F449017

General Info

Members Datasets Scaffolds Average Seq Length
462 249 451 359

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2929212328|2929216090
Length 396
Sequence ESQQIDPRLLASFGANRTSRRRFIGGSAAAAAALALGSSVLAACGGSDSGSASSASPTDDGGPVSGNLRISNWPLYMADGFIAAFQTATGLTVDYKEDYNDNEEWFAKVKEPLSRGQDIGADLVVPTQFMAARLNGLGWLNEIGDARWTNKKNMLPELMASPVDDGRKFSAPYMSYMVGLAYNRAATGRDITKVDDLWDPAFKGKVSLFSDPQDGLGMIMQSQGNSPQNPSTQTVQQAVDLIREQKDRGQIRRFTGNDYSDDLAAGNLIVAQAYSGDVVQLQKDNPDLKFVIPESGGLTSIDTMVIPKTTQNRAAAEEWINYVYDRANYAKLIAFTQYVPVLSDMDAELSKIDPNLAKNPLINPPQATRDKLTTWPSLTDEQTQEYNAAYAAVTGA

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
4 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
5 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
6 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
7 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
8 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
9 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
10 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
11 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
148 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
149 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
150 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
151 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
152 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
153 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
154 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
155 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
156 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
157 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
158 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
228 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
229 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
230 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
231 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
232 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
233 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
242 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
243 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
244 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
245 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
246 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.62
Metatranscriptomes 0
Isolates 2.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.77
Nodule 0.22
Rhizoplane 11.04
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 9.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10004752 3300002077 Bacteria 2807
2 JGI24744J21845_10011463 3300002077 Bacteria 1813
3 JGI24034J26672_10003032 3300002239 Bacteria 2328
4 JGI25407J50210_10002788 3300003373 Bacteria 4152
5 Ga0055540_1001265 3300003792 Bacteria 15402
6 Ga0055540_1003233 3300003792 Bacteria 7989
7 Ga0055540_1012911 3300003792 Bacteria 2589
8 Ga0070676_10060482 3300005328 Bacteria 2250
9 Ga0070670_100126733 3300005331 Bacteria 2204
10 Ga0068869_100072600 3300005334 Bacteria 2550
11 Ga0068869_100251438 3300005334 Bacteria 1412
12 Ga0070666_10029480 3300005335 Bacteria 3608
13 Ga0070666_10173459 3300005335 Bacteria 1511
14 Ga0070682_100001675 3300005337 Bacteria 12333
15 Ga0068868_100108112 3300005338 Bacteria 2257
16 Ga0070668_100000276 3300005347 Bacteria 33981
17 Ga0070668_100002744 3300005347 Bacteria 12961
18 Ga0070668_100015363 3300005347 Bacteria 5722
19 Ga0070668_100143123 3300005347 Bacteria 1928
20 Ga0070669_100001256 3300005353 Bacteria 18407
21 Ga0070675_100209365 3300005354 Bacteria 1694
22 Ga0070671_100000377 3300005355 Bacteria 30681
23 Ga0070674_100013812 3300005356 Bacteria 5002
24 Ga0070674_100047463 3300005356 Bacteria 2943
25 Ga0070659_100139310 3300005366 Bacteria 1975
26 Ga0070659_100195972 3300005366 Bacteria 1661
27 Ga0070667_100000877 3300005367 Bacteria 27795
28 Ga0070667_100000920 3300005367 Bacteria 27197
29 Ga0070667_100011510 3300005367 Bacteria 7317
30 Ga0070709_10005837 3300005434 Bacteria 6674
31 Ga0070710_10001503 3300005437 Bacteria 10991
32 Ga0070701_10000925 3300005438 Bacteria 10625
33 Ga0070711_100000402 3300005439 Bacteria 22353
34 Ga0070711_100002219 3300005439 Bacteria 11011
35 Ga0070700_100003324 3300005441 Bacteria 8289
36 Ga0070700_100055620 3300005441 Bacteria 2477
37 Ga0070694_100118456 3300005444 Bacteria 1897
38 Ga0070694_100124841 3300005444 Bacteria 1851
39 Ga0070663_100006109 3300005455 Bacteria 7207
40 Ga0070678_100001104 3300005456 Bacteria 14151
41 Ga0068867_100000667 3300005459 Bacteria 22759
42 Ga0070685_10039180 3300005466 Bacteria 2691
43 Ga0068853_100002662 3300005539 Bacteria 13458
44 Ga0068853_100103393 3300005539 Bacteria 2521
45 Ga0070672_100223731 3300005543 Bacteria 1579
46 Ga0070686_100176251 3300005544 Bacteria 1516
47 Ga0070695_100023206 3300005545 Bacteria 3810
48 Ga0070695_100205862 3300005545 Bacteria 1409
49 Ga0070696_100001988 3300005546 Bacteria 13423
50 Ga0070696_100012698 3300005546 Bacteria 5656
51 Ga0070665_100006012 3300005548 Bacteria 12411
52 Ga0070665_100018650 3300005548 Bacteria 6954
53 Ga0070665_100051243 3300005548 Bacteria 4140
54 Ga0070704_100001144 3300005549 Bacteria 13849
55 Ga0070704_100009350 3300005549 Bacteria 5917
56 Ga0068855_100131684 3300005563 Bacteria 2856
57 Ga0068854_100002798 3300005578 Bacteria 10838
58 Ga0070702_100004350 3300005615 Bacteria 6459
59 Ga0070702_100039809 3300005615 Bacteria 2625
60 Ga0068852_100093019 3300005616 Bacteria 2701
61 Ga0068859_100000115 3300005617 Bacteria 75584
62 Ga0068859_100087688 3300005617 Bacteria 3160
63 Ga0068859_100196147 3300005617 Bacteria 2103
64 Ga0068864_100019318 3300005618 Bacteria 5697
65 Ga0068864_100185920 3300005618 Bacteria 1902
66 Ga0068866_10000674 3300005718 Bacteria 15478
67 Ga0068861_100082816 3300005719 Bacteria 2515
68 Ga0068861_100101634 3300005719 Bacteria 2287
69 Ga0068863_100000277 3300005841 Bacteria 53361
70 Ga0068863_100006312 3300005841 Bacteria 11635
71 Ga0068858_100001285 3300005842 Bacteria 25947
72 Ga0068858_100017982 3300005842 Bacteria 6621
73 Ga0068858_100053553 3300005842 Bacteria 3732
74 Ga0068860_100000044 3300005843 Bacteria 225595
75 Ga0068860_100000775 3300005843 Bacteria 35961
76 Ga0068860_100131473 3300005843 Bacteria 2402
77 Ga0068862_100000003 3300005844 Bacteria 369793
78 Ga0068862_100099281 3300005844 Bacteria 2544
79 Ga0068862_100201076 3300005844 Bacteria 1796
80 Ga0081455_10004404 3300005937 Bacteria 15825
81 Ga0081455_10009266 3300005937 Bacteria 10140
82 Ga0081455_10038577 3300005937 Bacteria 4229
83 Ga0081538_10001047 3300005981 Bacteria 29464
84 Ga0081538_10019363 3300005981 Bacteria 5061
85 Ga0081538_10021223 3300005981 Bacteria 4751
86 Ga0075365_10010242 3300006038 Bacteria 5448
87 Ga0075363_100007925 3300006048 Bacteria 4919
88 Ga0075363_100022652 3300006048 Bacteria 3177
89 Ga0075364_10006302 3300006051 Bacteria 6967
90 Ga0075364_10013146 3300006051 Bacteria 5079
91 Ga0075364_10016079 3300006051 Bacteria 4650
92 Ga0075364_10024376 3300006051 Bacteria 3841
93 Ga0075364_10043538 3300006051 Bacteria 2919
94 Ga0075364_10055520 3300006051 Bacteria 2591
95 Ga0075364_10089066 3300006051 Bacteria 2046
96 Ga0070716_100041275 3300006173 Bacteria 2570
97 Ga0070716_100111921 3300006173 Bacteria 1693
98 Ga0070712_100001056 3300006175 Bacteria 16636
99 Ga0070712_100050151 3300006175 Bacteria 2902
100 Ga0075362_10030225 3300006177 Bacteria 2339
101 Ga0075367_10008353 3300006178 Bacteria 5363
102 Ga0075369_10002033 3300006186 Bacteria 7127
103 Ga0075369_10011745 3300006186 Bacteria 3449
104 Ga0075369_10012186 3300006186 Bacteria 3395
105 Ga0075370_10000913 3300006353 Bacteria 12127
106 Ga0075370_10013556 3300006353 Bacteria 4338
107 Ga0075370_10031116 3300006353 Bacteria 2979
108 Ga0075428_100020199 3300006844 Bacteria 7377
109 Ga0075430_100097238 3300006846 Bacteria 2460
110 Ga0075431_100156257 3300006847 Bacteria 2346
111 Ga0075431_100160727 3300006847 Bacteria 2310
112 Ga0075429_100150572 3300006880 Bacteria 2037
113 Ga0097620_100000115 3300006931 Bacteria 75584
114 Ga0097620_100087689 3300006931 Bacteria 3160
115 Ga0097620_100196148 3300006931 Bacteria 2103
