F449192

General Info

Members Datasets Scaffolds Average Seq Length
463 305 926 227

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0079601|Ga0501032_0079601_367_1206
Length 269
Sequence VAGPGGALSVTGRRTPPVPRTGTSPEVTVPHDTALPASWQPVLGAELDKPYFARLTEFVEAERAAGPVYPPREEVFAALEATPFDRVRVLVLGQDPYHGPGQGHGLCFSVRPGVKVPPSLRNIFRELKDEYDLPVPDNGYLMPWAEQGVLLLNAVLTVREGEANSHKGKGWETFTDAVIRAVSDRPDPAVFVLWGNYAKKKLPLIDTTRHAVVSGAHPSPLSARLFLGSKPFSRIDTALKEQGHEPIDWRLPDLGPVPAPAAAASGAPA

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
114 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
115 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
116 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
127 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
137 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
138 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
139 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
165 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
180 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
188 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
189 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
199 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
200 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
201 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
202 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
233 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
250 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
251 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
252 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
253 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
254 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
255 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
256 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
257 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
258 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
259 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
260 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
261 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
264 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
267 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
269 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
270 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
271 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
272 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
273 2643221670 Streptomyces sp. Root431 Isolate Unclassified
274 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
275 2643221732 Bacillus sp. Root239 Isolate Unclassified
276 2808606448 Streptomyces sp. 193411 Isolate Unclassified
277 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
278 2862574272 Streptomyces sp. AcE210 Isolate Nodule
279 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
280 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
281 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
282 2867369537 Streptomyces sp. Z26 Isolate Unclassified
283 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
284 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
285 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
286 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
287 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
288 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
289 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
290 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
291 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
292 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
293 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
294 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
295 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
296 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
297 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
298 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
299 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
300 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
301 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
302 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
303 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
304 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
305 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.01
Metatranscriptomes 0
Isolates 7.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.4
Nodule 0.43
Rhizoplane 1.51
Rhizosphere 85.53
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0079601 3300049569 Bacteria 2181
2 JGI25159J45721_1002398 3300002987 Bacteria 7139
3 JGI25151J46595_10021609 3300003187 Bacteria 2688
4 JGI25151J46595_10034016 3300003187 Bacteria 1954
5 JGI25151J46595_10058440 3300003187 Bacteria 1249
