0501069_0229279
882 Ga0501070_0017466
883 Ga0501071_0296742
884 Ga0501079_0221920
885 Ga0501080_0006633
886 Ga0501080_0034683
887 Ga0501083_0000437
888 Ga0501083_0143972
889 Ga0501035_0122087
890 Ga0501044_0015853
891 Ga0501044_0065969
892 nmdc:mga03683_273359_c1
893 nmdc:mga03683_34742_c1
894 nmdc:mga03683_51522_c1
895 nmdc:mga03683_69857_c1
896 nmdc:mga03n38_179909_c1
897 nmdc:mga00v17_18285_c1
898 nmdc:mga0yw44_392612_c1
899 nmdc:mga0k408_14806_c2
900 nmdc:mga0k408_27982_c1
901 nmdc:mga06z11_129494_c1
902 nmdc:mga06z11_302542_c1
903 nmdc:mga07m45_864609_c1
904 nmdc:mga05p37_1176884_c1
905 nmdc:mga05p37_232541_c1
906 nmdc:mga0qj67_420094_c1
907 nmdc:mga08y16_110879_c1
908 nmdc:mga08y16_1192027_c1
909 nmdc:mga08x19_341799_c1
910 nmdc:mga0sz30_272815_c1
911 Ga0495601_0087291
912 Ga0495601_0128612
913 Ga0495601_0185317
914 Ga0495612_0009416
915 Ga0495612_0247028
916 Ga0495655_0091262
917 Ga0495595_0009338
918 Ga0495619_0090827
919 Ga0495619_0179601
920 Ga0500651_0258163
921 Ga0500595_082170
922 Ga0500658_0044563
923 Ga0500568_0073764
924 Ga0500577_0164236
925 Ga0500604_0007457
926 Ga0500616_0060374
927 Ga0500645_102700
928 Ga0501082_0218692

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14229

DUF4332

Domain of unknown function (DUF4332)

27

147

0.98

PF14520

HHH_5

Helix-hairpin-helix domain

22

76

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bke-assembly1.cif.gz_A conformational flexibility revealed by the crystal structure of a crenarchaeal rada 0.905 62 127
2zud-assembly1.cif.gz_B crystal structure of left-handed rada filament 0.8776 63 127
2zud-assembly1.cif.gz_A crystal structure of left-handed rada filament 0.8724 66 127
3etl-assembly1.cif.gz_A rada recombinase from methanococcus maripaludis in complex with amppnp 0.8644 64 127
3ewa-assembly1.cif.gz_A rada recombinase from methanococcus maripaludis in complex with amppnp and ammonium ions 0.8641 64 127
ID Description Score Start End Superfamily
2bkeA01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.906 75 127 1.10.150.20
2va8B04 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.8756 60 129 1.10.150.20
2zudA01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.8724 66 127 1.10.150.20
3ew9A01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.8591 64 127 1.10.150.20
2jzbB01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.8564 62 127 1.10.150.20
ID Description Score Start End GO Terms
AF-A0A832U642-F1-model_v4 DUF4332 domain-containing protein 0.9811 24 135 GO:0000166
AF-A0A7X8WKC3-F1-model_v4 DUF4332 domain-containing protein 0.9787 48 135
AF-A0A7C4PDY0-F1-model_v4 DUF4332 domain-containing protein 0.9778 1 135 GO:0006355
GO:0016020
AF-A0A7Y1UJS3-F1-model_v4 DUF4332 domain-containing protein 0.9768 63 127 GO:0016020
AF-A0A3B9KI73-F1-model_v4 DUF4332 domain-containing protein 0.9759 59 127

Map