F449024

General Info

Members Datasets Scaffolds Average Seq Length
462 307 924 194

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8056667051|8056670450
Length 229
Sequence PLVPGAGDQVTWQRVRRSRHTDHGDDVQALRRENAVGTVTLGVSIAVPEPYGSFLQKRRESFGDPQAHGIPTHVTLLPPTEADASSLPAIERHLAEVAEAGRPFRMRLSGTGTFRPLSPVVFVNVVEGSSSCAWLQKRVRDASGPVARELQFPYHPHVTVAHGIAEEAMDRAYAELADYEAEWTIEGFALYEQGEDGIWRLERDFPFGKDGAGELPHQSDLSPLSRPSP

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
6 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
7 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
12 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
13 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
14 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
15 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
16 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
17 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
18 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
19 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
20 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
21 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
22 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
23 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
24 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
25 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
26 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
27 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
36 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
37 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
39 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
40 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
41 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
42 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
43 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
44 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
45 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
46 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
47 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
48 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
49 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
50 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
51 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
52 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
53 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
54 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
55 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
56 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
57 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
58 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
59 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
60 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
61 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
62 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
63 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
64 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
65 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
66 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
67 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
68 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
69 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
70 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
71 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
72 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
73 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
74 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
75 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
76 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
77 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
78 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
79 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
80 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
83 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
84 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
85 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
86 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
87 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
88 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
93 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
94 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
95 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
98 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
99 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
100 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
101 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
102 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
103 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
104 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
105 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
106 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
107 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
108 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
109 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
114 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
115 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
116 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
117 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
118 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
119 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
122 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
123 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
124 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
125 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
126 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
127 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
128 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
129 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
132 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
133 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
142 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
145 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
146 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