116 Ga0099795_10002078 3300007788 Bacteria 4600
117 Ga0111539_10511270 3300009094 Bacteria 1399
118 Ga0105245_10097767 3300009098 Bacteria 2711
119 Ga0105245_10172418 3300009098 Bacteria 2061
120 Ga0105245_10210537 3300009098 Bacteria 1871
121 Ga0105247_10000006 3300009101 Bacteria 416061
122 Ga0105247_10000963 3300009101 Bacteria 21722
123 Ga0105247_10056515 3300009101 Bacteria 2424
124 Ga0105247_10074229 3300009101 Bacteria 2132
125 Ga0105243_10002663 3300009148 Bacteria 14835
126 Ga0105243_10117866 3300009148 Bacteria 2233
127 Ga0105242_10000459 3300009176 Bacteria 32413
128 Ga0105248_10000062 3300009177 Bacteria 124366
129 Ga0105248_10003658 3300009177 Bacteria 17060
130 Ga0105237_10044500 3300009545 Bacteria 4470
131 Ga0105237_10072017 3300009545 Bacteria 3450
132 Ga0105237_10171561 3300009545 Bacteria 2169
133 Ga0105249_10000008 3300009553 Bacteria 341271
134 Ga0105249_10030325 3300009553 Bacteria 4889
135 Ga0105249_10152555 3300009553 Bacteria 2225
136 Ga0099796_10004588 3300010159 Bacteria 3361
137 Ga0105239_10004121 3300010375 Bacteria 17467
138 Ga0105239_10032818 3300010375 Bacteria 5705
139 Ga0105239_10045701 3300010375 Bacteria 4799
140 Ga0105239_10228305 3300010375 Bacteria 2088
141 Ga0157369_10231903 3300013105 Bacteria 1930
142 Ga0157374_10023822 3300013296 Bacteria 5481
143 Ga0157378_10205593 3300013297 Bacteria 1864
144 Ga0163162_10011983 3300013306 Bacteria 8456
145 Ga0163162_10050133 3300013306 Bacteria 4186
146 Ga0163162_10107612 3300013306 Bacteria 2884
147 Ga0163162_10158412 3300013306 Bacteria 2385
148 Ga0163162_10325563 3300013306 Bacteria 1669
149 Ga0163162_10355268 3300013306 Bacteria 1598
150 Ga0157372_10170385 3300013307 Bacteria 2519
151 Ga0157372_10313520 3300013307 Bacteria 1826
152 Ga0157375_10138870 3300013308 Bacteria 2555
153 Ga0163163_10205560 3300014325 Bacteria 2017
154 Ga0157380_10028427 3300014326 Bacteria 4263
155 Ga0157377_10104505 3300014745 Bacteria 1693
156 Ga0157379_10040857 3300014968 Bacteria 4140
157 Ga0157376_10027668 3300014969 Bacteria 4497
158 Ga0163161_10002277 3300017792 Bacteria 13770
159 Ga0163161_10137697 3300017792 Bacteria 1846
160 Ga0209025_1043406 3300025294 Bacteria 1895
161 Ga0209051_1000652 3300025303 Bacteria 39235
162 Ga0209051_1001152 3300025303 Bacteria 24033
163 Ga0209051_1011577 3300025303 Bacteria 4343
164 Ga0209051_1030967 3300025303 Bacteria 2067
165 Ga0207692_10005872 3300025898 Bacteria 4948
166 Ga0207642_10109967 3300025899 Bacteria 1401
167 Ga0207710_10000025 3300025900 Bacteria 314658
168 Ga0207710_10007952 3300025900 Bacteria 4484
169 Ga0207688_10015470 3300025901 Bacteria 4138
170 Ga0207680_10018650 3300025903 Bacteria 3694
171 Ga0207680_10051817 3300025903 Bacteria 2456
172 Ga0207699_10036449 3300025906 Bacteria 2804
173 Ga0207645_10016970 3300025907 Bacteria 4810
174 Ga0207671_10003210 3300025914 Bacteria 16463
175 Ga0207671_10032798 3300025914 Bacteria 3865
176 Ga0207671_10082433 3300025914 Bacteria 2413
177 Ga0207671_10195469 3300025914 Bacteria 1578
178 Ga0207693_10000381 3300025915 Bacteria 40785
179 Ga0207657_10078799 3300025919 Bacteria 2773
180 Ga0207681_10002490 3300025923 Bacteria 11697
181 Ga0207681_10099761 3300025923 Bacteria 2092
182 Ga0207659_10073055 3300025926 Bacteria 2510
183 Ga0207687_10094512 3300025927 Bacteria 2188
184 Ga0207687_10163486 3300025927 Bacteria 1711
185 Ga0207644_10022743 3300025931 Bacteria 4286
186 Ga0207644_10235720 3300025931 Bacteria 1455
187 Ga0207706_10003648 3300025933 Bacteria 14710
188 Ga0207706_10006665 3300025933 Bacteria 10677
189 Ga0207686_10058273 3300025934 Bacteria 2434
190 Ga0207709_10008188 3300025935 Bacteria 5789
191 Ga0207709_10076069 3300025935 Bacteria 2148
192 Ga0207670_10003336 3300025936 Bacteria 8515
193 Ga0207665_10006892 3300025939 Bacteria 7521
194 Ga0207665_10032771 3300025939 Bacteria 3440
195 Ga0207691_10049194 3300025940 Bacteria 3863
196 Ga0207691_10223061 3300025940 Bacteria 1634
197 Ga0207711_10000674 3300025941 Bacteria 33924
198 Ga0207711_10222421 3300025941 Bacteria 1727
199 Ga0207689_10150914 3300025942 Bacteria 1915
200 Ga0207667_10282101 3300025949 Bacteria 1697
201 Ga0207651_10037822 3300025960 Bacteria 3165
202 Ga0207712_10000011 3300025961 Bacteria 412321
203 Ga0207712_10008012 3300025961 Bacteria 6681
204 Ga0207712_10014006 3300025961 Bacteria 5146
205 Ga0207668_10000126 3300025972 Bacteria 54346
206 Ga0207668_10008233 3300025972 Bacteria 6213
207 Ga0207640_10002814 3300025981 Bacteria 9328
208 Ga0207658_10000659 3300025986 Bacteria 30114
209 Ga0207658_10003144 3300025986 Bacteria 11814
210 Ga0207658_10010623 3300025986 Bacteria 6257
211 Ga0207658_10015777 3300025986 Bacteria 5186
212 Ga0207658_10114538 3300025986 Bacteria 2138
213 Ga0207677_10008156 3300026023 Bacteria 5832
214 Ga0207677_10045234 3300026023 Bacteria 2938
215 Ga0207703_10002416 3300026035 Bacteria 16220
216 Ga0207703_10026816 3300026035 Bacteria 4538
217 Ga0207703_10052071 3300026035 Bacteria 3322
218 Ga0207639_10192529 3300026041 Bacteria 1743
219 Ga0207678_10012289 3300026067 Bacteria 7518
220 Ga0207678_10222373 3300026067 Bacteria 1616
221 Ga0207708_10015436 3300026075 Bacteria 5729
222 Ga0207708_10040365 3300026075 Bacteria 3558
223 Ga0207641_10003526 3300026088 Bacteria 13849
224 Ga0207648_10000462 3300026089 Bacteria 45206
225 Ga0207648_10099604 3300026089 Bacteria 2545
226 Ga0207676_10269135 3300026095 Bacteria 1542
227 Ga0207675_100029687 3300026118 Bacteria 5092
228 Ga0207675_100142963 3300026118 Bacteria 2274
229 Ga0207683_10000575 3300026121 Bacteria 33996
230 Ga0207683_10023444 3300026121 Bacteria 5310
231 Ga0207698_10073782 3300026142 Bacteria 2718
232 Ga0207698_10246198 3300026142 Bacteria 1633
233 Ga0209179_1007326 3300027512 Bacteria 1818
234 Ga0268266_10045198 3300028379 Bacteria 3767
235 Ga0268266_10116346 3300028379 Bacteria 2374
236 Ga0268265_10000010 3300028380 Bacteria 370129
237 Ga0268265_10045778 3300028380 Bacteria 3267
238 Ga0268265_10313047 3300028380 Bacteria 1418
239 Ga0268264_10000007 3300028381 Bacteria 815790
240 Ga0268264_10039666 3300028381 Bacteria 3891
241 Ga0307413_10158615 3300031824 Bacteria 1586
242 Ga0307409_100007704 3300031995 Bacteria 6469
243 Ga0307409_100017833 3300031995 Bacteria 4747
244 Ga0307409_100137114 3300031995 Bacteria 2102
245 Ga0307416_100064392 3300032002 Bacteria 3007
246 Ga0373937_0127004 3300036401 Bacteria 2380
247 Ga0436365_0543858 3300039437 Bacteria 4274
248 Ga0439466_0003285 3300041411 Bacteria 6299
249 Ga0439465_0000467 3300041413 Bacteria 11943
250 Ga0439465_0002850 3300041413 Bacteria 5661
251 Ga0439465_0008235 3300041413 Bacteria 3292
252 Ga0439465_0053152 3300041413 Bacteria 1330
253 Ga0439431_0008052 3300041997 Bacteria 2362
254 Ga0439445_0005576 3300042004 Bacteria 2872
255 Ga0439448_0009298 3300042005 Bacteria 2895
256 Ga0439450_005041 3300042008 Bacteria 2296
257 Ga0439454_002964 3300042011 Bacteria 1848
258 Ga0439463_005691 3300042016 Bacteria 3096
259 Ga0439435_0016082 3300042436 Bacteria 1871
260 Ga0439464_0006797 3300042439 Bacteria 2983
261 Ga0466972_0012281 3300044658 Bacteria 4304
262 Ga0466972_0025283 3300044658 Bacteria 2944
263 Ga0466965_0004661 3300044683 Bacteria 6112
264 Ga0466965_0005902 3300044683 Bacteria 5529
265 Ga0466965_0187017 3300044683 Bacteria 1094
266 Ga0466966_0028007 3300044684 Bacteria 3671
267 Ga0466968_0004521 3300044735 Bacteria 5203
268 Ga0466968_0018019 3300044735 Bacteria 2830
269 Ga0466968_0041728 3300044735 Bacteria 1938
270 Ga0466970_0021866 3300044765 Bacteria 3337
271 Ga0466960_0001475 3300044901 Bacteria 8577
272 Ga0466960_0042266 3300044901 Bacteria 2163
273 Ga0466960_0211580 3300044901 Bacteria 1063
274 Ga0466959_0003572 3300045049 Bacteria 10233
275 Ga0466958_0017501 3300045836 Bacteria 4145
276 Ga0466967_0046255 3300045976 Bacteria 3788
277 Ga0466967_0137361 3300045976 Bacteria 2274
278 Ga0466967_0169875 3300045976 Bacteria 2051
279 Ga0495629_0060681 3300046459 Bacteria 2643
280 Ga0495638_0004021 3300046460 Bacteria 11283
281 Ga0495638_0004986 3300046460 Bacteria 9958
282 Ga0495648_0000871 3300046524 Bacteria 31818
283 Ga0495640_0012804 3300046533 Bacteria 6401
284 Ga0495668_0021101 3300046616 Bacteria 3740
