F449010

General Info

Members Datasets Scaffolds Average Seq Length
462 288 924 208

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2675903058|2676477450
Length 251
Sequence TPLRLTVVSAGLSVPSSTRLLADRLTDATRRALAARGREVEVTVVELRDLATDVANNLVTGFPSRRLSDALASVSEADGLIAVTPVFSASYSGLFKSFFDVVDNDALTGTPVLAAATGGTARHSLALEHALRPLFTFLRAVVVPTAVYAAAEDWGGRGDSMTEGLPTRIERAAGELADLLAGRVHGDARAAVDVRADGVRTNGARVDGDARVVDGRPAEETFVPFEQYLAALRPDQPPDLIATDEPSGGLR

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
28 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
29 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
49 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
51 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
52 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
53 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
54 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
55 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
56 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
57 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
58 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
59 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
60 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
61 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
62 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
63 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
64 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
69 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
70 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
71 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
72 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
76 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
77 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
78 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
79 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
80 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
81 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
82 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
83 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
84 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
85 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
86 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
87 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
88 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
89 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
90 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
91 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
92 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
93 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
94 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
95 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
96 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
97 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
98 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
99 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
100 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
101 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
108 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
127 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
136 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
137 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
138 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
139 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
140 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
160 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
161 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
170 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
173 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
174 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
180 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
213 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
214 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