147 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
189 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
190 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
191 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
192 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
193 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
194 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
195 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
196 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
197 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
198 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
199 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
200 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
201 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
202 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
203 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
204 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
205 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
206 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
207 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
208 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
211 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
212 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
213 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
218 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
219 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
220 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
221 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
222 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
223 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
224 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
225 2643221548 Streptomyces sp. Root55 Isolate Unclassified
226 2643221578 Streptomyces sp. Root63 Isolate Unclassified
227 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
228 2643221647 Streptomyces sp. Root369 Isolate Unclassified
229 2643221670 Streptomyces sp. Root431 Isolate Unclassified
230 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
231 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
232 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
233 2643221714 Streptomyces sp. Root264 Isolate Unclassified
234 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
235 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
236 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
237 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
238 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
239 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
240 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
241 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
242 2808606448 Streptomyces sp. 193411 Isolate Unclassified
243 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
244 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
245 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
246 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
247 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
248 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
249 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
250 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
251 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
252 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
253 2862574272 Streptomyces sp. AcE210 Isolate Nodule
254 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
255 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
256 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
257 2867369537 Streptomyces sp. Z26 Isolate Unclassified
258 2867428634 Streptomyces sp. RP5T Isolate Unclassified
259 2867475112 Streptomyces sp. TM32 Isolate Unclassified
260 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
261 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
262 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
263 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
264 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
265 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
266 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
267 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
268 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
269 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
270 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
271 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
272 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
273 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
274 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
275 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
276 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
277 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
278 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
279 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
280 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
281 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
282 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
283 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
284 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
285 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
286 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
287 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
288 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
289 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
290 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
291 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
292 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
293 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
294 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
295 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
296 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
297 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
298 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
299 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
300 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
301 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