6 JGI25406J46586_10008572 3300003203 Bacteria 4619
7 rootL2_10350170 3300003322 Bacteria 1463
8 rootH1_10280006 3300003323 Bacteria 2311
9 Ga0070683_100013313 3300005329 Bacteria 7171
10 Ga0070683_100268060 3300005329 Bacteria 1624
11 Ga0068869_100001362 3300005334 Bacteria 14490
12 Ga0068869_100010801 3300005334 Bacteria 5968
13 Ga0068869_100330186 3300005334 Bacteria 1239
14 Ga0070666_10416740 3300005335 Bacteria 967
15 Ga0070680_100303095 3300005336 Bacteria 1355
16 Ga0068868_100001501 3300005338 Bacteria 16076
17 Ga0070660_100016597 3300005339 Bacteria 5348
18 Ga0070660_100022636 3300005339 Bacteria 4650
19 Ga0070689_100006501 3300005340 Bacteria 8100
20 Ga0070689_100406133 3300005340 Bacteria 1152
21 Ga0070661_100034710 3300005344 Bacteria 3659
22 Ga0070692_10002178 3300005345 Bacteria 7502
23 Ga0070692_10028840 3300005345 Bacteria 2762
24 Ga0070668_100409514 3300005347 Bacteria 1159
25 Ga0070669_100045389 3300005353 Bacteria 3202
26 Ga0070669_100148659 3300005353 Bacteria 1812
27 Ga0070675_100000671 3300005354 Bacteria 23731
28 Ga0070675_100003575 3300005354 Bacteria 11817
29 Ga0070659_100011176 3300005366 Bacteria 6634
30 Ga0070659_100037057 3300005366 Bacteria 3802
31 Ga0070667_100410840 3300005367 Bacteria 1233
32 Ga0070714_100018059 3300005435 Bacteria 5721
33 Ga0070714_100762024 3300005435 Bacteria 936
34 Ga0070701_10389813 3300005438 Bacteria 880
35 Ga0070700_100012862 3300005441 Bacteria 4688
36 Ga0070700_100370945 3300005441 Bacteria 1067
37 Ga0070663_100011316 3300005455 Bacteria 5596
38 Ga0070663_100041654 3300005455 Bacteria 3223
39 Ga0070663_100298248 3300005455 Bacteria 1289
40 Ga0070662_100002758 3300005457 Bacteria 10864
41 Ga0070662_100013857 3300005457 Bacteria 5371
42 Ga0070681_10256108 3300005458 Bacteria 1662
43 Ga0070681_10348083 3300005458 Bacteria 1392
44 Ga0070685_10001546 3300005466 Bacteria 12133
45 Ga0070685_10315335 3300005466 Bacteria 1058
46 Ga0070706_100009116 3300005467 Bacteria 9241
47 Ga0070684_100003933 3300005535 Bacteria 11252
48 Ga0070684_100021820 3300005535 Bacteria 5333
49 Ga0070684_100105786 3300005535 Bacteria 2518
50 Ga0068853_100390431 3300005539 Bacteria 1301
51 Ga0070686_100165276 3300005544 Bacteria 1561
52 Ga0070665_100031294 3300005548 Bacteria 5355
53 Ga0070665_100119478 3300005548 Bacteria 2638
54 Ga0068855_100102846 3300005563 Bacteria 3288
55 Ga0068855_100310545 3300005563 Bacteria 1745
56 Ga0068855_100608371 3300005563 Bacteria 1178
57 Ga0070664_100000074 3300005564 Bacteria 63200
58 Ga0070664_100007375 3300005564 Bacteria 8871
59 Ga0070664_100021754 3300005564 Bacteria 5289
60 Ga0068857_100023395 3300005577 Bacteria 5439
61 Ga0068857_100388363 3300005577 Bacteria 1297
62 Ga0068854_100003862 3300005578 Bacteria 9391
63 Ga0068854_100074505 3300005578 Bacteria 2490
64 Ga0068856_100152680 3300005614 Bacteria 2319
65 Ga0068856_100278703 3300005614 Bacteria 1689
66 Ga0068856_100811947 3300005614 Bacteria 955
67 Ga0070702_100046413 3300005615 Bacteria 2462
68 Ga0070702_100193140 3300005615 Bacteria 1341
69 Ga0068861_100053563 3300005719 Bacteria 3070
70 Ga0068861_100081461 3300005719 Bacteria 2534
71 Ga0068870_10077967 3300005840 Bacteria 1824
72 Ga0068863_100200477 3300005841 Bacteria 1920
73 Ga0068860_100168322 3300005843 Bacteria 2116
74 Ga0068862_100028386 3300005844 Bacteria 4712
75 Ga0081539_10000109 3300005985 Bacteria 193696
76 Ga0070717_10164243 3300006028 Bacteria 1928
77 Ga0070717_10312866 3300006028 Bacteria 1398
78 Ga0075364_10142490 3300006051 Bacteria 1613
79 Ga0075428_100187737 3300006844 Bacteria 2236
80 Ga0075430_100076528 3300006846 Bacteria 2805
81 Ga0075430_100451629 3300006846 Bacteria 1061
82 Ga0075431_100257434 3300006847 Bacteria 1772
83 Ga0075431_100258274 3300006847 Bacteria 1768
84 Ga0075429_100009014 3300006880 Bacteria 8669
85 Ga0105251_10043291 3300009011 Bacteria 2181
86 Ga0105244_10147759 3300009036 Bacteria 1127
87 Ga0105240_10014680 3300009093 Bacteria 10688
88 Ga0105240_10102534 3300009093 Bacteria 3477
89 Ga0111539_10011084 3300009094 Bacteria 11343
90 Ga0111539_10689308 3300009094 Bacteria 1189
91 Ga0105245_10015622 3300009098 Bacteria 6621
92 Ga0114129_10040225 3300009147 Bacteria 6590
93 Ga0105243_10548073 3300009148 Bacteria 1105
94 Ga0105241_10006695 3300009174 Bacteria 8478
95 Ga0105241_10459524 3300009174 Bacteria 1128
96 Ga0105248_10552542 3300009177 Bacteria 1299
97 Ga0105237_10264699 3300009545 Bacteria 1722
98 Ga0105237_11186012 3300009545 Bacteria 770
99 Ga0105238_10000019 3300009551 Bacteria 212662
100 Ga0105238_10003550 3300009551 Bacteria 15549
101 Ga0105238_10688211 3300009551 Bacteria 1034
102 Ga0105238_11037808 3300009551 Bacteria 841
103 Ga0105249_10034934 3300009553 Bacteria 4557
104 Ga0105249_10118619 3300009553 Bacteria 2511
105 Ga0105249_10550780 3300009553 Bacteria 1204