217 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
220 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
221 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
222 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
223 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
224 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
225 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
226 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
227 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
228 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
229 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
233 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
234 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
235 2582580736 Prauserella sp. Am3 Isolate Unclassified
236 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
237 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
238 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
239 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
240 2643221548 Streptomyces sp. Root55 Isolate Unclassified
241 2643221641 Nocardioides sp. Root122 Isolate Unclassified
242 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
243 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
244 2643221714 Streptomyces sp. Root264 Isolate Unclassified
245 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
246 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
247 2739367898 Nocardioides sp. CF479 Isolate Unclassified
248 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
249 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
250 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
251 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
252 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
253 2808606448 Streptomyces sp. 193411 Isolate Unclassified
254 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
255 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
256 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
257 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
258 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
259 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
260 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
261 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
262 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
263 2867428634 Streptomyces sp. RP5T Isolate Unclassified
264 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
265 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
266 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
267 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
268 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
269 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
270 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
271 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
272 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
273 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
274 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
275 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
276 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
277 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
278 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
279 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
280 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
281 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
282 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
283 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
284 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
285 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
286 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
287 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere
288 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.63
Metatranscriptomes 2.81
Isolates 12.55

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0
Endosphere 6.06
Nodule 0.43
Rhizoplane 1.95
Rhizosphere 76.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10012060 3300001989 Bacteria 3175
2 rootH1_10007719 3300003316 Bacteria 1635
3 rootH2_10048161 3300003320 Bacteria 11950
4 rootL2_10050146 3300003322 Bacteria 4492
5 rootL2_10136955 3300003322 Bacteria 2299
6 Ga0006562J51391_1063772 3300003578 Bacteria 3950
7 Ga0006562J51391_1063773 3300003578 Bacteria 3974
8 Ga0070680_100228824 3300005336 Bacteria 1570
9 Ga0070668_100001849 3300005347 Bacteria 15433
10 Ga0070668_100778298 3300005347 Bacteria 849
11 Ga0070674_101143635 3300005356 Bacteria 689
12 Ga0070667_100316827 3300005367 Bacteria 1407
13 Ga0070709_10188805 3300005434 Bacteria 1452
14 Ga0070713_100077572 3300005436 Bacteria 2825
15 Ga0068867_100490604 3300005459 Bacteria 1054
16 Ga0070679_100853539 3300005530 Bacteria 854
17 Ga0068853_100117597 3300005539 Bacteria 2368
18 Ga0070665_100349625 3300005548 Bacteria 1484
19 Ga0068856_100147506 3300005614 Bacteria 2360
20 Ga0068861_100776343 3300005719 Bacteria 897
21 Ga0068862_100443865 3300005844 Bacteria 1222
22 Ga0075365_10015400 3300006038 Bacteria 4626
23 Ga0075365_10064952 3300006038 Bacteria 2446
24 Ga0075365_10607021 3300006038 Bacteria 774
25 Ga0075368_10005115 3300006042 Bacteria 4494
26 Ga0075367_10006729 3300006178 Bacteria 5833
27 Ga0075436_100480399 3300006914 Bacteria 907
28 Ga0105243_10265885 3300009148 Bacteria 1538
29 Ga0105238_10515220 3300009551 Bacteria 1198
30 Ga0105246_10000350 3300011119 Bacteria 24717
31 Ga0157372_10568137 3300013307 Bacteria 1322
32 Ga0157377_10279337 3300014745 Bacteria 1094
33 Ga0183367_1002 3300015688 Bacteria 1101531
34 Ga0206353_10590688 3300020082 Bacteria 1881
35 Ga0224712_10012943 3300022467 Bacteria 2643
36 Ga0209051_1059972 3300025303 Bacteria 1204
37 Ga0207688_10022775 3300025901 Bacteria 3430
38 Ga0207647_10043782 3300025904 Bacteria 2799
39 Ga0207647_10175573 3300025904 Bacteria 1246
40 Ga0207699_10159087 3300025906 Bacteria 1502
41 Ga0207660_10898662 3300025917 Bacteria 723
42 Ga0207652_10688174 3300025921 Bacteria 913
43 Ga0207700_10033956 3300025928 Bacteria 3656
44 Ga0207664_10081897 3300025929 Bacteria 2628
45 Ga0207669_10233744 3300025937 Bacteria 1358
46 Ga0207704_10175682 3300025938 Bacteria 1542
47 Ga0207661_10306339 3300025944 Bacteria 1425
48 Ga0207712_10873471 3300025961 Bacteria 793
49 Ga0207668_10050988 3300025972 Bacteria 2855
50 Ga0207658_10235441 3300025986 Bacteria 1548
51 Ga0207639_10076961 3300026041 Bacteria 2628
52 Ga0207674_10699526 3300026116 Bacteria 978
53 Ga0207675_100385193 3300026118 Bacteria 1379
54 Ga0209813_10012589 3300027866 Bacteria 2240
55 Ga0268264_10394158 3300028381 Bacteria 1329
56 Ga0307517_10142039 3300028786 Bacteria 1682
57 Ga0307515_10000258 3300028794 Bacteria 131660
58 Ga0307515_10109991 3300028794 Bacteria 3230
59 Ga0307511_10137285 3300030521 Bacteria 1451
60 Ga0307512_10001966 3300030522 Bacteria 27433
61 Ga0307512_10069595 3300030522 Bacteria 2629
62 Ga0307512_10086145 3300030522 Bacteria 2221
63 Ga0307512_10242643 3300030522 Bacteria 909
64 Ga0307512_10249720 3300030522 Bacteria 885
65 Ga0307513_10017989 3300031456 Bacteria 8462
66 Ga0307509_10007108 3300031507 Bacteria 14762
67 Ga0307509_10173200 3300031507 Bacteria 2034
68 Ga0307508_10004187 3300031616 Bacteria 14188
69 Ga0307508_10027953 3300031616 Bacteria 5103
70 Ga0307508_10049559 3300031616 Bacteria 3740
71 Ga0307508_10228331 3300031616 Bacteria 1460
72 Ga0307514_10175742 3300031649 Bacteria 1389
73 Ga0307516_10001875 3300031730 Bacteria 28758
74 Ga0307405_10018487 3300031731 Bacteria 3846
75 Ga0307405_10625028 3300031731 Bacteria 882
76 Ga0307413_10030182 3300031824 Bacteria 3043
77 Ga0307413_10418380 3300031824 Bacteria 1055
78 Ga0307413_10554971 3300031824 Bacteria 932
79 Ga0307518_10212810 3300031838 Bacteria 1270
80 Ga0307518_10271235 3300031838 Bacteria 1059
81 Ga0307518_10296469 3300031838 Bacteria 987
82 Ga0307410_10143971 3300031852 Bacteria 1767
83 Ga0307406_10083120 3300031901 Bacteria 2134
84 Ga0307406_10176032 3300031901 Bacteria 1553