302 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
303 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
304 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
305 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
306 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
307 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79
Metatranscriptomes 1.52
Isolates 19.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.01
Nodule 0.87
Rhizoplane 1.3
Rhizosphere 71.65
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10095253 3300001990 Bacteria 882
2 rootH1_10054529 3300003323 Bacteria 2689
3 JGI25160J50197_1014965 3300003354 Bacteria 2568
4 JGI25160J50197_1057016 3300003354 Bacteria 798
5 Ga0006562J51391_1047751 3300003578 Bacteria 2998
6 Ga0006562J51391_1047752 3300003578 Bacteria 5010
7 Ga0006562J51391_1070275 3300003578 Bacteria 730
8 Ga0006562J51391_1070278 3300003578 Bacteria 1200
9 Ga0070706_100962208 3300005467 Bacteria 788
10 Ga0068853_100118623 3300005539 Bacteria 2358
11 Ga0070672_100636792 3300005543 Bacteria 931
12 Ga0070665_100181924 3300005548 Bacteria 2103
13 Ga0068855_100901691 3300005563 Bacteria 934
14 Ga0068856_100464478 3300005614 Bacteria 1286
15 Ga0068863_100656797 3300005841 Bacteria 1040
16 Ga0075368_10287068 3300006042 Bacteria 708
17 Ga0105245_10357501 3300009098 Bacteria 1449
18 Ga0105243_10030949 3300009148 Bacteria 4124
19 Ga0105248_10070895 3300009177 Bacteria 3913
20 Ga0105249_10963624 3300009553 Bacteria 921
21 Ga0105239_10297359 3300010375 Bacteria 1818
22 Ga0105246_10025557 3300011119 Bacteria 3850
23 Ga0157372_10212551 3300013307 Bacteria 2242
24 Ga0157375_10648301 3300013308 Bacteria 1212
25 Ga0182008_10001038 3300014497 Bacteria 19292
26 Ga0182006_1058341 3300015261 Bacteria 1464
27 Ga0182007_10000455 3300015262 Bacteria 24696
28 Ga0183367_1002 3300015688 Bacteria 1101531
29 Ga0209758_1002040 3300025297 Bacteria 21666
30 Ga0207426_1000693 3300025302 Bacteria 40462
31 Ga0207426_1000709 3300025302 Bacteria 39246
32 Ga0207426_1027926 3300025302 Bacteria 1874
33 Ga0207426_1038897 3300025302 Bacteria 1495
34 Ga0207647_10031195 3300025904 Bacteria 3431
35 Ga0207709_10255523 3300025935 Bacteria 1282
36 Ga0207691_10313344 3300025940 Bacteria 1346
37 Ga0207667_10808718 3300025949 Bacteria 934
38 Ga0207639_10092635 3300026041 Bacteria 2422
39 Ga0207702_10340668 3300026078 Bacteria 1432
40 Ga0207641_10306493 3300026088 Bacteria 1502
41 Ga0207674_11021930 3300026116 Bacteria 796
42 Ga0209371_1021970 3300027312 Bacteria 1536
43 Ga0209371_1041188 3300027312 Bacteria 936
44 Ga0209282_1043187 3300027666 Bacteria 2653
45 Ga0268266_10070159 3300028379 Bacteria 3037
46 Ga0307517_10003518 3300028786 Bacteria 24347
47 Ga0307517_10022088 3300028786 Bacteria 7994
48 Ga0307515_10000497 3300028794 Bacteria 94190
49 Ga0307515_10045831 3300028794 Bacteria 6703
50 Ga0307515_10332762 3300028794 Bacteria 1176
51 Ga0268256_1024742 3300030500 Bacteria 1536
52 Ga0268256_1034832 3300030500 Bacteria 1176
53 Ga0268256_1053541 3300030500 Bacteria 839
54 Ga0307511_10001205 3300030521 Bacteria 27440
55 Ga0307511_10005620 3300030521 Bacteria 12728
56 Ga0307511_10060759 3300030521 Bacteria 2888
57 Ga0307512_10000703 3300030522 Bacteria 49792
58 Ga0307512_10110983 3300030522 Bacteria 1807
59 Ga0307513_10027300 3300031456 Bacteria 6558
60 Ga0307513_10225450 3300031456 Bacteria 1691
61 Ga0307509_10056490 3300031507 Bacteria 4166
62 Ga0307509_10060065 3300031507 Bacteria 4020
63 Ga0307509_10095374 3300031507 Bacteria 3030
64 Ga0307509_10148080 3300031507 Bacteria 2269
65 Ga0307408_100483390 3300031548 Bacteria 1081
66 Ga0307508_10002329 3300031616 Bacteria 20137
67 Ga0307508_10002425 3300031616 Bacteria 19664
68 Ga0307508_10043387 3300031616 Bacteria 4029
69 Ga0307508_10100656 3300031616 Bacteria 2485
70 Ga0307514_10004286 3300031649 Bacteria 13175
71 Ga0307514_10062879 3300031649 Bacteria 2821
72 Ga0307514_10062962 3300031649 Bacteria 2818
73 Ga0307514_10118697 3300031649 Bacteria 1852
74 Ga0307516_10007174 3300031730 Bacteria 12864
75 Ga0307516_10016383 3300031730 Bacteria 7753
76 Ga0307516_10069163 3300031730 Bacteria 3397
77 Ga0307516_10256518 3300031730 Bacteria 1441
78 Ga0307516_10342480 3300031730 Bacteria 1162
79 Ga0307518_10073032 3300031838 Bacteria 2483
80 Ga0307518_10098480 3300031838 Bacteria 2096
81 Ga0307416_100267100 3300032002 Bacteria 1677
82 Ga0307507_10023296 3300033179 Bacteria 6802
83 Ga0307507_10117305 3300033179 Bacteria 2146
84 Ga0307510_10030390 3300033180 Bacteria 6123
85 Ga0307510_10032532 3300033180 Bacteria 5874
86 Ga0307510_10059604 3300033180 Bacteria 3938
87 Ga0307510_10173725 3300033180 Bacteria 1729
88 Ga0395898_0003234 3300037466 Bacteria 18301
89 Ga0395898_0021405 3300037466 Bacteria 6557
90 Ga0395905_0685584 3300037471 Bacteria 927
91 Ga0436364_1200369 3300037853 Bacteria 15115
92 Ga0395901_0429603 3300038443 Bacteria 1353
93 Ga0439436_0044896 3300041404 Bacteria 1258
94 Ga0439439_0185150 3300041406 Bacteria 601
95 Ga0451802_0490948 3300041460 Bacteria 1087
96 Ga0451853_0290340 3300041512 Bacteria 1051
97 Ga0451853_1727470 3300041512 Bacteria 4243
98 Ga0451853_3959824 3300041512 Bacteria 1391
99 Ga0439433_0012159 3300041999 Bacteria 1886
100 Ga0439442_011314 3300042002 Bacteria 1815
101 Ga0439448_0078357 3300042005 Bacteria 1107
102 Ga0439449_0004174 3300042007 Bacteria 5581
103 Ga0439449_0027790 3300042007 Bacteria 2110
104 Ga0439455_0006274 3300042012 Bacteria 2459
105 Ga0439457_000113 3300042014 Bacteria 19336
106 Ga0439457_008096 3300042014 Bacteria 2492
107 Ga0439457_021767 3300042014 Bacteria 1420
108 Ga0439462_0001589 3300042015 Bacteria 5101
109 Ga0439462_0082612 3300042015 Bacteria 878
110 Ga0450894_000178 3300042131 Bacteria 11327
111 Ga0450895_001990 3300042132 Bacteria 1480
112 Ga0450896_000229 3300042133 Bacteria 5055
113 Ga0450899_001646 3300042135 Bacteria 2469
114 Ga0450903_000262 3300042138 Bacteria 11591
115 Ga0450903_019847 3300042138 Bacteria 1041
116 Ga0450906_000063 3300042145 Bacteria 17659
117 Ga0450907_003604 3300042146 Bacteria 2744
118 Ga0439458_0000248 3300042157 Bacteria 13086
119 Ga0466969_0010312 3300044656 Bacteria 4957
120 Ga0466972_0008630 3300044658 Bacteria 5113
121 Ga0466972_0010945 3300044658 Bacteria 4553
122 Ga0466972_0011196 3300044658 Bacteria 4501
123 Ga0466972_0033172 3300044658 Bacteria 2533