106 Ga0105239_10043912 3300010375 Bacteria 4901
107 Ga0105239_10248278 3300010375 Bacteria 1999
108 Ga0105246_10081472 3300011119 Bacteria 2307
109 Ga0157370_10015326 3300013104 Bacteria 7797
110 Ga0157370_10032293 3300013104 Bacteria 5113
111 Ga0157369_10060148 3300013105 Bacteria 4097
112 Ga0157369_10093266 3300013105 Bacteria 3214
113 Ga0157374_10018677 3300013296 Bacteria 6123
114 Ga0157372_10288309 3300013307 Bacteria 1909
115 Ga0163163_10233510 3300014325 Bacteria 1889
116 Ga0157380_10805116 3300014326 Bacteria 957
117 Ga0157380_10920013 3300014326 Bacteria 902
118 Ga0157377_10000588 3300014745 Bacteria 15132
119 Ga0157377_10012149 3300014745 Bacteria 4322
120 Ga0213876_10003480 3300021384 Bacteria 8998
121 Ga0213875_10065528 3300021388 Bacteria 1698
122 Ga0209025_1004635 3300025294 Bacteria 11762
123 Ga0209025_1008218 3300025294 Bacteria 7547
124 Ga0207647_10015116 3300025904 Bacteria 5303
125 Ga0207645_10189017 3300025907 Bacteria 1353
126 Ga0207684_10066281 3300025910 Bacteria 3067
127 Ga0207654_10048821 3300025911 Bacteria 2424
128 Ga0207695_10000104 3300025913 Bacteria 257201
129 Ga0207695_10006639 3300025913 Bacteria 14938
130 Ga0207671_10000170 3300025914 Bacteria 99729
131 Ga0207660_10268588 3300025917 Bacteria 1351
132 Ga0207649_10028154 3300025920 Bacteria 3307
133 Ga0207681_10032542 3300025923 Bacteria 3415
134 Ga0207694_10000032 3300025924 Bacteria 212686
135 Ga0207694_10017291 3300025924 Bacteria 5451
136 Ga0207659_10002042 3300025926 Bacteria 11983
137 Ga0207687_10014954 3300025927 Bacteria 5082
138 Ga0207664_10160082 3300025929 Bacteria 1919
139 Ga0207664_10391174 3300025929 Bacteria 1235
140 Ga0207664_10441350 3300025929 Bacteria 1161
141 Ga0207690_10020144 3300025932 Bacteria 4117
142 Ga0207706_10003416 3300025933 Bacteria 15163
143 Ga0207706_10018248 3300025933 Bacteria 6313
144 Ga0207670_10006839 3300025936 Bacteria 6345
145 Ga0207669_10396105 3300025937 Bacteria 1080
146 Ga0207665_10226959 3300025939 Bacteria 1371
147 Ga0207711_10530355 3300025941 Bacteria 1098
148 Ga0207689_10017301 3300025942 Bacteria 6101
149 Ga0207689_10213554 3300025942 Bacteria 1594
150 Ga0207661_10016507 3300025944 Bacteria 5449
151 Ga0207661_10019881 3300025944 Bacteria 5011
152 Ga0207661_10233435 3300025944 Bacteria 1630
153 Ga0207679_10000952 3300025945 Bacteria 18567
154 Ga0207679_10056753 3300025945 Bacteria 2893
155 Ga0207667_10181720 3300025949 Bacteria 2160
156 Ga0207667_10193175 3300025949 Bacteria 2088
157 Ga0207712_10150785 3300025961 Bacteria 1795
158 Ga0207712_10428607 3300025961 Bacteria 1117
159 Ga0207668_10287594 3300025972 Bacteria 1351
160 Ga0207640_10059424 3300025981 Bacteria 2523
161 Ga0207640_10120645 3300025981 Bacteria 1877
162 Ga0207677_10009311 3300026023 Bacteria 5524
163 Ga0207678_10021392 3300026067 Bacteria 5672
164 Ga0207708_10016872 3300026075 Bacteria 5498
165 Ga0207708_10425159 3300026075 Bacteria 1102
166 Ga0207702_10603226 3300026078 Bacteria 1077
167 Ga0207641_10348174 3300026088 Bacteria 1411
168 Ga0207676_10030925 3300026095 Bacteria 4023
169 Ga0207675_100111599 3300026118 Bacteria 2580
170 Ga0207675_100138065 3300026118 Bacteria 2314
171 Ga0207675_100820803 3300026118 Bacteria 944
172 Ga0207698_10146985 3300026142 Bacteria 2040
173 Ga0207428_10012670 3300027907 Bacteria 7395
174 Ga0268266_10178677 3300028379 Bacteria 1931
175 Ga0268266_10477211 3300028379 Bacteria 1188
176 Ga0268265_10469246 3300028380 Bacteria 1179
177 Ga0268264_10065714 3300028381 Bacteria 3057
178 Ga0307517_10004517 3300028786 Bacteria 21354
179 Ga0307511_10174949 3300030521 Bacteria 1170
180 Ga0307514_10017466 3300031649 Bacteria 5899
181 Ga0307516_10004944 3300031730 Bacteria 16203
182 Ga0307516_10049362 3300031730 Bacteria 4136
183 Ga0307405_10000946 3300031731 Bacteria 11604
184 Ga0307405_10354535 3300031731 Bacteria 1133
185 Ga0307413_10010995 3300031824 Bacteria 4424
186 Ga0307410_10015665 3300031852 Bacteria 4504
187 Ga0307406_10048047 3300031901 Bacteria 2693
188 Ga0307406_10073861 3300031901 Bacteria 2244
189 Ga0307406_10321108 3300031901 Bacteria 1198
190 Ga0307407_10431274 3300031903 Bacteria 952
191 Ga0307409_100000109 3300031995 Bacteria 30137
192 Ga0307409_100182547 3300031995 Bacteria 1859
193 Ga0307416_100000122 3300032002 Bacteria 46669
194 Ga0307416_101207664 3300032002 Bacteria 862
195 Ga0307411_10327286 3300032005 Bacteria 1240
196 Ga0307415_100000011 3300032126 Bacteria 84750
197 Ga0307415_100004974 3300032126 Bacteria 6993
198 Ga0307415_100083607 3300032126 Bacteria 2288
199 Ga0307415_100244362 3300032126 Bacteria 1454
200 Ga0307415_100390760 3300032126 Bacteria 1184
201 Ga0307415_100598759 3300032126 Bacteria 981
202 Ga0307507_10000998 3300033179 Bacteria 62959
203 Ga0307510_10011560 3300033180 Bacteria 10477
204 Ga0395899_0032903 3300037312 Bacteria 3896
205 Ga0395900_0018166 3300037418 Bacteria 7174