285 Ga0495647_0043022 3300046681 Bacteria 1727
286 Ga0495658_0090324 3300046683 Bacteria 1813
287 Ga0495624_0030662 3300046690 Bacteria 3501
288 Ga0495649_0090334 3300046694 Bacteria 1633
289 Ga0495672_0009613 3300047320 Bacteria 6980
290 Ga0495672_0022101 3300047320 Bacteria 4140
291 Ga0495672_0090532 3300047320 Bacteria 1681
292 Ga0495672_0115009 3300047320 Bacteria 1438
293 Ga0495676_0030568 3300047321 Bacteria 4568
294 Ga0495686_0003859 3300047472 Bacteria 12667
295 Ga0495593_0025789 3300047673 Bacteria 3253
296 Ga0495626_0053565 3300048091 Bacteria 1856
297 Ga0496100_0000898 3300048903 Bacteria 14185
298 Ga0496100_0002625 3300048903 Bacteria 9165
299 Ga0496100_0006818 3300048903 Bacteria 6259
300 Ga0496100_0038522 3300048903 Bacteria 3030
301 Ga0496100_0060497 3300048903 Bacteria 2493
302 Ga0496101_0000002 3300048904 Bacteria 410971
303 Ga0496101_0000019 3300048904 Bacteria 220382
304 Ga0496101_0000065 3300048904 Bacteria 123942
305 Ga0496101_0002758 3300048904 Bacteria 10786
306 Ga0496101_0016599 3300048904 Bacteria 4980
307 Ga0496101_0068869 3300048904 Bacteria 2588
308 Ga0496102_0000007 3300048905 Bacteria 417224
309 Ga0496102_0000009 3300048905 Bacteria 344149
310 Ga0496102_0000402 3300048905 Bacteria 50427
311 Ga0496102_0003421 3300048905 Bacteria 13464
312 Ga0496102_0009359 3300048905 Bacteria 8416
313 Ga0496102_0028865 3300048905 Bacteria 4959
314 Ga0496102_0099047 3300048905 Bacteria 2705
315 Ga0496102_0223594 3300048905 Bacteria 1775
316 Ga0496103_0000005 3300048906 Bacteria 505416
317 Ga0496103_0000013 3300048906 Bacteria 297928
318 Ga0496103_0000651 3300048906 Bacteria 26280
319 Ga0496103_0002747 3300048906 Bacteria 10980
320 Ga0496103_0040337 3300048906 Bacteria 2868
321 Ga0496104_0005592 3300048907 Bacteria 11005
322 Ga0496105_0025929 3300048908 Bacteria 4776
323 Ga0496106_0001784 3300048909 Bacteria 16068
324 Ga0496106_0015872 3300048909 Bacteria 5571
325 Ga0496107_0001314 3300048910 Bacteria 15237
326 Ga0496107_0022512 3300048910 Bacteria 4453
327 Ga0496107_0049991 3300048910 Bacteria 3013
328 Ga0496107_0056392 3300048910 Bacteria 2839
329 Ga0496108_0001002 3300048911 Bacteria 22036
330 Ga0496108_0001176 3300048911 Bacteria 20414
331 Ga0496108_0044525 3300048911 Bacteria 3704
332 Ga0496109_0000256 3300048912 Bacteria 51465
333 Ga0496109_0028009 3300048912 Bacteria 5036
334 Ga0496109_0034599 3300048912 Bacteria 4552
335 Ga0496110_0003864 3300048913 Bacteria 11545
336 Ga0496110_0024788 3300048913 Bacteria 5118
337 Ga0496110_0270078 3300048913 Bacteria 1548
338 Ga0496110_0358263 3300048913 Bacteria 1329
339 Ga0496111_0108566 3300048914 Bacteria 2043
340 Ga0496112_0013299 3300048915 Bacteria 7599
341 Ga0496112_0027883 3300048915 Bacteria 5448
342 Ga0496112_0165141 3300048915 Bacteria 2180
343 Ga0496112_0190588 3300048915 Bacteria 2012
344 Ga0496113_0087524 3300048916 Bacteria 2395
345 Ga0496114_0000163 3300048917 Bacteria 47096
346 Ga0496115_0032238 3300048918 Bacteria 4133
347 Ga0496115_0073565 3300048918 Bacteria 2774
348 Ga0496116_0000033 3300048919 Bacteria 418191
349 Ga0496116_0000104 3300048919 Bacteria 193416
350 Ga0496116_0004723 3300048919 Bacteria 12867
351 Ga0496116_0007641 3300048919 Bacteria 9537
352 Ga0496117_0000019 3300048920 Bacteria 469256
353 Ga0496117_0000025 3300048920 Bacteria 418106
354 Ga0496117_0000190 3300048920 Bacteria 125026
355 Ga0496117_0071622 3300048920 Bacteria 2321
356 Ga0496118_0000020 3300048921 Bacteria 470521
357 Ga0496118_0000023 3300048921 Bacteria 418106
358 Ga0496118_0002690 3300048921 Bacteria 23417
359 Ga0496119_0001596 3300048922 Bacteria 26957
360 Ga0496119_0002576 3300048922 Bacteria 19713
361 Ga0496119_0005617 3300048922 Bacteria 11926
362 Ga0496119_0006869 3300048922 Bacteria 10398
363 Ga0496120_0000382 3300048923 Bacteria 71535
364 Ga0496120_0010739 3300048923 Bacteria 6352
365 Ga0496120_0034981 3300048923 Bacteria 3005
366 Ga0496120_0086211 3300048923 Bacteria 1689
367 Ga0496121_0000027 3300048924 Bacteria 444747
368 Ga0496121_0000039 3300048924 Bacteria 351444
369 Ga0496121_0000064 3300048924 Bacteria 272488
370 Ga0496121_0001772 3300048924 Bacteria 35094
371 Ga0496122_0000295 3300048925 Bacteria 110220
372 Ga0496124_0000016 3300048927 Bacteria 444747
373 Ga0496124_0006919 3300048927 Bacteria 12188
374 Ga0496125_0000008 3300048928 Bacteria 704677
375 Ga0496125_0008540 3300048928 Bacteria 10705
376 Ga0496126_0000025 3300048929 Bacteria 444747
377 Ga0496126_0000162 3300048929 Bacteria 153331
378 Ga0496126_0002244 3300048929 Bacteria 26663
379 Ga0496126_0007370 3300048929 Bacteria 12070
380 Ga0496126_0017449 3300048929 Bacteria 7151
381 Ga0501032_0009544 3300049569 Bacteria 7035
382 Ga0501033_0026722 3300049570 Bacteria 4342
383 Ga0501034_0015192 3300049571 Bacteria 7914
384 Ga0501034_0141403 3300049571 Bacteria 2386
385 Ga0501036_0003817 3300049572 Bacteria 12090
386 Ga0501036_0035685 3300049572 Bacteria 4207
387 Ga0501037_0000060 3300049573 Bacteria 100831
388 Ga0501037_0119670 3300049573 Bacteria 1894
389 Ga0501039_0001407 3300049575 Bacteria 17702
390 Ga0501039_0006999 3300049575 Bacteria 8587
391 Ga0501042_0024393 3300049578 Bacteria 4242
392 Ga0501042_0148183 3300049578 Bacteria 1692
393 Ga0501043_0002866 3300049579 Bacteria 14399
394 Ga0501046_0003011 3300049580 Bacteria 15578
395 Ga0501048_0027386 3300049582 Bacteria 4142
396 Ga0501070_0028628 3300049586 Bacteria 4672
397 Ga0501071_0098713 3300049587 Bacteria 2151
398 Ga0501072_0002649 3300049588 Bacteria 13413
399 Ga0501074_0126640 3300049590 Bacteria 1827
400 Ga0501075_0004226 3300049591 Bacteria 9704
401 Ga0501076_0006986 3300049592 Bacteria 8204
402 Ga0501076_0099395 3300049592 Bacteria 2344
403 Ga0501077_0019573 3300049593 Bacteria 4280
404 Ga0501079_0008238 3300049741 Bacteria 7899
405 Ga0501083_0111228 3300049744 Bacteria 1801
406 Ga0501044_0089035 3300049823 Bacteria 3116
407 Ga0501045_0004970 3300049824 Bacteria 9215
408 nmdc:mga03683_108445_c1 3300050489 Bacteria 1225
409 nmdc:mga03n38_16367_c1 3300050490 Bacteria 2883
410 nmdc:mga03n38_29335_c1 3300050490 Bacteria 2302
411 nmdc:mga03n38_31571_c1 3300050490 Bacteria 2236
412 nmdc:mga03n38_4652_c1 3300050490 Bacteria 4577
413 nmdc:mga00v17_11676_c1 3300050491 Bacteria 4831
414 nmdc:mga00v17_118233_c1 3300050491 Bacteria 1686
415 nmdc:mga00v17_13434_c1 3300050491 Bacteria 4546
416 nmdc:mga00v17_17329_c1 3300050491 Bacteria 4076
417 nmdc:mga00v17_291274_c1 3300050491 Bacteria 1060
418 nmdc:mga00v17_3626_c1 3300050491 Bacteria 7978
419 nmdc:mga00v17_936_c1 3300050491 Bacteria 11145
420 nmdc:mga0yw44_1249_c1 3300050492 Bacteria 9989
421 nmdc:mga0yw44_15689_c1 3300050492 Bacteria 4067
422 nmdc:mga0yw44_43728_c1 3300050492 Bacteria 2676
423 nmdc:mga0k408_83810_c1 3300050493 Bacteria 1869
424 nmdc:mga06z11_125218_c1 3300050494 Bacteria 1437
425 nmdc:mga06z11_151949_c1 3300050494 Bacteria 1317
426 nmdc:mga06z11_18762_c1 3300050494 Bacteria 3166
427 nmdc:mga07m45_10187_c1 3300050496 Bacteria 4901
428 nmdc:mga07m45_3696_c1 3300050496 Bacteria 7402
429 nmdc:mga05p37_156344_c1 3300050507 Bacteria 2786
430 nmdc:mga09592_113039_c1 3300050508 Bacteria 2330
431 nmdc:mga0qj67_88574_c1 3300050509 Bacteria 2485
432 nmdc:mga06r32_297184_c1 3300050510 Bacteria 1601
433 nmdc:mga0sz30_1185_c1 3300050516 Bacteria 9340
434 nmdc:mga0sz30_1263_c1 3300050516 Bacteria 9028
435 nmdc:mga0sz30_13518_c1 3300050516 Bacteria 3198
436 nmdc:mga0sz30_46014_c1 3300050516 Bacteria 1841
437 nmdc:mga0sz30_69864_c1 3300050516 Bacteria 1510
438 Ga0495601_0237962 3300053077 Bacteria 1189
439 Ga0495619_0059562 3300053085 Bacteria 2537
440 Ga0500643_008929 3300053087 Bacteria 3880
441 Ga0500642_0134271 3300053130 Bacteria 1160
442 Ga0500652_000547 3300053131 Bacteria 13106
443 Ga0500616_0025453 3300053153 Bacteria 3282
444 Ga0500627_0004430 3300053158 Bacteria 4513
445 Ga0500645_000035 3300053730 Bacteria 113679
446 Ga0500645_010693 3300053730 Bacteria 3022
447 Ga0501084_0017440 3300054114 Bacteria 5970
448 Ga0501084_0078040 3300054114 Bacteria 2776
449 Ga0466962_0032730 3300061719 Bacteria 2488
450 Ga0530510_0003778 3300061734 Bacteria 10427
451 Ga0530510_0006827 3300061734 Bacteria 7953