85 Ga0307407_10016354 3300031903 Bacteria 3693
86 Ga0307412_10138474 3300031911 Bacteria 1779
87 Ga0307412_10180593 3300031911 Bacteria 1587
88 Ga0307409_100101211 3300031995 Bacteria 2390
89 Ga0307409_100196207 3300031995 Bacteria 1802
90 Ga0307409_100222441 3300031995 Bacteria 1705
91 Ga0307409_100223934 3300031995 Bacteria 1700
92 Ga0307409_100529590 3300031995 Bacteria 1153
93 Ga0307409_100536485 3300031995 Bacteria 1146
94 Ga0307409_100754587 3300031995 Bacteria 977
95 Ga0307409_101066226 3300031995 Bacteria 828
96 Ga0307416_100130590 3300032002 Bacteria 2260
97 Ga0307416_100236180 3300032002 Bacteria 1767
98 Ga0307416_100570787 3300032002 Bacteria 1207
99 Ga0307416_101151354 3300032002 Bacteria 881
100 Ga0307411_10214474 3300032005 Bacteria 1489
101 Ga0307411_10665542 3300032005 Bacteria 903
102 Ga0307415_100004523 3300032126 Bacteria 7235
103 Ga0307415_100128178 3300032126 Bacteria 1916
104 Ga0307415_100181716 3300032126 Bacteria 1651
105 Ga0307415_100283584 3300032126 Bacteria 1363
106 Ga0307415_100471192 3300032126 Bacteria 1091
107 Ga0307507_10000240 3300033179 Bacteria 106042
108 Ga0307507_10025553 3300033179 Bacteria 6401
109 Ga0307507_10066141 3300033179 Bacteria 3317
110 Ga0307510_10190566 3300033180 Bacteria 1599
111 Ga0307510_10355450 3300033180 Bacteria 914
112 Ga0373935_0018059 3300035692 Bacteria 4288
113 Ga0395898_0036579 3300037466 Bacteria 4874
114 Ga0395898_0345444 3300037466 Bacteria 1419
115 Ga0395898_0764534 3300037466 Bacteria 907
116 Ga0395901_0021537 3300038443 Bacteria 6606
117 Ga0395901_0057315 3300038443 Bacteria 4052
118 Ga0395901_0259982 3300038443 Bacteria 1807
119 Ga0439438_022771 3300041405 Bacteria 1734
120 Ga0439466_0111644 3300041411 Bacteria 848
121 Ga0451789_0060067 3300041443 Bacteria 1196
122 Ga0451789_0997067 3300041443 Bacteria 923
123 Ga0451791_0077492 3300041451 Bacteria 1473
124 Ga0451791_0381482 3300041451 Bacteria 1817
125 Ga0451793_1768735 3300041452 Bacteria 724
126 Ga0451797_0668506 3300041453 Bacteria 1206
127 Ga0451807_1652371 3300041486 Bacteria 1245
128 Ga0451837_1090609 3300041494 Bacteria 934
129 Ga0451837_1808306 3300041494 Bacteria 577
130 Ga0451839_0692888 3300041496 Bacteria 892
131 Ga0451841_0387088 3300041498 Bacteria 1164
132 Ga0451843_0744411 3300041509 Bacteria 804
133 Ga0451853_1127399 3300041512 Bacteria 1842
134 Ga0439455_0006712 3300042012 Bacteria 2402
135 Ga0439457_046037 3300042014 Bacteria 976
136 Ga0450894_000149 3300042131 Bacteria 12354
137 Ga0450896_002049 3300042133 Bacteria 2565
138 Ga0450898_027737 3300042134 Bacteria 1026
139 Ga0450899_000455 3300042135 Bacteria 4591
140 Ga0450900_008934 3300042136 Bacteria 1262
141 Ga0450902_010444 3300042137 Bacteria 1468
142 Ga0450903_000008 3300042138 Bacteria 36921
143 Ga0450906_000591 3300042145 Bacteria 7708
144 Ga0439458_0000093 3300042157 Bacteria 17233
145 Ga0439458_0045392 3300042157 Bacteria 1074
146 Ga0450901_009529 3300042533 Bacteria 1003
147 Ga0466969_0017911 3300044656 Bacteria 3695
148 Ga0466972_0019896 3300044658 Bacteria 3355
149 Ga0466972_0020895 3300044658 Bacteria 3268
150 Ga0466972_0024669 3300044658 Bacteria 2984
151 Ga0466972_0040971 3300044658 Bacteria 2255
152 Ga0466965_0068832 3300044683 Bacteria 1777
153 Ga0466965_0128170 3300044683 Bacteria 1314
154 Ga0466965_0379200 3300044683 Bacteria 778
155 Ga0466966_0023774 3300044684 Bacteria 4010
156 Ga0466966_0029411 3300044684 Bacteria 3574
157 Ga0466961_0010395 3300044693 Bacteria 5939
158 Ga0466961_0019484 3300044693 Bacteria 4364
159 Ga0466961_0039844 3300044693 Bacteria 3011
160 Ga0466963_0002412 3300044694 Bacteria 10454
161 Ga0466963_0026360 3300044694 Bacteria 3717
162 Ga0466963_0091845 3300044694 Bacteria 2068
163 Ga0466964_0016623 3300044706 Bacteria 2811
164 Ga0466964_0093536 3300044706 Bacteria 1312
165 Ga0466971_0003866 3300044719 Bacteria 6423
166 Ga0466971_0038227 3300044719 Bacteria 2153
167 Ga0466971_0038444 3300044719 Bacteria 2147
168 Ga0466971_0087184 3300044719 Bacteria 1427
169 Ga0466968_0005347 3300044735 Bacteria 4804
170 Ga0466968_0116871 3300044735 Bacteria 1204