206 Ga0395900_0082415 3300037418 Bacteria 3305
207 Ga0395898_0011347 3300037466 Bacteria 9257
208 Ga0395905_0033630 3300037471 Bacteria 4814
209 Ga0436364_1050672 3300037853 Bacteria 3248
210 Ga0395901_0018692 3300038443 Bacteria 7078
211 Ga0395901_0038863 3300038443 Bacteria 4922
212 Ga0436365_0756511 3300039437 Bacteria 1496
213 Ga0436361_0017532 3300039447 Bacteria 881
214 Ga0451807_2756517 3300041486 Bacteria 1034
215 Ga0451837_1084771 3300041494 Bacteria 3568
216 Ga0451845_0591611 3300041501 Bacteria 1025
217 Ga0451849_0783382 3300041505 Bacteria 1524
218 Ga0466969_0003825 3300044656 Bacteria 7996
219 Ga0466969_0010124 3300044656 Bacteria 5001
220 Ga0466969_0013148 3300044656 Bacteria 4361
221 Ga0466966_0013030 3300044684 Bacteria 5505
222 Ga0466966_0022338 3300044684 Bacteria 4152
223 Ga0466961_0001882 3300044693 Bacteria 13050
224 Ga0466961_0003838 3300044693 Bacteria 9403
225 Ga0466961_0018621 3300044693 Bacteria 4467
226 Ga0466961_0219093 3300044693 Bacteria 1173
227 Ga0466971_0006305 3300044719 Bacteria 5149
228 Ga0466971_0017482 3300044719 Bacteria 3173
229 Ga0466971_0265695 3300044719 Bacteria 819
230 Ga0466968_0329215 3300044735 Bacteria 739
231 Ga0466970_0005991 3300044765 Bacteria 6058
232 Ga0466960_0153136 3300044901 Bacteria 1233
233 Ga0466959_0002121 3300045049 Bacteria 12550
234 Ga0466959_0017334 3300045049 Bacteria 5277
235 Ga0466959_0040673 3300045049 Bacteria 3433
236 Ga0466959_0065286 3300045049 Bacteria 2641
237 Ga0466959_0374209 3300045049 Bacteria 970
238 Ga0466958_0077602 3300045836 Bacteria 2040
239 Ga0466958_0397644 3300045836 Bacteria 889
240 Ga0466967_0376456 3300045976 Bacteria 1378
241 Ga0495592_0015082 3300046454 Bacteria 5869
242 Ga0495592_0021376 3300046454 Bacteria 4920
243 Ga0495603_0001771 3300046455 Bacteria 12728
244 Ga0495629_0006678 3300046459 Bacteria 8540
245 Ga0495629_0151302 3300046459 Bacteria 1613
246 Ga0495629_0184440 3300046459 Bacteria 1445
247 Ga0495629_0505659 3300046459 Bacteria 814
248 Ga0495638_0046953 3300046460 Bacteria 2710
249 Ga0495651_0002359 3300046462 Bacteria 14583
250 Ga0495651_0004965 3300046462 Bacteria 10161
251 Ga0495653_0032988 3300046463 Bacteria 4106
252 Ga0495580_0007819 3300046472 Bacteria 8559
253 Ga0495662_0177188 3300046476 Bacteria 1051
254 Ga0495664_0044223 3300046477 Bacteria 2639
255 Ga0495585_0066650 3300046492 Bacteria 1971
256 Ga0495594_0082522 3300046499 Bacteria 1796
257 Ga0495594_0122646 3300046499 Bacteria 1469
258 Ga0495594_0141767 3300046499 Bacteria 1363
259 Ga0495608_0004466 3300046511 Bacteria 9999
260 Ga0495608_0010407 3300046511 Bacteria 6493
261 Ga0495628_0012375 3300046516 Bacteria 7195
262 Ga0495628_0035716 3300046516 Bacteria 3992
263 Ga0495630_0029476 3300046517 Bacteria 4080
264 Ga0495631_0163662 3300046518 Bacteria 954
265 Ga0495632_0097892 3300046519 Bacteria 1384
266 Ga0495643_0004558 3300046522 Bacteria 9651
267 Ga0495666_0000897 3300046526 Bacteria 13958
268 Ga0495652_0003381 3300046529 Bacteria 15788
269 Ga0495652_0015130 3300046529 Bacteria 6910
270 Ga0495652_0233161 3300046529 Bacteria 1375
271 Ga0495665_0001618 3300046531 Bacteria 12046
272 Ga0495640_0014857 3300046533 Bacteria 5874
273 Ga0495640_0074288 3300046533 Bacteria 2274
274 Ga0495609_0144138 3300046538 Bacteria 1015
275 Ga0495645_0003091 3300046543 Bacteria 11272
276 Ga0495645_0109225 3300046543 Bacteria 1958
277 Ga0495645_0221196 3300046543 Bacteria 1273
278 Ga0495622_0094126 3300046557 Bacteria 1375
279 Ga0495622_0138665 3300046557 Bacteria 1105
280 Ga0495667_0000787 3300046559 Bacteria 20365
281 Ga0495667_0500904 3300046559 Bacteria 761
282 Ga0495668_0244699 3300046616 Bacteria 982
283 Ga0495634_0003641 3300046642 Bacteria 12294
284 Ga0495634_0393528 3300046642 Bacteria 824
285 Ga0495611_0032945 3300046648 Bacteria 2285
286 Ga0495635_0036513 3300046663 Bacteria 3405
287 Ga0495659_0073535 3300046664 Bacteria 1285
288 Ga0495661_0127314 3300046665 Bacteria 1400
289 Ga0495599_0032735 3300046678 Bacteria 3263
290 Ga0495623_0035992 3300046679 Bacteria 3172
291 Ga0495646_0004812 3300046680 Bacteria 8526
292 Ga0495658_0040174 3300046683 Bacteria 2600
293 Ga0495613_0003683 3300046689 Bacteria 11487
294 Ga0495613_0012021 3300046689 Bacteria 6433
295 Ga0495613_0013099 3300046689 Bacteria 6162
296 Ga0495624_0019056 3300046690 Bacteria 4584
297 Ga0495670_0031574 3300046691 Bacteria 2633
298 Ga0495671_0322670 3300046692 Bacteria 742
299 Ga0495589_0003099 3300046794 Bacteria 9098
300 Ga0495600_0256036 3300046809 Bacteria 1112
301 Ga0495600_0309814 3300046809 Bacteria 994
302 Ga0495660_0061488 3300046810 Bacteria 2015
303 Ga0495581_0005335 3300047315 Bacteria 7433
304 Ga0495581_0445533 3300047315 Bacteria 754
305 Ga0495604_0000800 3300047317 Bacteria 26453
306 Ga0495604_0004211 3300047317 Bacteria 11389
307 Ga0495604_0116924 3300047317 Bacteria 1935