124 Ga0466965_0007400 3300044683 Bacteria 5039
125 Ga0466965_0028664 3300044683 Bacteria 2706
126 Ga0466966_0000771 3300044684 Bacteria 20322
127 Ga0466966_0021436 3300044684 Bacteria 4243
128 Ga0466961_0001621 3300044693 Bacteria 13950
129 Ga0466961_0002207 3300044693 Bacteria 12121
130 Ga0466963_0000226 3300044694 Bacteria 24096
131 Ga0466963_0004317 3300044694 Bacteria 8249
132 Ga0466971_0395153 3300044719 Bacteria 673
133 Ga0466968_0007028 3300044735 Bacteria 4266
134 Ga0466970_0000866 3300044765 Bacteria 14617
135 Ga0466957_0002141 3300044842 Bacteria 10570
136 Ga0466960_0006672 3300044901 Bacteria 4643
137 Ga0466959_0004451 3300045049 Bacteria 9381
138 Ga0466959_0116611 3300045049 Bacteria 1901
139 Ga0466958_0003155 3300045836 Bacteria 8481
140 Ga0466967_0004961 3300045976 Bacteria 9108
141 Ga0466967_0093870 3300045976 Bacteria 2731
142 Ga0466967_0201288 3300045976 Bacteria 1886
143 Ga0495617_143423 3300046452 Bacteria 762
144 Ga0495592_0180630 3300046454 Bacteria 1437
145 Ga0495603_0000778 3300046455 Bacteria 18228
146 Ga0495603_0001524 3300046455 Bacteria 13526
147 Ga0495603_0005574 3300046455 Bacteria 7517
148 Ga0495603_0020208 3300046455 Bacteria 4036
149 Ga0495603_0021315 3300046455 Bacteria 3924
150 Ga0495603_0462267 3300046455 Bacteria 727
151 Ga0495629_0002618 3300046459 Bacteria 13799
152 Ga0495629_0002696 3300046459 Bacteria 13596
153 Ga0495629_0011762 3300046459 Bacteria 6351
154 Ga0495629_0161259 3300046459 Bacteria 1557
155 Ga0495629_0370402 3300046459 Bacteria 975
156 Ga0495638_0050789 3300046460 Bacteria 2589
157 Ga0495638_0057970 3300046460 Bacteria 2401
158 Ga0495651_0114051 3300046462 Bacteria 1994
159 Ga0495582_0020536 3300046473 Bacteria 3616
160 Ga0495639_0018184 3300046475 Bacteria 3058
161 Ga0495662_0005773 3300046476 Bacteria 6193
162 Ga0495662_0006552 3300046476 Bacteria 5813
163 Ga0495664_0000654 3300046477 Bacteria 17640
164 Ga0495585_0148747 3300046492 Bacteria 1222
165 Ga0495594_0001288 3300046499 Bacteria 13090
166 Ga0495594_0009281 3300046499 Bacteria 5080
167 Ga0495594_0081911 3300046499 Bacteria 1802
168 Ga0495594_0299877 3300046499 Bacteria 915
169 Ga0495607_0093735 3300046501 Bacteria 1621
170 Ga0495607_0150928 3300046501 Bacteria 1189
171 Ga0495583_0022885 3300046506 Bacteria 3176
172 Ga0495618_0027910 3300046514 Bacteria 3516
173 Ga0495620_0066850 3300046515 Bacteria 1480
174 Ga0495631_0082097 3300046518 Bacteria 1390
175 Ga0495631_0110567 3300046518 Bacteria 1182
176 Ga0495632_0020685 3300046519 Bacteria 3558
177 Ga0495637_0103014 3300046520 Bacteria 1113
178 Ga0495643_0001773 3300046522 Bacteria 18564
179 Ga0495652_0080016 3300046529 Bacteria 2700
180 Ga0495587_0077632 3300046536 Bacteria 1927
181 Ga0495645_0021900 3300046543 Bacteria 4622
182 Ga0495622_0003589 3300046557 Bacteria 7285
183 Ga0495622_0018901 3300046557 Bacteria 3211
184 Ga0495622_0242420 3300046557 Bacteria 794
185 Ga0495633_0100809 3300046558 Bacteria 1340
186 Ga0495633_0108349 3300046558 Bacteria 1288
187 Ga0495656_0190888 3300046615 Bacteria 1012
188 Ga0495668_0126487 3300046616 Bacteria 1399
189 Ga0495634_0003466 3300046642 Bacteria 12633
190 Ga0495611_0018573 3300046648 Bacteria 2983
191 Ga0495625_0016419 3300046660 Bacteria 5829
192 Ga0495625_0036445 3300046660 Bacteria 3615
193 Ga0495635_0001262 3300046663 Bacteria 16904
194 Ga0495661_0110131 3300046665 Bacteria 1536
195 Ga0495588_0001332 3300046674 Bacteria 10542
196 Ga0495588_0030498 3300046674 Bacteria 2710
197 Ga0495588_0061015 3300046674 Bacteria 1952
198 Ga0495657_0003053 3300046675 Bacteria 13856
199 Ga0495657_0008961 3300046675 Bacteria 7614
200 Ga0495599_0070785 3300046678 Bacteria 2177
201 Ga0495623_0184105 3300046679 Bacteria 1211
202 Ga0495646_0001937 3300046680 Bacteria 12468
203 Ga0495658_0082506 3300046683 Bacteria 1889
204 Ga0495658_0147956 3300046683 Bacteria 1441
205 Ga0495613_0001468 3300046689 Bacteria 17945
206 Ga0495613_0030869 3300046689 Bacteria 3980
207 Ga0495613_0031118 3300046689 Bacteria 3963
208 Ga0495613_0084218 3300046689 Bacteria 2309
209 Ga0495624_0177585 3300046690 Bacteria 1298
210 Ga0495670_0085692 3300046691 Bacteria 1608
211 Ga0495670_0088556 3300046691 Bacteria 1582
212 Ga0495670_0118576 3300046691 Bacteria 1374
213 Ga0495671_0054880 3300046692 Bacteria 1974
214 Ga0495649_0291544 3300046694 Bacteria 832
215 Ga0495589_0005767 3300046794 Bacteria 6533
216 Ga0495589_0021602 3300046794 Bacteria 3288
217 Ga0495589_0136790 3300046794 Bacteria 1174
218 Ga0495589_0178425 3300046794 Bacteria 1008
219 Ga0495600_0083154 3300046809 Bacteria 2089
220 Ga0495660_0005949 3300046810 Bacteria 7262
221 Ga0495581_0000686 3300047315 Bacteria 17768
222 Ga0495604_0155923 3300047317 Bacteria 1617
223 Ga0495604_0286592 3300047317 Bacteria 1111
224 Ga0495636_0012661 3300047318 Bacteria 3340
225 Ga0495636_0020216 3300047318 Bacteria 2682
226 Ga0495674_0189601 3300047319 Bacteria 1709
227 Ga0495676_0003115 3300047321 Bacteria 15001
228 Ga0495676_0030031 3300047321 Bacteria 4620
229 Ga0495676_0043214 3300047321 Bacteria 3691
230 Ga0495676_0078719 3300047321 Bacteria 2508
231 Ga0495676_0330378 3300047321 Bacteria 1022
232 Ga0495683_0099572 3300047323 Bacteria 1399
233 Ga0495687_001741 3300047443 Bacteria 19262
234 Ga0495687_013872 3300047443 Bacteria 4176
235 Ga0495687_034070 3300047443 Bacteria 2304
236 Ga0495675_0173004 3300047444 Bacteria 1325
237 Ga0495685_000285 3300047447 Bacteria 16923
238 Ga0495685_000604 3300047447 Bacteria 11043
239 Ga0495685_001084 3300047447 Bacteria 8288
240 Ga0495685_005966 3300047447 Bacteria 3979
241 Ga0495685_015132 3300047447 Bacteria 2629
242 Ga0495685_022056 3300047447 Bacteria 2191
243 Ga0495681_0001283 3300047470 Bacteria 19021
244 Ga0495681_0002414 3300047470 Bacteria 13371
245 Ga0495681_0103853 3300047470 Bacteria 1239
246 Ga0495686_0018514 3300047472 Bacteria 4671
247 Ga0495593_0012646 3300047673 Bacteria 4821
248 Ga0495602_0016781 3300048088 Bacteria 7353
249 Ga0495614_0000974 3300048089 Bacteria 12190
250 Ga0495614_0024612 3300048089 Bacteria 2598
251 Ga0495614_0028112 3300048089 Bacteria 2423
252 Ga0495614_0045817 3300048089 Bacteria 1875
253 Ga0496104_0718116 3300048907 Bacteria 907
254 Ga0496108_0288035 3300048911 Bacteria 1430
255 Ga0496110_0131644 3300048913 Bacteria 2259
256 Ga0496113_0428439 3300048916 Bacteria 1063
257 Ga0501310_003138 3300049130 Bacteria 1606