171 Ga0466970_0033502 3300044765 Bacteria 2715
172 Ga0466970_0055248 3300044765 Bacteria 2120
173 Ga0466970_0139847 3300044765 Bacteria 1333
174 Ga0466970_0264623 3300044765 Bacteria 965
175 Ga0466970_0266521 3300044765 Bacteria 961
176 Ga0466957_0001811 3300044842 Bacteria 11262
177 Ga0466957_0393771 3300044842 Bacteria 946
178 Ga0466960_0073673 3300044901 Bacteria 1704
179 Ga0466960_0101376 3300044901 Bacteria 1483
180 Ga0466959_0173070 3300045049 Bacteria 1513
181 Ga0466958_0006367 3300045836 Bacteria 6420
182 Ga0466958_0094291 3300045836 Bacteria 1854
183 Ga0466958_0493477 3300045836 Bacteria 794
184 Ga0466967_0001656 3300045976 Bacteria 13197
185 Ga0466967_0004873 3300045976 Bacteria 9164
186 Ga0466967_0012352 3300045976 Bacteria 6529
187 Ga0466967_0058691 3300045976 Bacteria 3402
188 Ga0466967_0086551 3300045976 Bacteria 2839
189 Ga0466967_0149194 3300045976 Bacteria 2184
190 Ga0495592_0080621 3300046454 Bacteria 2354
191 Ga0495603_0004220 3300046455 Bacteria 8556
192 Ga0495603_0014053 3300046455 Bacteria 4840
193 Ga0495603_0014817 3300046455 Bacteria 4715
194 Ga0495603_0023736 3300046455 Bacteria 3710
195 Ga0495629_0002208 3300046459 Bacteria 15016
196 Ga0495629_0038569 3300046459 Bacteria 3364
197 Ga0495629_0126088 3300046459 Bacteria 1783
198 Ga0495629_0180190 3300046459 Bacteria 1464
199 Ga0495638_0152867 3300046460 Bacteria 1337
200 Ga0495651_0011388 3300046462 Bacteria 6834
201 Ga0495651_0044210 3300046462 Bacteria 3452
202 Ga0495651_0179225 3300046462 Bacteria 1501
203 Ga0495651_0198530 3300046462 Bacteria 1406
204 Ga0495653_0009606 3300046463 Bacteria 7911
205 Ga0495580_0065657 3300046472 Bacteria 2541
206 Ga0495605_0039502 3300046474 Bacteria 2363
207 Ga0495662_0007088 3300046476 Bacteria 5564
208 Ga0495662_0035761 3300046476 Bacteria 2397
209 Ga0495662_0049576 3300046476 Bacteria 2026
210 Ga0495662_0095121 3300046476 Bacteria 1455
211 Ga0495664_0028284 3300046477 Bacteria 3274
212 Ga0495585_0015711 3300046492 Bacteria 4396
213 Ga0495594_0001139 3300046499 Bacteria 13860
214 Ga0495594_0006795 3300046499 Bacteria 5878
215 Ga0495594_0145571 3300046499 Bacteria 1344
216 Ga0495596_0040519 3300046500 Bacteria 1839
217 Ga0495583_0008560 3300046506 Bacteria 6234
218 Ga0495583_0035892 3300046506 Bacteria 2361
219 Ga0495583_0158978 3300046506 Bacteria 933
220 Ga0495606_0013058 3300046507 Bacteria 6598
221 Ga0495608_0001061 3300046511 Bacteria 19348
222 Ga0495608_0114150 3300046511 Bacteria 1735
223 Ga0495610_0007038 3300046512 Bacteria 7599
224 Ga0495616_0021961 3300046513 Bacteria 3449
225 Ga0495618_0002300 3300046514 Bacteria 12388
226 Ga0495618_0084611 3300046514 Bacteria 2026
227 Ga0495618_0288135 3300046514 Bacteria 1022
228 Ga0495620_0121844 3300046515 Bacteria 1027
229 Ga0495628_0004626 3300046516 Bacteria 12158
230 Ga0495628_0132296 3300046516 Bacteria 1907
231 Ga0495628_0179750 3300046516 Bacteria 1601
232 Ga0495631_0067455 3300046518 Bacteria 1547
233 Ga0495632_0040811 3300046519 Bacteria 2335
234 Ga0495637_0020890 3300046520 Bacteria 3005
235 Ga0495666_0001304 3300046526 Bacteria 12056
236 Ga0495666_0165276 3300046526 Bacteria 1025
237 Ga0495652_0015292 3300046529 Bacteria 6867
238 Ga0495652_0033557 3300046529 Bacteria 4481
239 Ga0495652_0077589 3300046529 Bacteria 2753
240 Ga0495654_0022316 3300046530 Bacteria 3288
241 Ga0495665_0002501 3300046531 Bacteria 9927
242 Ga0495640_0000167 3300046533 Bacteria 42901
243 Ga0495640_0019352 3300046533 Bacteria 5026
244 Ga0495640_0123285 3300046533 Bacteria 1682
245 Ga0495640_0145859 3300046533 Bacteria 1522
246 Ga0495587_0005512 3300046536 Bacteria 8256
247 Ga0495645_0003929 3300046543 Bacteria 10135
248 Ga0495645_0039484 3300046543 Bacteria 3442
249 Ga0495622_0002733 3300046557 Bacteria 8441
250 Ga0495633_0013816 3300046558 Bacteria 4238
251 Ga0495667_0120345 3300046559 Bacteria 1695
252 Ga0495667_0141217 3300046559 Bacteria 1552
253 Ga0495667_0164447 3300046559 Bacteria 1427
254 Ga0495634_0024343 3300046642 Bacteria 4247
255 Ga0495634_0077672 3300046642 Bacteria 2176