308 Ga0495604_0206290 3300047317 Bacteria 1360
309 Ga0495604_0379417 3300047317 Bacteria 934
310 Ga0495674_0014172 3300047319 Bacteria 7468
311 Ga0495676_0019113 3300047321 Bacteria 6031
312 Ga0495676_0032283 3300047321 Bacteria 4421
313 Ga0495676_0045788 3300047321 Bacteria 3557
314 Ga0495687_021439 3300047443 Bacteria 3125
315 Ga0495675_0017959 3300047444 Bacteria 4485
316 Ga0495675_0263342 3300047444 Bacteria 1032
317 Ga0495679_028451 3300047446 Bacteria 1834
318 Ga0495685_000298 3300047447 Bacteria 16313
319 Ga0495685_031947 3300047447 Bacteria 1809
320 Ga0495681_0004865 3300047470 Bacteria 9080
321 Ga0495686_0087889 3300047472 Bacteria 1890
322 Ga0495593_0016240 3300047673 Bacteria 4202
323 Ga0495602_0069910 3300048088 Bacteria 3007
324 Ga0495614_0000501 3300048089 Bacteria 15996
325 Ga0496105_0030679 3300048908 Bacteria 4405
326 Ga0496108_0146764 3300048911 Bacteria 2034
327 Ga0496108_0466080 3300048911 Bacteria 1104
328 Ga0496112_0030728 3300048915 Bacteria 5202
329 Ga0496112_0045666 3300048915 Bacteria 4294
330 Ga0496115_0190829 3300048918 Bacteria 1693
331 Ga0501031_0012385 3300049568 Bacteria 5561
332 Ga0501031_0104840 3300049568 Bacteria 1845
333 Ga0501032_0004249 3300049569 Bacteria 10821
334 Ga0501032_0048086 3300049569 Bacteria 2880
335 Ga0501032_0068952 3300049569 Bacteria 2360
336 Ga0501033_0011270 3300049570 Bacteria 6843
337 Ga0501033_0013836 3300049570 Bacteria 6139
338 Ga0501033_0079473 3300049570 Bacteria 2406
339 Ga0501033_0140724 3300049570 Bacteria 1744
340 Ga0501034_0010168 3300049571 Bacteria 9816
341 Ga0501034_0065033 3300049571 Unclassified 3660
342 Ga0501034_0125028 3300049571 Bacteria 2557
343 Ga0501036_0007378 3300049572 Bacteria 8957
344 Ga0501036_0026721 3300049572 Bacteria 4876
345 Ga0501036_0037129 3300049572 Bacteria 4121
346 Ga0501036_0092898 3300049572 Bacteria 2549
347 Ga0501037_0001093 3300049573 Bacteria 20095
348 Ga0501037_0028669 3300049573 Bacteria 4112
349 Ga0501038_0014410 3300049574 Bacteria 7204
350 Ga0501038_0047578 3300049574 Bacteria 3715
351 Ga0501038_0157459 3300049574 Bacteria 1848
352 Ga0501038_0205705 3300049574 Bacteria 1577
353 Ga0501039_0082963 3300049575 Bacteria 2496
354 Ga0501040_0079966 3300049576 Bacteria 2263
355 Ga0501041_0042837 3300049577 Bacteria 2751
356 Ga0501042_0456325 3300049578 Bacteria 927
357 Ga0501043_0003118 3300049579 Bacteria 13748
358 Ga0501043_0011304 3300049579 Bacteria 6986
359 Ga0501047_0000191 3300049581 Bacteria 74396
360 Ga0501047_0017260 3300049581 Bacteria 6910
361 Ga0501047_0046814 3300049581 Bacteria 4179
362 Ga0501047_0060513 3300049581 Bacteria 3654
363 Ga0501047_0133725 3300049581 Bacteria 2360
364 Ga0501048_0083004 3300049582 Bacteria 2259
365 Ga0501067_0001260 3300049583 Bacteria 13764
366 Ga0501068_0018163 3300049584 Bacteria 4071
367 Ga0501068_0146117 3300049584 Bacteria 1484
368 Ga0501070_0148744 3300049586 Bacteria 1932
369 Ga0501071_0000235 3300049587 Bacteria 25360
370 Ga0501072_0040366 3300049588 Bacteria 3664
371 Ga0501073_0043693 3300049589 Bacteria 3160
372 Ga0501073_0156763 3300049589 Bacteria 1577
373 Ga0501074_0219581 3300049590 Bacteria 1353
374 Ga0501075_0752752 3300049591 Bacteria 742
375 Ga0501076_0672385 3300049592 Bacteria 855
376 Ga0501077_0017752 3300049593 Bacteria 4495
377 Ga0501227_017978 3300049665 Bacteria 1600
378 Ga0501225_0053720 3300049705 Bacteria 1125
379 Ga0501079_0258296 3300049741 Bacteria 1361
380 Ga0501080_0015279 3300049742 Bacteria 7077
381 Ga0501083_0207541 3300049744 Bacteria 1277
382 Ga0501035_0003355 3300049822 Bacteria 15340
383 Ga0501035_0018221 3300049822 Bacteria 6467
384 Ga0501035_0026843 3300049822 Bacteria 5266
385 Ga0501035_0431577 3300049822 Bacteria 1092
386 Ga0501044_0004705 3300049823 Bacteria 15256
387 Ga0501044_0283520 3300049823 Bacteria 1589
388 Ga0501045_0018474 3300049824 Bacteria 4959
389 nmdc:mga00v17_22276_c1 3300050491 Bacteria 3654
390 nmdc:mga05p37_20599_c1 3300050507 Bacteria 6590
391 nmdc:mga09592_7618_c1 3300050508 Bacteria 8804
392 nmdc:mga0qj67_23091_c1 3300050509 Bacteria 4781
393 nmdc:mga0qj67_687716_c1 3300050509 Bacteria 814
394 nmdc:mga06r32_1289421_c1 3300050510 Bacteria 675
395 nmdc:mga06r32_407526_c1 3300050510 Bacteria 1341
396 nmdc:mga06r32_607702_c1 3300050510 Bacteria 1064
397 nmdc:mga08y16_22047_c1 3300050511 Bacteria 6726
398 Ga0495601_0013410 3300053077 Bacteria 4929
399 Ga0495601_0022220 3300053077 Bacteria 3893
400 Ga0495612_0048205 3300053078 Bacteria 1746
401 Ga0495619_0024065 3300053085 Bacteria 3906
402 Ga0495619_0207278 3300053085 Bacteria 1357
403 Ga0500578_0048278 3300053086 Bacteria 2731
404 Ga0500583_0159954 3300053092 Bacteria 1122
405 Ga0500654_057807 3300053099 Bacteria 2017
406 Ga0500558_041877 3300053106 Bacteria 1949
407 Ga0500560_101617 3300053107 Bacteria 963
408 Ga0500569_006414 3300053109 Bacteria 2582
409 Ga0500628_010959 3300053129 Bacteria 1636