258 Ga0501315_004663 3300049531 Bacteria 1446
259 Ga0501316_002810 3300049532 Bacteria 1642
260 Ga0501031_0004841 3300049568 Bacteria 8746
261 Ga0501031_0055211 3300049568 Bacteria 2588
262 Ga0501032_0006764 3300049569 Bacteria 8415
263 Ga0501032_0073963 3300049569 Bacteria 2270
264 Ga0501033_0001811 3300049570 Bacteria 18666
265 Ga0501033_0014796 3300049570 Bacteria 5923
266 Ga0501033_0119959 3300049570 Bacteria 1909
267 Ga0501033_0152204 3300049570 Bacteria 1668
268 Ga0501033_0260449 3300049570 Bacteria 1227
269 Ga0501033_0790714 3300049570 Bacteria 642
270 Ga0501034_0002992 3300049571 Bacteria 19559
271 Ga0501034_0074481 3300049571 Bacteria 3403
272 Ga0501034_0114490 3300049571 Bacteria 2685
273 Ga0501034_0312148 3300049571 Bacteria 1506
274 Ga0501036_0011400 3300049572 Bacteria 7356
275 Ga0501036_0039226 3300049572 Bacteria 4008
276 Ga0501036_0063461 3300049572 Bacteria 3128
277 Ga0501037_0017371 3300049573 Bacteria 5298
278 Ga0501037_0052396 3300049573 Bacteria 2984
279 Ga0501037_0107038 3300049573 Bacteria 2015
280 Ga0501038_0001158 3300049574 Bacteria 23923
281 Ga0501038_0034940 3300049574 Bacteria 4417
282 Ga0501038_0047408 3300049574 Bacteria 3722
283 Ga0501038_0050166 3300049574 Bacteria 3607
284 Ga0501038_0269733 3300049574 Bacteria 1342
285 Ga0501039_0025184 3300049575 Bacteria 4570
286 Ga0501039_0099097 3300049575 Bacteria 2274
287 Ga0501039_0380271 3300049575 Bacteria 1109
288 Ga0501040_0003768 3300049576 Bacteria 9831
289 Ga0501041_0003513 3300049577 Bacteria 9016
290 Ga0501042_0058894 3300049578 Bacteria 2742
291 Ga0501042_0069731 3300049578 Bacteria 2514
292 Ga0501043_0003384 3300049579 Bacteria 13134
293 Ga0501043_0037995 3300049579 Bacteria 3786
294 Ga0501043_0125795 3300049579 Bacteria 2010
295 Ga0501043_0129877 3300049579 Bacteria 1974
296 Ga0501046_0016537 3300049580 Bacteria 6171
297 Ga0501046_0095198 3300049580 Bacteria 2288
298 Ga0501046_0359165 3300049580 Bacteria 1056
299 Ga0501047_0000005 3300049581 Bacteria 456524
300 Ga0501047_0019772 3300049581 Bacteria 6463
301 Ga0501047_0060222 3300049581 Bacteria 3664
302 Ga0501047_0208359 3300049581 Bacteria 1814
303 Ga0501047_0359631 3300049581 Bacteria 1291
304 Ga0501048_0010035 3300049582 Bacteria 7085
305 Ga0501067_0002980 3300049583 Bacteria 9340
306 Ga0501068_0008390 3300049584 Bacteria 5746
307 Ga0501069_0014652 3300049585 Bacteria 4193
308 Ga0501070_0012591 3300049586 Bacteria 7136
309 Ga0501070_0024194 3300049586 Bacteria 5092
310 Ga0501070_0136057 3300049586 Bacteria 2029
311 Ga0501071_0011161 3300049587 Bacteria 6041
312 Ga0501072_0005275 3300049588 Bacteria 9844
313 Ga0501073_0026809 3300049589 Bacteria 4125
314 Ga0501073_0185882 3300049589 Bacteria 1438
315 Ga0501074_0000869 3300049590 Bacteria 19255
316 Ga0501074_0046676 3300049590 Bacteria 3131
317 Ga0501076_0238460 3300049592 Bacteria 1487
318 Ga0501077_0376066 3300049593 Bacteria 907
319 Ga0501079_0008774 3300049741 Bacteria 7661
320 Ga0501079_0469277 3300049741 Bacteria 989
321 Ga0501080_0044762 3300049742 Bacteria 4119
322 Ga0501083_0013547 3300049744 Bacteria 5701
323 Ga0501035_0003104 3300049822 Bacteria 15958
324 Ga0501035_0089299 3300049822 Bacteria 2714
325 Ga0501035_0124444 3300049822 Bacteria 2251
326 Ga0501035_0164440 3300049822 Bacteria 1919
327 Ga0501035_0216844 3300049822 Bacteria 1635
328 Ga0501044_0004844 3300049823 Bacteria 15049
329 Ga0501044_0010090 3300049823 Bacteria 10264
330 Ga0501044_0014075 3300049823 Bacteria 8639
331 Ga0501044_0028078 3300049823 Bacteria 5939
332 Ga0501044_0032445 3300049823 Bacteria 5490
333 Ga0501044_0059848 3300049823 Bacteria 3902
334 Ga0501044_0310422 3300049823 Bacteria 1504
335 Ga0501044_0700176 3300049823 Bacteria 898
336 Ga0501045_0077235 3300049824 Bacteria 2453
337 Ga0501045_0684050 3300049824 Bacteria 757
338 nmdc:mga03n38_1464_c1 3300050490 Bacteria 6785
339 nmdc:mga0yw44_576153_c1 3300050492 Bacteria 764
340 nmdc:mga07m45_23653_c1 3300050496 Bacteria 3360
341 Ga0495612_0087644 3300053078 Bacteria 1314
342 Ga0495655_0004063 3300053083 Bacteria 2474
343 Ga0500578_0031264 3300053086 Bacteria 3420
344 Ga0500644_0022661 3300053088 Bacteria 1897
345 Ga0500651_0277803 3300053093 Bacteria 967
346 Ga0500566_0030501 3300053094 Bacteria 3144
347 Ga0500640_025038 3300053095 Bacteria 2595
348 Ga0500654_073687 3300053099 Bacteria 1644
349 Ga0500660_103515 3300053100 Bacteria 1234
350 Ga0500553_077470 3300053101 Bacteria 1508
351 Ga0500553_137714 3300053101 Bacteria 969
352 Ga0500560_001964 3300053107 Bacteria 3779
353 Ga0500560_039272 3300053107 Bacteria 1476
354 Ga0500569_090106 3300053109 Bacteria 992
355 Ga0500572_006798 3300053111 Bacteria 2629
356 Ga0500652_001275 3300053131 Bacteria 7985
357 Ga0500561_0000648 3300053137 Bacteria 5501
358 Ga0500573_0003323 3300053140 Bacteria 8309
359 Ga0500573_0041412 3300053140 Bacteria 2659
360 Ga0500579_012015 3300053143 Bacteria 5549
361 Ga0500600_0039976 3300053149 Bacteria 2711
362 Ga0500600_0138258 3300053149 Bacteria 1230
363 Ga0500616_0016149 3300053153 Bacteria 4256
364 Ga0500633_0000644 3300053160 Bacteria 5813
365 Ga0500634_0000429 3300053161 Bacteria 13600
366 Ga0500634_0161996 3300053161 Bacteria 1031
367 Ga0500656_002153 3300053732 Bacteria 1767
368 Ga0500587_004321 3300053739 Bacteria 1955
369 Ga0501084_0021233 3300054114 Bacteria 5414
370 Ga0501082_0040764 3300060353 Bacteria 4004
371 Ga0466962_0000710 3300061719 Bacteria 14828
372 Ga0530510_0052380 3300061734 Bacteria 2949
373 8056670450 8056667051 Bacteria 6953971
374 2547411805 2547132111 Bacteria 8013147
375 2554256652 2554235005 Bacteria 6457341
376 2585296056 2582581312 Bacteria 7308206
377 2585306201 2582581313 Bacteria 10042643
378 2585320674 2582581314 Bacteria 11452267
379 2616903115 2616644941 Bacteria 8510691
380 2643764641 2643221548 Bacteria 8053412
381 2643903083 2643221578 Bacteria 9213798
382 2643941857 2643221587 Bacteria 7586415
383 2644261423 2643221647 Bacteria 10741251
384 2644389479 2643221670 Bacteria 6497041
385 2644404407 2643221673 Bacteria 9196637
386 2644428940 2643221677 Bacteria 7584031
387 2644462026 2643221682 Bacteria 6743283
388 2644633131 2643221714 Bacteria 9015452
389 2768643636 2767802112 Bacteria 6465194
390 2784589882 2784132148 Bacteria 8627943
391 2785341719 2784746763 Bacteria 9783172
392 2785370947 2784746768 Bacteria 10036182
393 2786672123 2786546132 Bacteria 10419719