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044684 Ga0466966_0028007 Ga0466966_0028007_2678_3634 318
2 3300005618 Ga0068864_100185920 Ga0068864_1001859202 320
3 3300044683 Ga0466965_0187017 Ga0466965_0187017_91_1053 320
4 3300044901 Ga0466960_0211580 Ga0466960_0211580_53_1015 320
5 3300046460 Ga0495638_0004021 Ga0495638_0004021_105_1067 320
6 3300048913 Ga0496110_0358263 Ga0496110_0358263_24_986 320
7 3300050491 nmdc:mga00v17_291274_c1 nmdc:mga00v17_291274_c1_60_1022 320
8 3300050516 nmdc:mga0sz30_1185_c1 nmdc:mga0sz30_1185_c1_2913_3875 320
9 3300050516 nmdc:mga0sz30_69864_c1 nmdc:mga0sz30_69864_c1_413_1375 320
10 3300053077 Ga0495601_0237962 Ga0495601_0237962_37_999 320
11 3300053130 Ga0500642_0134271 Ga0500642_0134271_37_999 320
12 3300053153 Ga0500616_0025453 Ga0500616_0025453_2175_3137 320
13 3300042005 Ga0439448_0009298 Ga0439448_0009298_1346_2431 332
14 3300042008 Ga0439450_005041 Ga0439450_005041_159_1244 332
15 3300042011 Ga0439454_002964 Ga0439454_002964_408_1493 332
16 3300042016 Ga0439463_005691 Ga0439463_005691_1609_2694 332
17 3300042439 Ga0439464_0006797 Ga0439464_0006797_53_1138 332
18 3300050507 nmdc:mga05p37_156344_c1 nmdc:mga05p37_156344_c1_1532_2617 332
19 3300041411 Ga0439466_0003285 Ga0439466_0003285_5018_6151 333
20 3300041413 Ga0439465_0008235 Ga0439465_0008235_322_1455 333
21 3300049570 Ga0501033_0026722 Ga0501033_0026722_1311_2456 338
22 3300049572 Ga0501036_0035685 Ga0501036_0035685_2911_4056 338
23 3300049573 Ga0501037_0119670 Ga0501037_0119670_678_1823 338
24 3300049575 Ga0501039_0006999 Ga0501039_0006999_771_1916 338
25 3300049578 Ga0501042_0024393 Ga0501042_0024393_1413_2558 338
26 3300049580 Ga0501046_0003011 Ga0501046_0003011_7047_8192 338
27 3300049582 Ga0501048_0027386 Ga0501048_0027386_766_1911 338
28 3300049587 Ga0501071_0098713 Ga0501071_0098713_796_1941 338
29 3300049588 Ga0501072_0002649 Ga0501072_0002649_43_1188 338
30 3300049590 Ga0501074_0126640 Ga0501074_0126640_305_1450 338
31 3300049591 Ga0501075_0004226 Ga0501075_0004226_6778_7923 338
32 3300049592 Ga0501076_0006986 Ga0501076_0006986_285_1430 338
33 3300049593 Ga0501077_0019573 Ga0501077_0019573_781_1926 338
34 3300049741 Ga0501079_0008238 Ga0501079_0008238_2278_3423 338
35 3300049744 Ga0501083_0111228 Ga0501083_0111228_199_1344 338
36 3300049824 Ga0501045_0004970 Ga0501045_0004970_208_1353 338
37 3300054114 Ga0501084_0017440 Ga0501084_0017440_1791_2936 338
38 3300061734 Ga0530510_0003778 Ga0530510_0003778_6801_7946 338
39 3300046683 Ga0495658_0090324 Ga0495658_0090324_659_1798 340
40 3300050494 nmdc:mga06z11_151949_c1 nmdc:mga06z11_151949_c1_24_1229 341
41 3300039437 Ga0436365_0543858 Ga0436365_0543858_2398_3519 343
42 3300005347 Ga0070668_100015363 Ga0070668_1000153632 348
43 3300025972 Ga0207668_10008233 Ga0207668_100082339 348
44 3300047320 Ga0495672_0115009 Ga0495672_0115009_205_1392 348
45 3300048929 Ga0496126_0000162 Ga0496126_0000162_115323_116507 348
46 3300053087 Ga0500643_008929 Ga0500643_008929_1576_2763 348
47 3300053158 Ga0500627_0004430 Ga0500627_0004430_2264_3451 348
48 3300053730 Ga0500645_000035 Ga0500645_000035_30543_31730 348
49 3300053730 Ga0500645_010693 Ga0500645_010693_1638_2825 348
50 3300005337 Ga0070682_100001675 Ga0070682_1000016755 349
51 3300005353 Ga0070669_100001256 Ga0070669_10000125613 349
52 3300005367 Ga0070667_100000920 Ga0070667_10000092019 349
53 3300005548 Ga0070665_100018650 Ga0070665_1000186507 349
54 3300005617 Ga0068859_100000115 Ga0068859_10000011550 349
55 3300005841 Ga0068863_100000277 Ga0068863_10000027710 349
56 3300005842 Ga0068858_100017982 Ga0068858_1000179823 349
57 3300005843 Ga0068860_100000044 Ga0068860_10000004448 349
58 3300005844 Ga0068862_100000003 Ga0068862_100000003183 349
59 3300006048 Ga0075363_100022652 Ga0075363_1000226522 349
60 3300006931 Ga0097620_100000115 Ga0097620_10000011550 349
61 3300009101 Ga0105247_10000006 Ga0105247_10000006138 349
62 3300009177 Ga0105248_10000062 Ga0105248_1000006245 349
63 3300009553 Ga0105249_10000008 Ga0105249_10000008275 349
64 3300010375 Ga0105239_10228305 Ga0105239_102283052 349
65 3300014968 Ga0157379_10040857 Ga0157379_100408575 349
66 3300025900 Ga0207710_10000025 Ga0207710_10000025149 349
67 3300025923 Ga0207681_10002490 Ga0207681_100024908 349
68 3300025941 Ga0207711_10000674 Ga0207711_1000067413 349
69 3300025961 Ga0207712_10000011 Ga0207712_1000001146 349
70 3300025986 Ga0207658_10000659 Ga0207658_1000065919 349
71 3300026035 Ga0207703_10026816 Ga0207703_100268162 349
72 3300028380 Ga0268265_10000010 Ga0268265_10000010183 349
73 3300028381 Ga0268264_10000007 Ga0268264_10000007717 349
74 3300046694 Ga0495649_0090334 Ga0495649_0090334_397_1590 349
75 3300047320 Ga0495672_0090532 Ga0495672_0090532_39_1205 349
76 3300048903 Ga0496100_0038522 Ga0496100_0038522_1061_2260 349
77 3300048904 Ga0496101_0068869 Ga0496101_0068869_1144_2343 349
78 3300048905 Ga0496102_0000402 Ga0496102_0000402_4512_5711 349
79 3300048906 Ga0496103_0002747 Ga0496103_0002747_5705_6904 349
80 3300048911 Ga0496108_0044525 Ga0496108_0044525_1673_2842 349
81 3300048912 Ga0496109_0028009 Ga0496109_0028009_3237_4406 349
82 3300048915 Ga0496112_0190588 Ga0496112_0190588_716_1885 349
83 3300048919 Ga0496116_0007641 Ga0496116_0007641_6481_7680 349
84 3300048920 Ga0496117_0000190 Ga0496117_0000190_28668_29867 349
85 3300048921 Ga0496118_0002690 Ga0496118_0002690_14873_16072 349
86 3300048922 Ga0496119_0002576 Ga0496119_0002576_6177_7376 349
87 3300048923 Ga0496120_0010739 Ga0496120_0010739_3410_4609 349
88 3300048924 Ga0496121_0001772 Ga0496121_0001772_5332_6531 349
89 3300048927 Ga0496124_0006919 Ga0496124_0006919_5879_7078 349
90 3300048928 Ga0496125_0008540 Ga0496125_0008540_5284_6483 349
91 3300048929 Ga0496126_0017449 Ga0496126_0017449_1730_2929 349
92 3300006051 Ga0075364_10016079 Ga0075364_100160793 350
93 3300009545 Ga0105237_10044500 Ga0105237_100445003 350
94 3300010375 Ga0105239_10032818 Ga0105239_100328183 350
95 3300025914 Ga0207671_10032798 Ga0207671_100327982 350
96 3300041413 Ga0439465_0002850 Ga0439465_0002850_2866_4053 350
97 3300041997 Ga0439431_0008052 Ga0439431_0008052_1022_2209 350
98 3300048903 Ga0496100_0002625 Ga0496100_0002625_6189_7385 350
99 3300048904 Ga0496101_0000019 Ga0496101_0000019_120737_121933 350
100 3300048905 Ga0496102_0000007 Ga0496102_0000007_268958_270154 350
101 3300048906 Ga0496103_0000013 Ga0496103_0000013_149815_151011 350
102 3300048919 Ga0496116_0000033 Ga0496116_0000033_148017_149213 350
103 3300048920 Ga0496117_0000025 Ga0496117_0000025_147947_149143 350
104 3300048921 Ga0496118_0000023 Ga0496118_0000023_268964_270160 350
105 3300048922 Ga0496119_0001596 Ga0496119_0001596_13288_14484 350
106 3300048923 Ga0496120_0000382 Ga0496120_0000382_66050_67246 350
107 3300048924 Ga0496121_0000039 Ga0496121_0000039_103680_104876 350
108 3300048929 Ga0496126_0007370 Ga0496126_0007370_2010_3206 350
109 3300050491 nmdc:mga00v17_11676_c1 nmdc:mga00v17_11676_c1_1793_2980 350
110 3300003792 Ga0055540_1001265 Ga0055540_100126510 351
111 3300005335 Ga0070666_10029480 Ga0070666_100294802 351
112 3300005367 Ga0070667_100000877 Ga0070667_10000087723 351
113 3300006048 Ga0075363_100007925 Ga0075363_1000079254 351