410 Ga0500652_001177 3300053131 Bacteria 8350
411 Ga0500561_0009648 3300053137 Bacteria 1967
412 Ga0500573_0042744 3300053140 Bacteria 2617
413 Ga0500573_0099765 3300053140 Bacteria 1635
414 Ga0500579_060836 3300053143 Bacteria 2243
415 Ga0500588_0018344 3300053146 Bacteria 1842
416 Ga0500600_0016349 3300053149 Bacteria 4490
417 Ga0500616_0018695 3300053153 Bacteria 3915
418 Ga0500633_0068207 3300053160 Bacteria 1265
419 Ga0500637_0276755 3300053178 Bacteria 926
420 Ga0501084_0015667 3300054114 Bacteria 6288
421 Ga0501084_0129825 3300054114 Bacteria 2121
422 Ga0501082_0019393 3300060353 Bacteria 5861
423 Ga0466962_0000394 3300061719 Bacteria 18868
424 Ga0466962_0045893 3300061719 Bacteria 2088
425 Ga0466962_0057097 3300061719 Bacteria 1864
426 Ga0530510_0015400 3300061734 Bacteria 5404
427 2547409192 2547132111 Bacteria 8013147
428 2554259745 2554235005 Bacteria 6457341
429 2585297816 2582581312 Bacteria 7308206
430 2643942655 2643221587 Bacteria 7586415
431 2644385975 2643221670 Bacteria 6497041
432 2644430114 2643221677 Bacteria 7584031
433 2644726422 2643221732 Bacteria 5756404
434 2809230112 2808606448 Bacteria 8656184
435 2819699385 2818991463 Bacteria 7948711
436 2862580169 2862574272 Bacteria 10567477
437 2862709615 2862705112 Bacteria 6563286
438 2867316516 2867312974 Bacteria 7058875
439 2867321710 2867319477 Bacteria 7069771
440 2867369673 2867369537 Bacteria 6501581
441 2887485823 2887478801 Bacteria 8972725
442 2912758644 2912757875 Bacteria 7940295
443 2918502343 2918501144 Bacteria 8668083
444 2919429446 2919425241 Bacteria 8055701
445 2966604585 2966598605 Bacteria 7676064
446 2990045753 2990044586 Bacteria 6603797
447 2990088938 2990088156 Bacteria 6657676
448 3001269727 3001267043 Bacteria 4823521
449 3001275073 3001272096 Bacteria 4729684
450 3006327527 3006321560 Bacteria 8247479
451 3006430732 3006425503 Bacteria 6491253
452 3006498302 3006493962 Bacteria 8825450
453 3006986477 3006984091 Bacteria 4207523
454 3006990795 3006988479 Bacteria 4767936
455 8001785041 8001781756 Bacteria 9586736
456 8008486959 8008485437 Bacteria 7198341
457 8023624414 8023623736 Bacteria 8593882
458 8025526216 8025524527 Bacteria 7197316
459 8025533806 8025530807 Bacteria 8495698
460 8033689113 8033684223 Bacteria 6906479
461 8054162695 8054160619 Bacteria 7783213
462 8054706633 8054704163 Bacteria 7247792
463 8056454196 8056447290 Bacteria 7680491
464 Ga0501032_0079601
465 JGI25159J45721_1002398
466 JGI25151J46595_10021609
467 JGI25151J46595_10034016
468 JGI25151J46595_10058440
469 JGI25406J46586_10008572
470 rootL2_10350170
471 rootH1_10280006
472 Ga0070683_100013313
473 Ga0070683_100268060
474 Ga0068869_100001362
475 Ga0068869_100010801
476 Ga0068869_100330186
477 Ga0070666_10416740
478 Ga0070680_100303095
479 Ga0068868_100001501
480 Ga0070660_100016597
481 Ga0070660_100022636
482 Ga0070689_100006501
483 Ga0070689_100406133
484 Ga0070661_100034710
485 Ga0070692_10002178
486 Ga0070692_10028840
487 Ga0070668_100409514
488 Ga0070669_100045389
489 Ga0070669_100148659
490 Ga0070675_100000671
491 Ga0070675_100003575
492 Ga0070659_100011176
493 Ga0070659_100037057
494 Ga0070667_100410840
495 Ga0070714_100018059
496 Ga0070714_100762024
497 Ga0070701_10389813
498 Ga0070700_100012862
499 Ga0070700_100370945
500 Ga0070663_100011316
501 Ga0070663_100041654
502 Ga0070663_100298248
503 Ga0070662_100002758
504 Ga0070662_100013857
505 Ga0070681_10256108
506 Ga0070681_10348083
507 Ga0070685_10001546
508 Ga0070685_10315335
509 Ga0070706_100009116
510 Ga0070684_100003933
511 Ga0070684_100021820
512 Ga0070684_100105786
513 Ga0068853_100390431
514 Ga0070686_100165276
515 Ga0070665_100031294
516 Ga0070665_100119478
517 Ga0068855_100102846
518 Ga0068855_100310545
519 Ga0068855_100608371
520 Ga0070664_100000074
521 Ga0070664_100007375
522 Ga0070664_100021754
523 Ga0068857_100023395
524 Ga0068857_100388363
525 Ga0068854_100003862
526 Ga0068854_100074505
527 Ga0068856_100152680
528 Ga0068856_100278703
529 Ga0068856_100811947
530 Ga0070702_100046413
531 Ga0070702_100193140
532 Ga0068861_100053563
533 Ga0068861_100081461
534 Ga0068870_10077967
535 Ga0068863_100200477
536 Ga0068860_100168322
537 Ga0068862_100028386
538 Ga0081539_10000109
539 Ga0070717_10164243
540 Ga0070717_10312866
541 Ga0075364_10142490
542 Ga0075428_100187737
543 Ga0075430_100076528
544 Ga0075430_100451629
545 Ga0075431_100257434
546 Ga0075431_100258274
547 Ga0075429_100009014
548 Ga0105251_10043291
549 Ga0105244_10147759
550 Ga0105240_10014680
551 Ga0105240_10102534
552 Ga0111539_10011084
553 Ga0111539_10689308
554 Ga0105245_10015622
555 Ga0114129_10040225
556 Ga0105243_10548073
557 Ga0105241_10006695
558 Ga0105241_10459524
559 Ga0105248_10552542
560 Ga0105237_10264699
561 Ga0105237_11186012
562 Ga0105238_10000019
563 Ga0105238_10003550
564 Ga0105238_10688211