394 2793977666 2791355406 Bacteria 11364898
395 2808843500 2808606359 Bacteria 9866990
396 2808913074 2808606375 Bacteria 9466072
397 2809233552 2808606448 Bacteria 8656184
398 2811844947 2808606982 Bacteria 7791042
399 2812356541 2811994879 Bacteria 9313447
400 2812479273 2811994917 Bacteria 7761064
401 2819695106 2818991463 Bacteria 7948711
402 2852640146 2852635781 Bacteria 8251373
403 2862185176 2862178590 Bacteria 8583590
404 2862287169 2862281513 Bacteria 9621493
405 2862294640 2862290372 Bacteria 7471434
406 2862392305 2862382967 Bacteria 10317375
407 2862512029 2862507626 Bacteria 9425308
408 2862578033 2862574272 Bacteria 10567477
409 2862707012 2862705112 Bacteria 6563286
410 2863411413 2863404153 Bacteria 9672205
411 2867351834 2867346516 Bacteria 7608576
412 2867373357 2867369537 Bacteria 6501581
413 2867435621 2867428634 Bacteria 9590268
414 2867476428 2867475112 Bacteria 6909112
415 2873154567 2873151551 Bacteria 8625867
416 2875396169 2875391855 Bacteria 7600475
417 2877679637 2877676314 Bacteria 9512378
418 2912718277 2912715099 Bacteria 9460473
419 2912730648 2912723979 Bacteria 8557534
420 2912762272 2912757875 Bacteria 7940295
421 2918505961 2918501144 Bacteria 8668083
422 2919470383 2919468124 Bacteria 9133025
423 2946048447 2946045630 Bacteria 8527308
424 2946069325 2946064051 Bacteria 8957905
425 2946077266 2946072368 Bacteria 8999607
426 2947227588 2947224130 Bacteria 9938529
427 2954004901 2954002825 Bacteria 9173742
428 2954384542 2954380949 Bacteria 10050426
429 2954678396 2954673503 Bacteria 9685905
430 2954685759 2954682443 Bacteria 9862841
431 2954695398 2954691527 Bacteria 10720516
432 2954710589 2954701450 Bacteria 10834262
433 2954714835 2954711539 Bacteria 10867210
434 2954724780 2954721474 Bacteria 10456478
435 2954737038 2954731030 Bacteria 10243860
436 2954743705 2954740390 Bacteria 10229294
437 2954755889 2954749733 Bacteria 10366972
438 2954762658 2954759201 Bacteria 9358192
439 2966601325 2966598605 Bacteria 7676064
440 2990044941 2990044586 Bacteria 6603797
441 2990059755 2990059506 Bacteria 9321252
442 2990094140 2990088156 Bacteria 6657676
443 2997457986 2997451912 Bacteria 8492419
444 2997600508 2997600082 Bacteria 9896405
445 3006397728 3006393351 Bacteria 6615579
446 3006498968 3006493962 Bacteria 8825450
447 8008491466 8008485437 Bacteria 7198341
448 8008566705 8008558824 Bacteria 10610750
449 8023631704 8023623736 Bacteria 8593882
450 8025482314 8025478263 Bacteria 8209203
451 8025530796 8025524527 Bacteria 7197316
452 8025532517 8025530807 Bacteria 8495698
453 8033687120 8033684223 Bacteria 6906479
454 8047898190 8047893842 Bacteria 11723082
455 8048136706 8048127548 Bacteria 11053136
456 8048360703 8048356638 Bacteria 11044339
457 8048375153 8048369669 Bacteria 11666822
458 8048383053 8048379754 Bacteria 11877923
459 8048413685 8048406513 Bacteria 8936924
460 8054166752 8054160619 Bacteria 7783213
461 8056454098 8056447290 Bacteria 7680491
462 8056837458 8056829672 Bacteria 9045328
463 JGI24737J22298_10095253
464 rootH1_10054529
465 JGI25160J50197_1014965
466 JGI25160J50197_1057016
467 Ga0006562J51391_1047751
468 Ga0006562J51391_1047752
469 Ga0006562J51391_1070275
470 Ga0006562J51391_1070278
471 Ga0070706_100962208
472 Ga0068853_100118623
473 Ga0070672_100636792
474 Ga0070665_100181924
475 Ga0068855_100901691
476 Ga0068856_100464478
477 Ga0068863_100656797
478 Ga0075368_10287068
479 Ga0105245_10357501
480 Ga0105243_10030949
481 Ga0105248_10070895
482 Ga0105249_10963624
483 Ga0105239_10297359
484 Ga0105246_10025557
485 Ga0157372_10212551
486 Ga0157375_10648301
487 Ga0182008_10001038
488 Ga0182006_1058341
489 Ga0182007_10000455
490 Ga0183367_1002
491 Ga0209758_1002040
492 Ga0207426_1000693
493 Ga0207426_1000709
494 Ga0207426_1027926
495 Ga0207426_1038897
496 Ga0207647_10031195
497 Ga0207709_10255523
498 Ga0207691_10313344
499 Ga0207667_10808718
500 Ga0207639_10092635
501 Ga0207702_10340668
502 Ga0207641_10306493
503 Ga0207674_11021930
504 Ga0209371_1021970
505 Ga0209371_1041188
506 Ga0209282_1043187
507 Ga0268266_10070159
508 Ga0307517_10003518
509 Ga0307517_10022088
510 Ga0307515_10000497
511 Ga0307515_10045831
512 Ga0307515_10332762
513 Ga0268256_1024742
514 Ga0268256_1034832
515 Ga0268256_1053541
516 Ga0307511_10001205
517 Ga0307511_10005620
518 Ga0307511_10060759
519 Ga0307512_10000703
520 Ga0307512_10110983
521 Ga0307513_10027300
522 Ga0307513_10225450
523 Ga0307509_10056490
524 Ga0307509_10060065
525 Ga0307509_10095374
526 Ga0307509_10148080
527 Ga0307408_100483390
528 Ga0307508_10002329
529 Ga0307508_10002425
530 Ga0307508_10043387
531 Ga0307508_10100656
532 Ga0307514_10004286
533 Ga0307514_10062879
534 Ga0307514_10062962
535 Ga0307514_10118697
536 Ga0307516_10007174
537 Ga0307516_10016383
538 Ga0307516_10069163
539 Ga0307516_10256518
540 Ga0307516_10342480
541 Ga0307518_10073032
542 Ga0307518_10098480
543 Ga0307416_100267100
544 Ga0307507_10023296
545 Ga0307507_10117305
546 Ga0307510_10030390
547 Ga0307510_10032532
548 Ga0307510_10059604
549 Ga0307510_10173725
550 Ga0395898_0003234
551 Ga0395898_0021405
552 Ga0395905_0685584
553 Ga0436364_1200369
554 Ga0395901_0429603
555 Ga0439436_0044896
556 Ga0439439_0185150
557 Ga0451802_0490948
558 Ga0451853_0290340
559 Ga0451853_1727470
560 Ga0451853_3959824
561 Ga0439433_0012159
562 Ga0439442_011314
563 Ga0439448_0078357
564 Ga0439449_0004174
565 Ga0439449_0027790
566 Ga0439455_0006274
567 Ga0439457_000113
568 Ga0439457_008096
569 Ga0439457_021767
570 Ga0439462_0001589
571 Ga0439462_0082612
572 Ga0450894_000178
573 Ga0450895_001990
574 Ga0450896_000229
575 Ga0450899_001646
576 Ga0450903_000262
577 Ga0450903_019847
578 Ga0450906_000063
579 Ga0450907_003604
580 Ga0439458_0000248
581 Ga0466969_0010312
582 Ga0466972_0008630
583 Ga0466972_0010945
584 Ga0466972_0011196
585 Ga0466972_0033172
586 Ga0466965_0007400
587 Ga0466965_0028664
588 Ga0466966_0000771
589 Ga0466966_0021436
590 Ga0466961_0001621
591 Ga0466961_0002207
592 Ga0466963_0000226
593 Ga0466963_0004317
594 Ga0466971_0395153
595 Ga0466968_0007028
596 Ga0466970_0000866
597 Ga0466957_0002141
598 Ga0466960_0006672
599 Ga0466959_0004451
600 Ga0466959_0116611
601 Ga0466958_0003155
602 Ga0466967_0004961
603 Ga0466967_0093870
604 Ga0466967_0201288
605 Ga0495617_143423
606 Ga0495592_0180630
607 Ga0495603_0000778
608 Ga0495603_0001524
609 Ga0495603_0005574