256 Ga0495611_0012798 3300046648 Bacteria 3565
257 Ga0495611_0023155 3300046648 Bacteria 2693
258 Ga0495611_0042736 3300046648 Bacteria 2024
259 Ga0495611_0102376 3300046648 Bacteria 1330
260 Ga0495625_0003109 3300046660 Bacteria 16960
261 Ga0495625_0014028 3300046660 Bacteria 6415
262 Ga0495625_0108840 3300046660 Bacteria 1896
263 Ga0495635_0007091 3300046663 Bacteria 7835
264 Ga0495661_0008634 3300046665 Bacteria 7042
265 Ga0495657_0002270 3300046675 Bacteria 16239
266 Ga0495657_0006398 3300046675 Bacteria 9221
267 Ga0495657_0018901 3300046675 Bacteria 4980
268 Ga0495657_0168969 3300046675 Bacteria 1348
269 Ga0495623_0031067 3300046679 Bacteria 3435
270 Ga0495623_0185817 3300046679 Bacteria 1204
271 Ga0495646_0000979 3300046680 Bacteria 16386
272 Ga0495646_0128842 3300046680 Bacteria 1426
273 Ga0495646_0228529 3300046680 Bacteria 1003
274 Ga0495613_0008163 3300046689 Bacteria 7785
275 Ga0495613_0016279 3300046689 Bacteria 5541
276 Ga0495613_0083299 3300046689 Bacteria 2322
277 Ga0495613_0117986 3300046689 Bacteria 1907
278 Ga0495613_0364455 3300046689 Bacteria 990
279 Ga0495624_0030296 3300046690 Bacteria 3525
280 Ga0495624_0044684 3300046690 Bacteria 2823
281 Ga0495624_0257919 3300046690 Bacteria 1054
282 Ga0495670_0000953 3300046691 Bacteria 14001
283 Ga0495671_0074402 3300046692 Bacteria 1666
284 Ga0495649_0032461 3300046694 Bacteria 2875
285 Ga0495589_0011643 3300046794 Bacteria 4566
286 Ga0495589_0011969 3300046794 Bacteria 4498
287 Ga0495589_0017947 3300046794 Bacteria 3629
288 Ga0495589_0219611 3300046794 Bacteria 893
289 Ga0495600_0020767 3300046809 Bacteria 4202
290 Ga0495581_0000894 3300047315 Bacteria 15962
291 Ga0495581_0014115 3300047315 Bacteria 4629
292 Ga0495581_0042327 3300047315 Bacteria 2636
293 Ga0495581_0185087 3300047315 Bacteria 1218
294 Ga0495604_0004680 3300047317 Bacteria 10851
295 Ga0495604_0092208 3300047317 Bacteria 2244
296 Ga0495604_0104853 3300047317 Bacteria 2070
297 Ga0495636_0006254 3300047318 Bacteria 4678
298 Ga0495636_0016155 3300047318 Bacteria 2979
299 Ga0495636_0113996 3300047318 Bacteria 1191
300 Ga0495636_0219917 3300047318 Bacteria 872
301 Ga0495636_0356043 3300047318 Bacteria 691
302 Ga0495674_0296400 3300047319 Bacteria 1321
303 Ga0495674_0480570 3300047319 Bacteria 995
304 Ga0495672_0181111 3300047320 Bacteria 1067
305 Ga0495676_0003750 3300047321 Bacteria 13806
306 Ga0495676_0006687 3300047321 Bacteria 10623
307 Ga0495676_0011527 3300047321 Bacteria 7972
308 Ga0495676_0019227 3300047321 Bacteria 6009
309 Ga0495676_0025690 3300047321 Bacteria 5081
310 Ga0495683_0020995 3300047323 Bacteria 3366
311 Ga0495687_001818 3300047443 Bacteria 18758
312 Ga0495687_006121 3300047443 Bacteria 7460
313 Ga0495687_020730 3300047443 Bacteria 3199
314 Ga0495687_028816 3300047443 Bacteria 2577
315 Ga0495687_077566 3300047443 Bacteria 1311
316 Ga0495675_0031331 3300047444 Bacteria 3394
317 Ga0495675_0039569 3300047444 Bacteria 3002
318 Ga0495677_0025565 3300047445 Bacteria 2142
319 Ga0495685_003754 3300047447 Bacteria 4863
320 Ga0495685_090420 3300047447 Bacteria 1015
321 Ga0495685_184281 3300047447 Bacteria 672
322 Ga0495681_0015828 3300047470 Bacteria 4256
323 Ga0495684_0350959 3300047471 Bacteria 1047
324 Ga0495686_0061902 3300047472 Bacteria 2322
325 Ga0495593_0001606 3300047673 Bacteria 13352
326 Ga0495593_0053006 3300047673 Bacteria 2141
327 Ga0495593_0062245 3300047673 Bacteria 1950
328 Ga0495602_0136305 3300048088 Bacteria 1949
329 Ga0495602_0311515 3300048088 Bacteria 1148
330 Ga0495614_0031833 3300048089 Bacteria 2270
331 Ga0495626_0010921 3300048091 Bacteria 4823
332 Ga0496107_0846577 3300048910 Bacteria 668
333 Ga0496114_0122120 3300048917 Bacteria 2241
334 Ga0496117_0000235 3300048920 Bacteria 104830
335 Ga0496118_0281534 3300048921 Bacteria 925
336 Ga0496123_0018745 3300048926 Bacteria 5485
337 Ga0496124_0114751 3300048927 Bacteria 2163
338 Ga0496126_0715351 3300048929 Bacteria 777
339 Ga0501309_017118 3300049129 Bacteria 993
340 Ga0501307_002331 3300049162 Bacteria 1756
341 Ga0501307_021983 3300049162 Bacteria 836