565 Ga0105238_11037808
566 Ga0105249_10034934
567 Ga0105249_10118619
568 Ga0105249_10550780
569 Ga0105239_10043912
570 Ga0105239_10248278
571 Ga0105246_10081472
572 Ga0157370_10015326
573 Ga0157370_10032293
574 Ga0157369_10060148
575 Ga0157369_10093266
576 Ga0157374_10018677
577 Ga0157372_10288309
578 Ga0163163_10233510
579 Ga0157380_10805116
580 Ga0157380_10920013
581 Ga0157377_10000588
582 Ga0157377_10012149
583 Ga0213876_10003480
584 Ga0213875_10065528
585 Ga0209025_1004635
586 Ga0209025_1008218
587 Ga0207647_10015116
588 Ga0207645_10189017
589 Ga0207684_10066281
590 Ga0207654_10048821
591 Ga0207695_10000104
592 Ga0207695_10006639
593 Ga0207671_10000170
594 Ga0207660_10268588
595 Ga0207649_10028154
596 Ga0207681_10032542
597 Ga0207694_10000032
598 Ga0207694_10017291
599 Ga0207659_10002042
600 Ga0207687_10014954
601 Ga0207664_10160082
602 Ga0207664_10391174
603 Ga0207664_10441350
604 Ga0207690_10020144
605 Ga0207706_10003416
606 Ga0207706_10018248
607 Ga0207670_10006839
608 Ga0207669_10396105
609 Ga0207665_10226959
610 Ga0207711_10530355
611 Ga0207689_10017301
612 Ga0207689_10213554
613 Ga0207661_10016507
614 Ga0207661_10019881
615 Ga0207661_10233435
616 Ga0207679_10000952
617 Ga0207679_10056753
618 Ga0207667_10181720
619 Ga0207667_10193175
620 Ga0207712_10150785
621 Ga0207712_10428607
622 Ga0207668_10287594
623 Ga0207640_10059424
624 Ga0207640_10120645
625 Ga0207677_10009311
626 Ga0207678_10021392
627 Ga0207708_10016872
628 Ga0207708_10425159
629 Ga0207702_10603226
630 Ga0207641_10348174
631 Ga0207676_10030925
632 Ga0207675_100111599
633 Ga0207675_100138065
634 Ga0207675_100820803
635 Ga0207698_10146985
636 Ga0207428_10012670
637 Ga0268266_10178677
638 Ga0268266_10477211
639 Ga0268265_10469246
640 Ga0268264_10065714
641 Ga0307517_10004517
642 Ga0307511_10174949
643 Ga0307514_10017466
644 Ga0307516_10004944
645 Ga0307516_10049362
646 Ga0307405_10000946
647 Ga0307405_10354535
648 Ga0307413_10010995
649 Ga0307410_10015665
650 Ga0307406_10048047
651 Ga0307406_10073861
652 Ga0307406_10321108
653 Ga0307407_10431274
654 Ga0307409_100000109
655 Ga0307409_100182547
656 Ga0307416_100000122
657 Ga0307416_101207664
658 Ga0307411_10327286
659 Ga0307415_100000011
660 Ga0307415_100004974
661 Ga0307415_100083607
662 Ga0307415_100244362
663 Ga0307415_100390760
664 Ga0307415_100598759
665 Ga0307507_10000998
666 Ga0307510_10011560
667 Ga0395899_0032903
668 Ga0395900_0018166
669 Ga0395900_0082415
670 Ga0395898_0011347
671 Ga0395905_0033630
672 Ga0436364_1050672
673 Ga0395901_0018692
674 Ga0395901_0038863
675 Ga0436365_0756511
676 Ga0436361_0017532
677 Ga0451807_2756517
678 Ga0451837_1084771
679 Ga0451845_0591611
680 Ga0451849_0783382
681 Ga0466969_0003825
682 Ga0466969_0010124
683 Ga0466969_0013148
684 Ga0466966_0013030
685 Ga0466966_0022338
686 Ga0466961_0001882
687 Ga0466961_0003838
688 Ga0466961_0018621
689 Ga0466961_0219093
690 Ga0466971_0006305
691 Ga0466971_0017482
692 Ga0466971_0265695
693 Ga0466968_0329215
694 Ga0466970_0005991
695 Ga0466960_0153136
696 Ga0466959_0002121
697 Ga0466959_0017334
698 Ga0466959_0040673
699 Ga0466959_0065286
700 Ga0466959_0374209
701 Ga0466958_0077602
702 Ga0466958_0397644
703 Ga0466967_0376456
704 Ga0495592_0015082
705 Ga0495592_0021376
706 Ga0495603_0001771
707 Ga0495629_0006678
708 Ga0495629_0151302
709 Ga0495629_0184440
710 Ga0495629_0505659
711 Ga0495638_0046953
712 Ga0495651_0002359
713 Ga0495651_0004965
714 Ga0495653_0032988
715 Ga0495580_0007819
716 Ga0495662_0177188
717 Ga0495664_0044223
718 Ga0495585_0066650
719 Ga0495594_0082522
720 Ga0495594_0122646
721 Ga0495594_0141767
722 Ga0495608_0004466
723 Ga0495608_0010407
724 Ga0495628_0012375
725 Ga0495628_0035716
726 Ga0495630_0029476
727 Ga0495631_0163662
728 Ga0495632_0097892
729 Ga0495643_0004558
730 Ga0495666_0000897
731 Ga0495652_0003381
732 Ga0495652_0015130
733 Ga0495652_0233161
734 Ga0495665_0001618
735 Ga0495640_0014857
736 Ga0495640_0074288
737 Ga0495609_0144138
738 Ga0495645_0003091
739 Ga0495645_0109225
740 Ga0495645_0221196
741 Ga0495622_0094126
742 Ga0495622_0138665
743 Ga0495667_0000787
744 Ga0495667_0500904
745 Ga0495668_0244699
746 Ga0495634_0003641
747 Ga0495634_0393528
748 Ga0495611_0032945
749 Ga0495635_0036513
750 Ga0495659_0073535
751 Ga0495661_0127314
752 Ga0495599_0032735
753 Ga0495623_0035992
754 Ga0495646_0004812
755 Ga0495658_0040174
756 Ga0495613_0003683
757 Ga0495613_0012021
758 Ga0495613_0013099
759 Ga0495624_0019056
760 Ga0495670_0031574
761 Ga0495671_0322670
762 Ga0495589_0003099
763 Ga0495600_0256036
764 Ga0495600_0309814
765 Ga0495660_0061488
766 Ga0495581_0005335
767 Ga0495581_0445533
768 Ga0495604_0000800
769 Ga0495604_0004211
770 Ga0495604_0116924
771 Ga0495604_0206290
772 Ga0495604_0379417
773 Ga0495674_0014172
774 Ga0495676_0019113
775 Ga0495676_0032283
776 Ga0495676_0045788
777 Ga0495687_021439
778 Ga0495675_0017959