610 Ga0495603_0020208
611 Ga0495603_0021315
612 Ga0495603_0462267
613 Ga0495629_0002618
614 Ga0495629_0002696
615 Ga0495629_0011762
616 Ga0495629_0161259
617 Ga0495629_0370402
618 Ga0495638_0050789
619 Ga0495638_0057970
620 Ga0495651_0114051
621 Ga0495582_0020536
622 Ga0495639_0018184
623 Ga0495662_0005773
624 Ga0495662_0006552
625 Ga0495664_0000654
626 Ga0495585_0148747
627 Ga0495594_0001288
628 Ga0495594_0009281
629 Ga0495594_0081911
630 Ga0495594_0299877
631 Ga0495607_0093735
632 Ga0495607_0150928
633 Ga0495583_0022885
634 Ga0495618_0027910
635 Ga0495620_0066850
636 Ga0495631_0082097
637 Ga0495631_0110567
638 Ga0495632_0020685
639 Ga0495637_0103014
640 Ga0495643_0001773
641 Ga0495652_0080016
642 Ga0495587_0077632
643 Ga0495645_0021900
644 Ga0495622_0003589
645 Ga0495622_0018901
646 Ga0495622_0242420
647 Ga0495633_0100809
648 Ga0495633_0108349
649 Ga0495656_0190888
650 Ga0495668_0126487
651 Ga0495634_0003466
652 Ga0495611_0018573
653 Ga0495625_0016419
654 Ga0495625_0036445
655 Ga0495635_0001262
656 Ga0495661_0110131
657 Ga0495588_0001332
658 Ga0495588_0030498
659 Ga0495588_0061015
660 Ga0495657_0003053
661 Ga0495657_0008961
662 Ga0495599_0070785
663 Ga0495623_0184105
664 Ga0495646_0001937
665 Ga0495658_0082506
666 Ga0495658_0147956
667 Ga0495613_0001468
668 Ga0495613_0030869
669 Ga0495613_0031118
670 Ga0495613_0084218
671 Ga0495624_0177585
672 Ga0495670_0085692
673 Ga0495670_0088556
674 Ga0495670_0118576
675 Ga0495671_0054880
676 Ga0495649_0291544
677 Ga0495589_0005767
678 Ga0495589_0021602
679 Ga0495589_0136790
680 Ga0495589_0178425
681 Ga0495600_0083154
682 Ga0495660_0005949
683 Ga0495581_0000686
684 Ga0495604_0155923
685 Ga0495604_0286592
686 Ga0495636_0012661
687 Ga0495636_0020216
688 Ga0495674_0189601
689 Ga0495676_0003115
690 Ga0495676_0030031
691 Ga0495676_0043214
692 Ga0495676_0078719
693 Ga0495676_0330378
694 Ga0495683_0099572
695 Ga0495687_001741
696 Ga0495687_013872
697 Ga0495687_034070
698 Ga0495675_0173004
699 Ga0495685_000285
700 Ga0495685_000604
701 Ga0495685_001084
702 Ga0495685_005966
703 Ga0495685_015132
704 Ga0495685_022056
705 Ga0495681_0001283
706 Ga0495681_0002414
707 Ga0495681_0103853
708 Ga0495686_0018514
709 Ga0495593_0012646
710 Ga0495602_0016781
711 Ga0495614_0000974
712 Ga0495614_0024612
713 Ga0495614_0028112
714 Ga0495614_0045817
715 Ga0496104_0718116
716 Ga0496108_0288035
717 Ga0496110_0131644
718 Ga0496113_0428439
719 Ga0501310_003138
720 Ga0501315_004663
721 Ga0501316_002810
722 Ga0501031_0004841
723 Ga0501031_0055211
724 Ga0501032_0006764
725 Ga0501032_0073963
726 Ga0501033_0001811
727 Ga0501033_0014796
728 Ga0501033_0119959
729 Ga0501033_0152204
730 Ga0501033_0260449
731 Ga0501033_0790714
732 Ga0501034_0002992
733 Ga0501034_0074481
734 Ga0501034_0114490
735 Ga0501034_0312148
736 Ga0501036_0011400
737 Ga0501036_0039226
738 Ga0501036_0063461
739 Ga0501037_0017371
740 Ga0501037_0052396
741 Ga0501037_0107038
742 Ga0501038_0001158
743 Ga0501038_0034940
744 Ga0501038_0047408
745 Ga0501038_0050166
746 Ga0501038_0269733
747 Ga0501039_0025184
748 Ga0501039_0099097
749 Ga0501039_0380271
750 Ga0501040_0003768
751 Ga0501041_0003513
752 Ga0501042_0058894
753 Ga0501042_0069731
754 Ga0501043_0003384
755 Ga0501043_0037995
756 Ga0501043_0125795
757 Ga0501043_0129877
758 Ga0501046_0016537
759 Ga0501046_0095198
760 Ga0501046_0359165
761 Ga0501047_0000005
762 Ga0501047_0019772
763 Ga0501047_0060222
764 Ga0501047_0208359
765 Ga0501047_0359631
766 Ga0501048_0010035
767 Ga0501067_0002980
768 Ga0501068_0008390
769 Ga0501069_0014652
770 Ga0501070_0012591
771 Ga0501070_0024194
772 Ga0501070_0136057
773 Ga0501071_0011161
774 Ga0501072_0005275
775 Ga0501073_0026809
776 Ga0501073_0185882
777 Ga0501074_0000869
778 Ga0501074_0046676
779 Ga0501076_0238460
780 Ga0501077_0376066
781 Ga0501079_0008774
782 Ga0501079_0469277
783 Ga0501080_0044762
784 Ga0501083_0013547
785 Ga0501035_0003104
786 Ga0501035_0089299
787 Ga0501035_0124444
788 Ga0501035_0164440
789 Ga0501035_0216844
790 Ga0501044_0004844
791 Ga0501044_0010090
792 Ga0501044_0014075
793 Ga0501044_0028078
794 Ga0501044_0032445
795 Ga0501044_0059848
796 Ga0501044_0310422
797 Ga0501044_0700176
798 Ga0501045_0077235
799 Ga0501045_0684050
800 nmdc:mga03n38_1464_c1
801 nmdc:mga0yw44_576153_c1
802 nmdc:mga07m45_23653_c1
803 Ga0495612_0087644
804 Ga0495655_0004063
805 Ga0500578_0031264
806 Ga0500644_0022661
807 Ga0500651_0277803
808 Ga0500566_0030501
809 Ga0500640_025038
810 Ga0500654_073687
811 Ga0500660_103515
812 Ga0500553_077470
813 Ga0500553_137714
814 Ga0500560_001964
815 Ga0500560_039272
816 Ga0500569_090106
817 Ga0500572_006798
818 Ga0500652_001275
819 Ga0500561_0000648
820 Ga0500573_0003323
821 Ga0500573_0041412
822 Ga0500579_012015
823 Ga0500600_0039976
824 Ga0500600_0138258
825 Ga0500616_0016149
826 Ga0500633_0000644
827 Ga0500634_0000429
828 Ga0500634_0161996
829 Ga0500656_002153
830 Ga0500587_004321
831 Ga0501084_0021233
832 Ga0501082_0040764
833 Ga0466962_0000710
834 Ga0530510_0052380
835 8056670450
836 2547411805
837 2554256652
838 2585296056
839 2585306201
840 2585320674
841 2616903115
842 2643764641
843 2643903083
844 2643941857
845 2644261423
846 2644389479
847 2644404407
848 2644428940
849 2644462026
850 2644633131
851 2768643636
852 2784589882
853 2785341719
854 2785370947
855 2786672123
856 2793977666
857 2808843500
858 2808913074
859 2809233552
860 2811844947
861 2812356541
862 2812479273
863 2819695106
864 2852640146
865 2862185176
866 2862287169
867 2862294640
868 2862392305
869 2862512029
870 2862578033
871 2862707012
872 2863411413
873 2867351834
874 2867373357
875 2867435621
876 2867476428
877 2873154567
878 2875396169
879 2877679637
880 2912718277
881 2912730648
882 2912762272
883 2918505961
884 2919470383
885 2946048447
886 2946069325
887 2946077266
888 2947227588
889 2954004901
890 2954384542
891 2954678396
892 2954685759
893 2954695398
894 2954710589
895 2954714835
896 2954724780
897 2954737038
898 2954743705
899 2954755889
900 2954762658
901 2966601325
902 2990044941
903 2990059755
904 2990094140
905 2997457986
906 2997600508
907 3006397728
908 3006498968
909 8008491466
910 8008566705
911 8023631704
912 8025482314
913 8025530796
914 8025532517
915 8033687120
916 8047898190
917 8048136706
918 8048360703
919 8048375153
920 8048383053
921 8048413685
922 8054166752
923 8056454098
924 8056837458