342 Ga0501311_003066 3300049527 Bacteria 1670
343 Ga0501317_000671 3300049533 Bacteria 2549
344 Ga0501318_000540 3300049534 Bacteria 2472
345 Ga0501318_023186 3300049534 Bacteria 800
346 Ga0501318_032933 3300049534 Bacteria 712
347 Ga0501321_016235 3300049537 Bacteria 884
348 Ga0501031_0079699 3300049568 Bacteria 2134
349 Ga0501031_0101322 3300049568 Bacteria 1879
350 Ga0501032_0107449 3300049569 Bacteria 1848
351 Ga0501032_0329208 3300049569 Bacteria 985
352 Ga0501034_0075751 3300049571 Bacteria 3371
353 Ga0501036_0212734 3300049572 Bacteria 1624
354 Ga0501038_0001543 3300049574 Bacteria 21259
355 Ga0501038_0119456 3300049574 Bacteria 2176
356 Ga0501039_0112348 3300049575 Bacteria 2130
357 Ga0501039_0566570 3300049575 Bacteria 891
358 Ga0501043_0087837 3300049579 Bacteria 2443
359 Ga0501048_0247273 3300049582 Bacteria 1266
360 Ga0501067_0044783 3300049583 Bacteria 2458
361 Ga0501069_0201377 3300049585 Bacteria 1154
362 Ga0501069_0309377 3300049585 Bacteria 927
363 Ga0501070_0085159 3300049586 Bacteria 2617
364 Ga0501070_0184544 3300049586 Bacteria 1716
365 Ga0501070_0385130 3300049586 Bacteria 1136
366 Ga0501071_0325981 3300049587 Bacteria 1167
367 Ga0501075_0166703 3300049591 Bacteria 1681
368 Ga0501076_0093977 3300049592 Bacteria 2414
369 Ga0501080_0381291 3300049742 Bacteria 1270
370 Ga0501035_0223198 3300049822 Bacteria 1608
371 Ga0501044_0142418 3300049823 Bacteria 2385
372 Ga0501045_0609360 3300049824 Bacteria 808
373 nmdc:mga0yw44_1576_c1 3300050492 Bacteria 9147
374 nmdc:mga0yw44_163727_c1 3300050492 Bacteria 1457
375 nmdc:mga0yw44_389862_c1 3300050492 Bacteria 941
376 nmdc:mga0yw44_41392_c1 3300050492 Bacteria 2743
377 nmdc:mga0yw44_518811_c1 3300050492 Bacteria 809
378 nmdc:mga06z11_169269_c1 3300050494 Bacteria 1253
379 nmdc:mga06z11_1861_c1 3300050494 Bacteria 7951
380 nmdc:mga04h51_3474_c1 3300050495 Bacteria 3833
381 Ga0495601_0022746 3300053077 Bacteria 3852
382 Ga0495601_0044991 3300053077 Bacteria 2775
383 Ga0495601_0381113 3300053077 Bacteria 915
384 Ga0495612_0022288 3300053078 Bacteria 2539
385 Ga0495655_0052630 3300053083 Bacteria 1083
386 Ga0495619_0018524 3300053085 Bacteria 4417
387 Ga0500651_0101452 3300053093 Bacteria 1764
388 Ga0500641_0077812 3300053096 Bacteria 1404
389 Ga0500650_0191090 3300053098 Bacteria 935
390 Ga0500660_082493 3300053100 Bacteria 1466
391 Ga0500553_030021 3300053101 Bacteria 2721
392 Ga0500556_0000971 3300053104 Bacteria 15299
393 Ga0500560_000528 3300053107 Bacteria 5409
394 Ga0500560_031365 3300053107 Bacteria 1608
395 Ga0500593_000263 3300053117 Bacteria 21458
396 Ga0500594_0003181 3300053118 Bacteria 3596
397 Ga0500573_0000842 3300053140 Bacteria 13888
398 Ga0500573_0065301 3300053140 Bacteria 2081
399 Ga0500616_0000088 3300053153 Bacteria 191662
400 Ga0501082_0725073 3300060353 Bacteria 870
401 Ga0466962_0008126 3300061719 Bacteria 5031
402 Ga0466962_0011048 3300061719 Bacteria 4347
403 Ga0466962_0012797 3300061719 Bacteria 4036
404 Ga0530510_0242875 3300061734 Bacteria 1341
405 2676477450 2675903058 Bacteria 6822861
406 2547410176 2547132111 Bacteria 8013147
407 2583152655 2582580736 Bacteria 5325865
408 2585308290 2582581313 Bacteria 10042643
409 2585312212 2582581314 Bacteria 11452267
410 2585321522 2582581314 Bacteria 11452267
411 2616703239 2616644814 Bacteria 11555299
412 2623499838 2622736605 Bacteria 4992138
413 2643763272 2643221548 Bacteria 8053412
414 2644228034 2643221641 Bacteria 4490190
415 2644439144 2643221678 Bacteria 9540101
416 2644463858 2643221682 Bacteria 6743283
417 2644632385 2643221714 Bacteria 9015452
418 2738697249 2738541272 Bacteria 6848551
419 2739326851 2738543027 Bacteria 6409078
420 2740165545 2739367898 Bacteria 4367674
421 2784589510 2784132148 Bacteria 8627943
422 2786671751 2786546132 Bacteria 10419719
423 2804845748 2802429296 Bacteria 7227771
424 2808843147 2808606359 Bacteria 9866990
425 2808921507 2808606375 Bacteria 9466072
426 2809233173 2808606448 Bacteria 8656184
427 2812479631 2811994917 Bacteria 7761064
428 2819698492 2818991463 Bacteria 7948711