779 Ga0495675_0263342
780 Ga0495679_028451
781 Ga0495685_000298
782 Ga0495685_031947
783 Ga0495681_0004865
784 Ga0495686_0087889
785 Ga0495593_0016240
786 Ga0495602_0069910
787 Ga0495614_0000501
788 Ga0496105_0030679
789 Ga0496108_0146764
790 Ga0496108_0466080
791 Ga0496112_0030728
792 Ga0496112_0045666
793 Ga0496115_0190829
794 Ga0501031_0012385
795 Ga0501031_0104840
796 Ga0501032_0004249
797 Ga0501032_0048086
798 Ga0501032_0068952
799 Ga0501033_0011270
800 Ga0501033_0013836
801 Ga0501033_0079473
802 Ga0501033_0140724
803 Ga0501034_0010168
804 Ga0501034_0065033
805 Ga0501034_0125028
806 Ga0501036_0007378
807 Ga0501036_0026721
808 Ga0501036_0037129
809 Ga0501036_0092898
810 Ga0501037_0001093
811 Ga0501037_0028669
812 Ga0501038_0014410
813 Ga0501038_0047578
814 Ga0501038_0157459
815 Ga0501038_0205705
816 Ga0501039_0082963
817 Ga0501040_0079966
818 Ga0501041_0042837
819 Ga0501042_0456325
820 Ga0501043_0003118
821 Ga0501043_0011304
822 Ga0501047_0000191
823 Ga0501047_0017260
824 Ga0501047_0046814
825 Ga0501047_0060513
826 Ga0501047_0133725
827 Ga0501048_0083004
828 Ga0501067_0001260
829 Ga0501068_0018163
830 Ga0501068_0146117
831 Ga0501070_0148744
832 Ga0501071_0000235
833 Ga0501072_0040366
834 Ga0501073_0043693
835 Ga0501073_0156763
836 Ga0501074_0219581
837 Ga0501075_0752752
838 Ga0501076_0672385
839 Ga0501077_0017752
840 Ga0501227_017978
841 Ga0501225_0053720
842 Ga0501079_0258296
843 Ga0501080_0015279
844 Ga0501083_0207541
845 Ga0501035_0003355
846 Ga0501035_0018221
847 Ga0501035_0026843
848 Ga0501035_0431577
849 Ga0501044_0004705
850 Ga0501044_0283520
851 Ga0501045_0018474
852 nmdc:mga00v17_22276_c1
853 nmdc:mga05p37_20599_c1
854 nmdc:mga09592_7618_c1
855 nmdc:mga0qj67_23091_c1
856 nmdc:mga0qj67_687716_c1
857 nmdc:mga06r32_1289421_c1
858 nmdc:mga06r32_407526_c1
859 nmdc:mga06r32_607702_c1
860 nmdc:mga08y16_22047_c1
861 Ga0495601_0013410
862 Ga0495601_0022220
863 Ga0495612_0048205
864 Ga0495619_0024065
865 Ga0495619_0207278
866 Ga0500578_0048278
867 Ga0500583_0159954
868 Ga0500654_057807
869 Ga0500558_041877
870 Ga0500560_101617
871 Ga0500569_006414
872 Ga0500628_010959
873 Ga0500652_001177
874 Ga0500561_0009648
875 Ga0500573_0042744
876 Ga0500573_0099765
877 Ga0500579_060836
878 Ga0500588_0018344
879 Ga0500600_0016349
880 Ga0500616_0018695
881 Ga0500633_0068207
882 Ga0500637_0276755
883 Ga0501084_0015667
884 Ga0501084_0129825
885 Ga0501082_0019393
886 Ga0466962_0000394
887 Ga0466962_0045893
888 Ga0466962_0057097
889 Ga0530510_0015400
890 2547409192
891 2554259745
892 2585297816
893 2643942655
894 2644385975
895 2644430114
896 2644726422
897 2809230112
898 2819699385
899 2862580169
900 2862709615
901 2867316516
902 2867321710
903 2867369673
904 2887485823
905 2912758644
906 2918502343
907 2919429446
908 2966604585
909 2990045753
910 2990088938
911 3001269727
912 3001275073
913 3006327527
914 3006430732
915 3006498302
916 3006986477
917 3006990795
918 8001785041
919 8008486959
920 8023624414
921 8025526216
922 8025533806
923 8033689113
924 8054162695
925 8054706633
926 8056454196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

81

240

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ail-assembly1.cif.gz_M bacillus phage vmy22 p56 in complex with bacillus weidmannii ung 0.9935 3 225
8ail-assembly1.cif.gz_M bacillus phage vmy22 p56 in complex with bacillus weidmannii ung 0.9891 3 225
3zor-assembly1.cif.gz_A structure of bsudg 0.9854 4 225
3fcl-assembly1.cif.gz_A complex of ung2 and a fragment-based designed inhibitor 0.9817 9 221
5eug-assembly1.cif.gz_A crystallographic and enzymatic studies of an active site variant h187q of escherichia coli uracil dna glycosylase: crystal structures of mutant h187q and its uracil complex 0.9808 9 221
ID Description Score Start End Superfamily
af_Q8ILU6_89_322_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9833 9 223 3.40.470.10
1okbB00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9829 9 221 3.40.470.10
af_O74834_61_307_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9729 4 220 3.40.470.10
af_Q1ZXM2_175_429_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9599 4 225 3.40.470.10
3a7nA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.95 4 223 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A2V2FW31-F1-model_v4 Uracil-DNA glycosylase (UDG) (EC 3.2.2.27) 0.9975 5 224 GO:0004844
GO:0005737
GO:0097510
AF-A0A353T3B1-F1-model_v4 Uracil-DNA glycosylase (UDG) (EC 3.2.2.27) 0.9964 5 225 GO:0004844
GO:0005737
GO:0097510
AF-A0A017H4D2-F1-model_v4 Uracil-DNA glycosylase (UDG) (EC 3.2.2.27) 0.9959 5 223 GO:0004844
GO:0005737
GO:0097510
AF-A0A7V7B2K0-F1-model_v4 Uracil-DNA glycosylase (EC 3.2.2.27) 0.9958 4 196 GO:0004844
GO:0005737
GO:0097510
AF-V9G802-F1-model_v4 Uracil-DNA glycosylase (UDG) (EC 3.2.2.27) 0.9951 26 225 GO:0004844
GO:0005737
GO:0097510

Map