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13563

2_5_RNA_ligase2

2'-5' RNA ligase superfamily

47

197

0.93

PF02834

LigT_PEase

LigT like Phosphoesterase

51

122

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d4g-assembly1.cif.gz_B structure of yjcg protein, a putative 2'-5' rna ligase from bacillus subtilis 0.9146 5 173
2d4g-assembly1.cif.gz_B structure of yjcg protein, a putative 2'-5' rna ligase from bacillus subtilis 0.9044 5 173
6epi-assembly1.cif.gz_B structure of the epsilon_1 / zeta_1 antitoxin / toxin system from neisseria gonorrhoeae in complex with unam-4p. 0.8095 151 175
7yff-assembly1.cif.gz_B structure of glun1a-glun2d nmda receptor in complex with agonist glycine and competitive antagonist cpp. 0.8026 152 174
6epg-assembly1.cif.gz_B structure of the epsilon_1 / zeta_1 antitoxin / toxin system from neisseria gonorrhoeae. 0.7885 151 175
ID Description Score Start End Superfamily
2d4gB00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.9148 6 173 3.90.1140.10
2d4gB00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.9044 6 173 3.90.1140.10
af_Q2FZP9_3_169_3.90.1140.10 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.9043 7 172 3.90.1140.10
af_Q2FZP9_3_169_3.90.1140.10 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.8889 7 172 3.90.1140.10
af_Q9EQ15_175_325_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.833 151 172 2.40.128.630
ID Description Score Start End GO Terms
AF-A0A6B3G3I4-F1-model_v4 2'-5' RNA ligase family protein 0.9973 58 173 GO:0016874
AF-A0A6G2ZU01-F1-model_v4 deleted 0.9951 1 173
AF-A0A7X0HCC8-F1-model_v4 2'-5' RNA ligase 0.9942 1 174 GO:0016874
AF-A0A7C6HQY8-F1-model_v4 2'-5' RNA ligase family protein 0.9914 4 175 GO:0016874
AF-A0A853ABX3-F1-model_v4 2'-5' RNA ligase 0.9906 2 172 GO:0016874

Map