114 3300006051 Ga0075364_10013146 Ga0075364_100131466 351
115 3300006178 Ga0075367_10008353 Ga0075367_100083533 351
116 3300006186 Ga0075369_10011745 Ga0075369_100117452 351
117 3300006353 Ga0075370_10000913 Ga0075370_1000091310 351
118 3300006353 Ga0075370_10031116 Ga0075370_100311163 351
119 3300013306 Ga0163162_10325563 Ga0163162_103255632 351
120 3300025303 Ga0209051_1001152 Ga0209051_100115211 351
121 3300025903 Ga0207680_10018650 Ga0207680_100186503 351
122 3300025986 Ga0207658_10003144 Ga0207658_100031442 351
123 3300031995 Ga0307409_100017833 Ga0307409_1000178332 351
124 3300041413 Ga0439465_0000467 Ga0439465_0000467_3667_4860 351
125 3300044658 Ga0466972_0025283 Ga0466972_0025283_1448_2638 351
126 3300044683 Ga0466965_0005902 Ga0466965_0005902_802_1995 351
127 3300044735 Ga0466968_0041728 Ga0466968_0041728_243_1433 351
128 3300045049 Ga0466959_0003572 Ga0466959_0003572_4392_5582 351
129 3300045836 Ga0466958_0017501 Ga0466958_0017501_1670_2860 351
130 3300045976 Ga0466967_0169875 Ga0466967_0169875_813_2009 351
131 3300048903 Ga0496100_0000898 Ga0496100_0000898_2166_3344 351
132 3300048904 Ga0496101_0000065 Ga0496101_0000065_24657_25835 351
133 3300048905 Ga0496102_0028865 Ga0496102_0028865_193_1371 351
134 3300048906 Ga0496103_0000651 Ga0496103_0000651_11482_12660 351
135 3300048909 Ga0496106_0015872 Ga0496106_0015872_4037_5215 351
136 3300048910 Ga0496107_0049991 Ga0496107_0049991_1683_2861 351
137 3300048911 Ga0496108_0001176 Ga0496108_0001176_10571_11749 351
138 3300048912 Ga0496109_0000256 Ga0496109_0000256_11770_12948 351
139 3300048913 Ga0496110_0003864 Ga0496110_0003864_9740_10918 351
140 3300048914 Ga0496111_0108566 Ga0496111_0108566_597_1775 351
141 3300048917 Ga0496114_0000163 Ga0496114_0000163_21130_22308 351
142 3300048918 Ga0496115_0032238 Ga0496115_0032238_1804_2982 351
143 3300048919 Ga0496116_0004723 Ga0496116_0004723_1950_3128 351
144 3300048920 Ga0496117_0071622 Ga0496117_0071622_488_1666 351
145 3300048922 Ga0496119_0006869 Ga0496119_0006869_4414_5592 351
146 3300048923 Ga0496120_0034981 Ga0496120_0034981_1552_2730 351
147 3300048924 Ga0496121_0000027 Ga0496121_0000027_118713_119891 351
148 3300048925 Ga0496122_0000295 Ga0496122_0000295_45364_46542 351
149 3300048927 Ga0496124_0000016 Ga0496124_0000016_118713_119891 351
150 3300048928 Ga0496125_0000008 Ga0496125_0000008_118713_119891 351
151 3300048929 Ga0496126_0000025 Ga0496126_0000025_118713_119891 351
152 3300050490 nmdc:mga03n38_29335_c1 nmdc:mga03n38_29335_c1_840_2027 351
153 3300050491 nmdc:mga00v17_17329_c1 nmdc:mga00v17_17329_c1_1048_2235 351
154 3300050491 nmdc:mga00v17_3626_c1 nmdc:mga00v17_3626_c1_417_1604 351
155 3300050492 nmdc:mga0yw44_1249_c1 nmdc:mga0yw44_1249_c1_730_1917 351
156 3300050492 nmdc:mga0yw44_43728_c1 nmdc:mga0yw44_43728_c1_430_1617 351
157 3300050493 nmdc:mga0k408_83810_c1 nmdc:mga0k408_83810_c1_17_1204 351
158 3300050494 nmdc:mga06z11_18762_c1 nmdc:mga06z11_18762_c1_1062_2249 351
159 3300050496 nmdc:mga07m45_10187_c1 nmdc:mga07m45_10187_c1_3683_4870 351
160 3300050496 nmdc:mga07m45_3696_c1 nmdc:mga07m45_3696_c1_4842_6029 351
161 3300050516 nmdc:mga0sz30_46014_c1 nmdc:mga0sz30_46014_c1_449_1633 351
162 3300061719 Ga0466962_0032730 Ga0466962_0032730_1177_2367 351
163 3300003792 Ga0055540_1003233 Ga0055540_10032334 352
164 3300005355 Ga0070671_100000377 Ga0070671_10000037724 352
165 3300006051 Ga0075364_10055520 Ga0075364_100555202 352
166 3300006846 Ga0075430_100097238 Ga0075430_1000972382 352
167 3300006847 Ga0075431_100160727 Ga0075431_1001607272 352
168 3300009094 Ga0111539_10511270 Ga0111539_105112701 352
169 3300013306 Ga0163162_10355268 Ga0163162_103552682 352
170 3300025303 Ga0209051_1011577 Ga0209051_10115774 352
171 3300025303 Ga0209051_1030967 Ga0209051_10309671 352
172 3300045976 Ga0466967_0046255 Ga0466967_0046255_1774_2970 352
173 3300048904 Ga0496101_0016599 Ga0496101_0016599_294_1481 352
174 3300050489 nmdc:mga03683_108445_c1 nmdc:mga03683_108445_c1_11_1207 352
175 3300050509 nmdc:mga0qj67_88574_c1 nmdc:mga0qj67_88574_c1_599_1783 352
176 3300050510 nmdc:mga06r32_297184_c1 nmdc:mga06r32_297184_c1_222_1415 352
177 3300002239 JGI24034J26672_10003032 JGI24034J26672_100030322 353
178 3300005545 Ga0070695_100205862 Ga0070695_1002058621 353
179 3300005844 Ga0068862_100099281 Ga0068862_1000992812 353
180 3300009098 Ga0105245_10210537 Ga0105245_102105372 353
181 3300009101 Ga0105247_10056515 Ga0105247_100565152 353
182 3300009553 Ga0105249_10030325 Ga0105249_100303252 353
183 3300013306 Ga0163162_10107612 Ga0163162_101076122 353
184 3300025961 Ga0207712_10014006 Ga0207712_100140066 353
185 3300028381 Ga0268264_10039666 Ga0268264_100396662 353
186 3300031824 Ga0307413_10158615 Ga0307413_101586152 353
187 3300031995 Ga0307409_100007704 Ga0307409_1000077045 353
188 3300032002 Ga0307416_100064392 Ga0307416_1000643922 353
189 3300044658 Ga0466972_0012281 Ga0466972_0012281_1280_2467 353
190 3300044683 Ga0466965_0004661 Ga0466965_0004661_3774_4961 353
191 3300044735 Ga0466968_0004521 Ga0466968_0004521_2215_3402 353
192 3300044901 Ga0466960_0042266 Ga0466960_0042266_113_1300 353
193 3300045976 Ga0466967_0137361 Ga0466967_0137361_617_1804 353
194 3300046524 Ga0495648_0000871 Ga0495648_0000871_20342_21526 353
195 3300046616 Ga0495668_0021101 Ga0495668_0021101_1626_2810 353
196 3300047320 Ga0495672_0009613 Ga0495672_0009613_2200_3384 353
197 3300048903 Ga0496100_0060497 Ga0496100_0060497_1061_2242 353
198 3300048905 Ga0496102_0223594 Ga0496102_0223594_91_1272 353
199 3300048912 Ga0496109_0034599 Ga0496109_0034599_1266_2447 353
200 3300048913 Ga0496110_0024788 Ga0496110_0024788_729_1910 353
201 3300048915 Ga0496112_0013299 Ga0496112_0013299_4799_5980 353
202 3300048915 Ga0496112_0027883 Ga0496112_0027883_4127_5332 353
203 3300048916 Ga0496113_0087524 Ga0496113_0087524_104_1285 353
204 3300049569 Ga0501032_0009544 Ga0501032_0009544_487_1680 353
205 3300049571 Ga0501034_0015192 Ga0501034_0015192_434_1627 353
206 3300049572 Ga0501036_0003817 Ga0501036_0003817_1917_3110 353
207 3300049573 Ga0501037_0000060 Ga0501037_0000060_88936_90129 353
208 3300049575 Ga0501039_0001407 Ga0501039_0001407_14736_15929 353
209 3300049579 Ga0501043_0002866 Ga0501043_0002866_11348_12541 353
210 3300049586 Ga0501070_0028628 Ga0501070_0028628_1126_2319 353
211 3300049823 Ga0501044_0089035 Ga0501044_0089035_1696_2889 353
212 3300050491 nmdc:mga00v17_118233_c1 nmdc:mga00v17_118233_c1_250_1452 353
213 3300005331 Ga0070670_100126733 Ga0070670_1001267331 354
214 3300005347 Ga0070668_100000276 Ga0070668_10000027633 354
215 3300005367 Ga0070667_100011510 Ga0070667_1000115108 354
216 3300005544 Ga0070686_100176251 Ga0070686_1001762511 354
217 3300005548 Ga0070665_100006012 Ga0070665_10000601212 354
218 3300005841 Ga0068863_100006312 Ga0068863_1000063124 354
219 3300005937 Ga0081455_10004404 Ga0081455_1000440412 354
220 3300005981 Ga0081538_10019363 Ga0081538_100193632 354
221 3300005981 Ga0081538_10021223 Ga0081538_100212232 354
222 3300006844 Ga0075428_100020199 Ga0075428_1000201996 354
223 3300006847 Ga0075431_100156257 Ga0075431_1001562572 354
224 3300006880 Ga0075429_100150572 Ga0075429_1001505722 354
225 3300010375 Ga0105239_10004121 Ga0105239_1000412116 354
226 3300014325 Ga0163163_10205560 Ga0163163_102055602 354
227 3300025914 Ga0207671_10003210 Ga0207671_1000321016 354
228 3300025931 Ga0207644_10235720 Ga0207644_102357202 354
229 3300025972 Ga0207668_10000126 Ga0207668_1000012624 354
230 3300025986 Ga0207658_10010623 Ga0207658_100106237 354
231 3300026088 Ga0207641_10003526 Ga0207641_100035266 354
232 3300026095 Ga0207676_10269135 Ga0207676_102691351 354
233 3300028379 Ga0268266_10116346 Ga0268266_101163462 354
234 3300048905 Ga0496102_0003421 Ga0496102_0003421_8668_9849 354
235 3300048907 Ga0496104_0005592 Ga0496104_0005592_9250_10431 354
236 3300048915 Ga0496112_0165141 Ga0496112_0165141_358_1539 354
237 3300049578 Ga0501042_0148183 Ga0501042_0148183_145_1353 354
238 3300049592 Ga0501076_0099395 Ga0501076_0099395_1107_2315 354
239 3300050508 nmdc:mga09592_113039_c1 nmdc:mga09592_113039_c1_503_1711 354
240 3300054114 Ga0501084_0078040 Ga0501084_0078040_632_1840 354
241 3300061734 Ga0530510_0006827 Ga0530510_0006827_4168_5376 354
242 3300005334 Ga0068869_100251438 Ga0068869_1002514382 355
243 3300005347 Ga0070668_100143123 Ga0070668_1001431232 355
244 3300005366 Ga0070659_100195972 Ga0070659_1001959722 355
245 3300005434 Ga0070709_10005837 Ga0070709_100058376 355
246 3300005437 Ga0070710_10001503 Ga0070710_100015034 355
247 3300005439 Ga0070711_100002219 Ga0070711_1000022196 355
248 3300005444 Ga0070694_100124841 Ga0070694_1001248412 355
249 3300005546 Ga0070696_100012698 Ga0070696_1000126984 355
250 3300005549 Ga0070704_100009350 Ga0070704_1000093506 355
251 3300005615 Ga0070702_100039809 Ga0070702_1000398092 355
252 3300005617 Ga0068859_100196147 Ga0068859_1001961472 355
253 3300005843 Ga0068860_100131473 Ga0068860_1001314732 355
254 3300006051 Ga0075364_10043538 Ga0075364_100435382 355
255 3300006175 Ga0070712_100050151 Ga0070712_1000501512 355
256 3300006931 Ga0097620_100196148 Ga0097620_1001961482 355
257 3300009101 Ga0105247_10074229 Ga0105247_100742292 355
258 3300009148 Ga0105243_10117866 Ga0105243_101178662 355
259 3300009545 Ga0105237_10171561 Ga0105237_101715612 355
260 3300013297 Ga0157378_10205593 Ga0157378_102055932 355
261 3300013306 Ga0163162_10158412 Ga0163162_101584122 355
262 3300013307 Ga0157372_10313520 Ga0157372_103135202 355
263 3300013308 Ga0157375_10138870 Ga0157375_101388702 355
264 3300014326 Ga0157380_10028427 Ga0157380_100284272 355
265 3300014969 Ga0157376_10027668 Ga0157376_100276686 355
266 3300017792 Ga0163161_10137697 Ga0163161_101376972 355
267 3300025906 Ga0207699_10036449 Ga0207699_100364493 355
268 3300025919 Ga0207657_10078799 Ga0207657_100787993 355
269 3300025923 Ga0207681_10099761 Ga0207681_100997612 355
270 3300025927 Ga0207687_10163486 Ga0207687_101634862 355
271 3300025933 Ga0207706_10006665 Ga0207706_100066656 355
272 3300025935 Ga0207709_10076069 Ga0207709_100760692 355
273 3300025940 Ga0207691_10049194 Ga0207691_100491942 355
274 3300025941 Ga0207711_10222421 Ga0207711_102224212 355
275 3300025986 Ga0207658_10114538 Ga0207658_101145382 355
276 3300026023 Ga0207677_10045234 Ga0207677_100452343 355
277 3300026041 Ga0207639_10192529 Ga0207639_101925292 355
278 3300026089 Ga0207648_10099604 Ga0207648_100996042 355
279 3300026121 Ga0207683_10023444 Ga0207683_100234442 355
280 3300026142 Ga0207698_10246198 Ga0207698_102461982 355
281 3300046459 Ga0495629_0060681 Ga0495629_0060681_897_2105 355
282 3300046533 Ga0495640_0012804 Ga0495640_0012804_4184_5392 355
283 3300046681 Ga0495647_0043022 Ga0495647_0043022_202_1410 355
284 3300046690 Ga0495624_0030662 Ga0495624_0030662_836_2044 355
285 3300047321 Ga0495676_0030568 Ga0495676_0030568_1702_2910 355
286 3300047673 Ga0495593_0025789 Ga0495593_0025789_1696_2904 355
287 3300048905 Ga0496102_0099047 Ga0496102_0099047_520_1704 355
288 3300048910 Ga0496107_0022512 Ga0496107_0022512_1930_3114 355
289 3300048918 Ga0496115_0073565 Ga0496115_0073565_1002_2186 355
290 3300050490 nmdc:mga03n38_31571_c1 nmdc:mga03n38_31571_c1_174_1367 355
291 3300050491 nmdc:mga00v17_13434_c1 nmdc:mga00v17_13434_c1_1251_2432 355
292 3300053085 Ga0495619_0059562 Ga0495619_0059562_803_2011 355
293 3300013306 Ga0163162_10050133 Ga0163162_100501334 356
294 3300025914 Ga0207671_10195469 Ga0207671_101954692 356
295 3300031995 Ga0307409_100137114 Ga0307409_1001371142 356
296 3300046460 Ga0495638_0004986 Ga0495638_0004986_7309_8517 356
297 3300047320 Ga0495672_0022101 Ga0495672_0022101_1251_2447 356
298 3300048091 Ga0495626_0053565 Ga0495626_0053565_534_1742 356
299 3300049571 Ga0501034_0141403 Ga0501034_0141403_974_2173 356
300 3300053131 Ga0500652_000547 Ga0500652_000547_4093_5304 356
301 3300003373 JGI25407J50210_10002788 JGI25407J50210_100027884 357
302 3300005539 Ga0068853_100002662 Ga0068853_1000026629 357
303 3300005937 Ga0081455_10009266 Ga0081455_100092665 357
304 3300005981 Ga0081538_10001047 Ga0081538_1000104712 357
305 3300006173 Ga0070716_100041275 Ga0070716_1000412752 357
306 3300025939 Ga0207665_10032771 Ga0207665_100327713 357
307 3300036401 Ga0373937_0127004 Ga0373937_0127004_316_1452 357
308 3300047472 Ga0495686_0003859 Ga0495686_0003859_226_1434 357
309 3300006051 Ga0075364_10006302 Ga0075364_100063026 358
310 3300006177 Ga0075362_10030225 Ga0075362_100302253 358
311 3300006186 Ga0075369_10012186 Ga0075369_100121863 358
312 3300042436 Ga0439435_0016082 Ga0439435_0016082_639_1829 358
313 3300050491 nmdc:mga00v17_936_c1 nmdc:mga00v17_936_c1_1486_2670 358
314 3300050516 nmdc:mga0sz30_13518_c1 nmdc:mga0sz30_13518_c1_974_2164 358
315 3300002077 JGI24744J21845_10011463 JGI24744J21845_100114632 359
316 3300005719 Ga0068861_100082816 Ga0068861_1000828162 359
317 3300005937 Ga0081455_10038577 Ga0081455_100385774 359
318 3300025914 Ga0207671_10082433 Ga0207671_100824332 359
319 3300025942 Ga0207689_10150914 Ga0207689_101509142 359
320 3300025960 Ga0207651_10037822 Ga0207651_100378223 359
321 3300026118 Ga0207675_100029687 Ga0207675_1000296872 359
322 3300044735 Ga0466968_0018019 Ga0466968_0018019_252_1439 359
323 3300044765 Ga0466970_0021866 Ga0466970_0021866_921_2108 359
324 3300025294 Ga0209025_1043406 Ga0209025_10434062 360
325 iso_pu_bacteria 2643221687 2644485812 360
326 iso_pu_bacteria 2643221715 2644633928 360
327 iso_pu_bacteria 2738541274 2738704114 360
328 iso_pu_bacteria 2738543028 2739334491 360
329 iso_pu_bacteria 2902792274 2902797739 360
330 iso_pu_bacteria 2902799365 2902800919 360
331 iso_pu_bacteria 2902810491 2902810834 360
332 iso_pu_bacteria 2902837492 2902843604 360
333 3300003792 Ga0055540_1012911 Ga0055540_10129112 361
334 3300025303 Ga0209051_1000652 Ga0209051_100065214 361
335 3300048913 Ga0496110_0270078 Ga0496110_0270078_121_1302 361
336 3300007788 Ga0099795_10002078 Ga0099795_100020782 362
337 3300010159 Ga0099796_10004588 Ga0099796_100045882 362
338 3300027512 Ga0209179_1007326 Ga0209179_10073262 362
339 3300041413 Ga0439465_0053152 Ga0439465_0053152_110_1312 362
340 3300042004 Ga0439445_0005576 Ga0439445_0005576_972_2174 362
341 3300044901 Ga0466960_0001475 Ga0466960_0001475_4481_5656 362
342 iso_pu_bacteria 2842134933 2842137846 362
343 3300005335 Ga0070666_10173459 Ga0070666_101734591 363
344 3300005338 Ga0068868_100108112 Ga0068868_1001081122 363
345 3300005356 Ga0070674_100047463 Ga0070674_1000474632 363
346 3300005441 Ga0070700_100055620 Ga0070700_1000556202 363
347 3300005618 Ga0068864_100019318 Ga0068864_1000193183 363
348 3300005842 Ga0068858_100053553 Ga0068858_1000535532 363
349 3300005844 Ga0068862_100201076 Ga0068862_1002010762 363
350 3300009098 Ga0105245_10097767 Ga0105245_100977672 363
351 3300013296 Ga0157374_10023822 Ga0157374_100238223 363
352 3300014745 Ga0157377_10104505 Ga0157377_101045052 363
353 3300025903 Ga0207680_10051817 Ga0207680_100518172 363
354 3300026035 Ga0207703_10052071 Ga0207703_100520712 363
355 3300026067 Ga0207678_10222373 Ga0207678_102223731 363
356 3300026075 Ga0207708_10040365 Ga0207708_100403652 363
357 3300028380 Ga0268265_10313047 Ga0268265_103130472 363
358 3300048908 Ga0496105_0025929 Ga0496105_0025929_3531_4727 363
359 3300048911 Ga0496108_0001002 Ga0496108_0001002_12973_14169 363
360 iso_pu_bacteria 2929212328 2929216090 363
361 3300006038 Ga0075365_10010242 Ga0075365_100102426 364
362 3300006051 Ga0075364_10024376 Ga0075364_100243765 364
363 3300006186 Ga0075369_10002033 Ga0075369_100020338 364
364 3300048923 Ga0496120_0086211 Ga0496120_0086211_302_1495 364
365 3300050490 nmdc:mga03n38_16367_c1 nmdc:mga03n38_16367_c1_1596_2780 364
366 3300050492 nmdc:mga0yw44_15689_c1 nmdc:mga0yw44_15689_c1_559_1743 364
367 3300050494 nmdc:mga06z11_125218_c1 nmdc:mga06z11_125218_c1_43_1227 364
368 3300050516 nmdc:mga0sz30_1263_c1 nmdc:mga0sz30_1263_c1_419_1603 364
369 iso_pu_bacteria 2939582691 2939585768 364
370 3300006051 Ga0075364_10089066 Ga0075364_100890662 365
371 3300006353 Ga0075370_10013556 Ga0075370_100135563 365
372 3300050490 nmdc:mga03n38_4652_c1 nmdc:mga03n38_4652_c1_2974_4161 365
373 3300048904 Ga0496101_0000002 Ga0496101_0000002_255552_256745 366
374 3300048905 Ga0496102_0000009 Ga0496102_0000009_325269_326462 366
375 3300048906 Ga0496103_0000005 Ga0496103_0000005_486536_487729 366
376 3300048910 Ga0496107_0056392 Ga0496107_0056392_1516_2709 366
377 3300048919 Ga0496116_0000104 Ga0496116_0000104_17849_19042 366
378 3300048920 Ga0496117_0000019 Ga0496117_0000019_142795_143988 366
379 3300048921 Ga0496118_0000020 Ga0496118_0000020_325269_326462 366
380 3300048922 Ga0496119_0005617 Ga0496119_0005617_8817_10010 366
381 3300048924 Ga0496121_0000064 Ga0496121_0000064_127167_128360 366
382 3300048929 Ga0496126_0002244 Ga0496126_0002244_5508_6701 366
383 3300002077 JGI24744J21845_10004752 JGI24744J21845_100047522 368
384 3300005328 Ga0070676_10060482 Ga0070676_100604822 368
385 3300005334 Ga0068869_100072600 Ga0068869_1000726002 368
386 3300005347 Ga0070668_100002744 Ga0070668_1000027444 368
387 3300005354 Ga0070675_100209365 Ga0070675_1002093652 368
388 3300005356 Ga0070674_100013812 Ga0070674_1000138124 368
389 3300005366 Ga0070659_100139310 Ga0070659_1001393102 368
390 3300005438 Ga0070701_10000925 Ga0070701_100009254 368
391 3300005439 Ga0070711_100000402 Ga0070711_10000040223 368
392 3300005441 Ga0070700_100003324 Ga0070700_1000033246 368
393 3300005444 Ga0070694_100118456 Ga0070694_1001184561 368
394 3300005455 Ga0070663_100006109 Ga0070663_1000061096 368
395 3300005456 Ga0070678_100001104 Ga0070678_10000110415 368
396 3300005459 Ga0068867_100000667 Ga0068867_10000066717 368
397 3300005466 Ga0070685_10039180 Ga0070685_100391802 368
398 3300005539 Ga0068853_100103393 Ga0068853_1001033932 368
399 3300005543 Ga0070672_100223731 Ga0070672_1002237312 368
400 3300005545 Ga0070695_100023206 Ga0070695_1000232062 368
401 3300005546 Ga0070696_100001988 Ga0070696_1000019885 368
402 3300005548 Ga0070665_100051243 Ga0070665_1000512432 368
403 3300005549 Ga0070704_100001144 Ga0070704_1000011448 368
404 3300005563 Ga0068855_100131684 Ga0068855_1001316842 368
405 3300005578 Ga0068854_100002798 Ga0068854_1000027982 368
406 3300005615 Ga0070702_100004350 Ga0070702_1000043505 368
407 3300005616 Ga0068852_100093019 Ga0068852_1000930192 368
408 3300005617 Ga0068859_100087688 Ga0068859_1000876882 368
409 3300005718 Ga0068866_10000674 Ga0068866_1000067410 368
410 3300005719 Ga0068861_100101634 Ga0068861_1001016342 368
411 3300005842 Ga0068858_100001285 Ga0068858_10000128517 368
412 3300005843 Ga0068860_100000775 Ga0068860_10000077526 368
413 3300006173 Ga0070716_100111921 Ga0070716_1001119211 368
414 3300006175 Ga0070712_100001056 Ga0070712_10000105610 368
415 3300006931 Ga0097620_100087689 Ga0097620_1000876892 368
416 3300009098 Ga0105245_10172418 Ga0105245_101724182 368
417 3300009101 Ga0105247_10000963 Ga0105247_1000096314 368
418 3300009148 Ga0105243_10002663 Ga0105243_100026639 368
419 3300009176 Ga0105242_10000459 Ga0105242_1000045932 368
420 3300009177 Ga0105248_10003658 Ga0105248_1000365811 368
421 3300009545 Ga0105237_10072017 Ga0105237_100720172 368
422 3300009553 Ga0105249_10152555 Ga0105249_101525552 368
423 3300010375 Ga0105239_10045701 Ga0105239_100457012 368
424 3300013105 Ga0157369_10231903 Ga0157369_102319032 368
425 3300013306 Ga0163162_10011983 Ga0163162_1001198310 368
426 3300013307 Ga0157372_10170385 Ga0157372_101703852 368
427 3300017792 Ga0163161_10002277 Ga0163161_1000227712 368
428 3300025898 Ga0207692_10005872 Ga0207692_100058722 368
429 3300025899 Ga0207642_10109967 Ga0207642_101099672 368
430 3300025900 Ga0207710_10007952 Ga0207710_100079522 368
431 3300025901 Ga0207688_10015470 Ga0207688_100154704 368
432 3300025907 Ga0207645_10016970 Ga0207645_100169702 368
433 3300025915 Ga0207693_10000381 Ga0207693_1000038131 368
434 3300025926 Ga0207659_10073055 Ga0207659_100730552 368
435 3300025927 Ga0207687_10094512 Ga0207687_100945122 368
436 3300025931 Ga0207644_10022743 Ga0207644_100227432 368
437 3300025933 Ga0207706_10003648 Ga0207706_1000364819 368
438 3300025934 Ga0207686_10058273 Ga0207686_100582732 368
439 3300025935 Ga0207709_10008188 Ga0207709_100081884 368
440 3300025936 Ga0207670_10003336 Ga0207670_100033364 368
441 3300025939 Ga0207665_10006892 Ga0207665_100068922 368
442 3300025940 Ga0207691_10223061 Ga0207691_102230612 368
443 3300025949 Ga0207667_10282101 Ga0207667_102821012 368
444 3300025961 Ga0207712_10008012 Ga0207712_100080128 368
445 3300025981 Ga0207640_10002814 Ga0207640_100028148 368
446 3300025986 Ga0207658_10015777 Ga0207658_100157776 368
447 3300026023 Ga0207677_10008156 Ga0207677_100081562 368
448 3300026035 Ga0207703_10002416 Ga0207703_100024168 368
449 3300026067 Ga0207678_10012289 Ga0207678_100122896 368
450 3300026075 Ga0207708_10015436 Ga0207708_100154365 368
451 3300026089 Ga0207648_10000462 Ga0207648_1000046217 368
452 3300026118 Ga0207675_100142963 Ga0207675_1001429632 368
453 3300026121 Ga0207683_10000575 Ga0207683_1000057538 368
454 3300026142 Ga0207698_10073782 Ga0207698_100737822 368
455 3300028379 Ga0268266_10045198 Ga0268266_100451984 368
456 3300028380 Ga0268265_10045778 Ga0268265_100457782 368
457 3300048903 Ga0496100_0006818 Ga0496100_0006818_3514_4713 368
458 3300048904 Ga0496101_0002758 Ga0496101_0002758_8779_9978 368
459 3300048905 Ga0496102_0009359 Ga0496102_0009359_1278_2477 368
460 3300048906 Ga0496103_0040337 Ga0496103_0040337_423_1622 368
461 3300048909 Ga0496106_0001784 Ga0496106_0001784_1723_2922 368
462 3300048910 Ga0496107_0001314 Ga0496107_0001314_4903_6102 368

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

80

364

0.88

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

120

361

0.85

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

74

330

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eqb-assembly2.cif.gz_B 1.5 angstrom crystal structure of spermidine/putrescine abc transporter substrate-binding protein potd from streptococcus pneumoniae strain canada mdr_19a in complex with calcium and hepes 0.9095 38 367
4eqb-assembly2.cif.gz_B 1.5 angstrom crystal structure of spermidine/putrescine abc transporter substrate-binding protein potd from streptococcus pneumoniae strain canada mdr_19a in complex with calcium and hepes 0.8963 38 367
2v84-assembly1.cif.gz_A crystal structure of the tp0655 (tppotd) lipoprotein of treponema pallidum 0.8688 39 368
2v84-assembly1.cif.gz_A crystal structure of the tp0655 (tppotd) lipoprotein of treponema pallidum 0.8637 39 368
7oyt-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88l in complex with spermidine 0.8589 38 368
ID Description Score Start End Superfamily
af_Q2G2A8_37_140_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9221 40 140 3.40.190.10
1poy101 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9034 38 331 3.40.190.10
2v84A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9031 39 319 3.40.190.10
af_Q2G2A8_33_356_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8858 39 367 3.40.190.10
3ttnB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8844 40 331 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7K2ZPR5-F1-model_v4 Extracellular solute-binding protein 0.9534 39 368 GO:0015846
GO:0019808
GO:0042597
AF-A0A6B1N4W6-F1-model_v4 deleted 0.9473 72 368
AF-A0A4R8VGI4-F1-model_v4 Spermidine/putrescine ABC transporter substrate-binding protein 0.9453 76 366 GO:0015846
GO:0019808
GO:0042597
AF-A0A7V8YAI9-F1-model_v4 Spermidine/putrescine ABC transporter substrate-binding protein 0.9333 45 368 GO:0015846
GO:0019808
GO:0042597
AF-A0A510THG6-F1-model_v4 Aminotransferase class V domain-containing protein 0.9313 75 368 GO:0015846
GO:0019808
GO:0042597

Feature Viewer

pLDDT pTM Quality
86.54 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map