429 2827634707 2827628540 Bacteria 6858585
430 2842891828 2842888712 Bacteria 4279094
431 2857733516 2857729791 Bacteria 4040535
432 2862181494 2862178590 Bacteria 8583590
433 2862283565 2862281513 Bacteria 9621493
434 2863411750 2863404153 Bacteria 9672205
435 2866555028 2866552031 Bacteria 5824618
436 2867436836 2867428634 Bacteria 9590268
437 2875395038 2875391855 Bacteria 7600475
438 2895452492 2895442618 Bacteria 11027144
439 2912718620 2912715099 Bacteria 9460473
440 2912729299 2912723979 Bacteria 8557534
441 2919475807 2919468124 Bacteria 9133025
442 2946049343 2946045630 Bacteria 8527308
443 2954002876 2954002825 Bacteria 9173742
444 2954678036 2954673503 Bacteria 9685905
445 2954686122 2954682443 Bacteria 9862841
446 2966602235 2966598605 Bacteria 7676064
447 2984580204 2984576629 Bacteria 4248407
448 2990089298 2990088156 Bacteria 6657676
449 2990259054 2990256926 Bacteria 4252839
450 3006488950 3006486233 Bacteria 8157040
451 3006494357 3006493962 Bacteria 8825450
452 3006499759 3006493962 Bacteria 8825450
453 8008566329 8008558824 Bacteria 10610750
454 8008577970 8008574985 Bacteria 7815457
455 8023630016 8023623736 Bacteria 8593882
456 8025416912 8025413630 Bacteria 7014048
457 8048132664 8048127548 Bacteria 11053136
458 8054611943 8054609563 Bacteria 5170090
459 8055180893 8055172936 Bacteria 9305943
460 8056833792 8056829672 Bacteria 9045328
461 8057348913 8057345674 Bacteria 4160394
462 8057569749 8057568493 Bacteria 7221719
463 JGI24739J22299_10012060
464 rootH1_10007719
465 rootH2_10048161
466 rootL2_10050146
467 rootL2_10136955
468 Ga0006562J51391_1063772
469 Ga0006562J51391_1063773
470 Ga0070680_100228824
471 Ga0070668_100001849
472 Ga0070668_100778298
473 Ga0070674_101143635
474 Ga0070667_100316827
475 Ga0070709_10188805
476 Ga0070713_100077572
477 Ga0068867_100490604
478 Ga0070679_100853539
479 Ga0068853_100117597
480 Ga0070665_100349625
481 Ga0068856_100147506
482 Ga0068861_100776343
483 Ga0068862_100443865
484 Ga0075365_10015400
485 Ga0075365_10064952
486 Ga0075365_10607021
487 Ga0075368_10005115
488 Ga0075367_10006729
489 Ga0075436_100480399
490 Ga0105243_10265885
491 Ga0105238_10515220
492 Ga0105246_10000350
493 Ga0157372_10568137
494 Ga0157377_10279337
495 Ga0183367_1002
496 Ga0206353_10590688
497 Ga0224712_10012943
498 Ga0209051_1059972
499 Ga0207688_10022775
500 Ga0207647_10043782
501 Ga0207647_10175573
502 Ga0207699_10159087
503 Ga0207660_10898662
504 Ga0207652_10688174
505 Ga0207700_10033956
506 Ga0207664_10081897
507 Ga0207669_10233744
508 Ga0207704_10175682
509 Ga0207661_10306339
510 Ga0207712_10873471
511 Ga0207668_10050988
512 Ga0207658_10235441
513 Ga0207639_10076961
514 Ga0207674_10699526
515 Ga0207675_100385193
516 Ga0209813_10012589
517 Ga0268264_10394158
518 Ga0307517_10142039
519 Ga0307515_10000258
520 Ga0307515_10109991
521 Ga0307511_10137285
522 Ga0307512_10001966
523 Ga0307512_10069595
524 Ga0307512_10086145
525 Ga0307512_10242643
526 Ga0307512_10249720
527 Ga0307513_10017989
528 Ga0307509_10007108
529 Ga0307509_10173200
530 Ga0307508_10004187
531 Ga0307508_10027953
532 Ga0307508_10049559
533 Ga0307508_10228331
534 Ga0307514_10175742
535 Ga0307516_10001875
536 Ga0307405_10018487
537 Ga0307405_10625028
538 Ga0307413_10030182
539 Ga0307413_10418380
540 Ga0307413_10554971
541 Ga0307518_10212810
542 Ga0307518_10271235
543 Ga0307518_10296469
544 Ga0307410_10143971
545 Ga0307406_10083120
546 Ga0307406_10176032
547 Ga0307407_10016354
548 Ga0307412_10138474
549 Ga0307412_10180593
550 Ga0307409_100101211
551 Ga0307409_100196207
552 Ga0307409_100222441
553 Ga0307409_100223934
554 Ga0307409_100529590
555 Ga0307409_100536485
556 Ga0307409_100754587
557 Ga0307409_101066226
558 Ga0307416_100130590
559 Ga0307416_100236180
560 Ga0307416_100570787
561 Ga0307416_101151354
562 Ga0307411_10214474
563 Ga0307411_10665542
564 Ga0307415_100004523
565 Ga0307415_100128178
566 Ga0307415_100181716
567 Ga0307415_100283584
568 Ga0307415_100471192
569 Ga0307507_10000240
570 Ga0307507_10025553
571 Ga0307507_10066141
572 Ga0307510_10190566
573 Ga0307510_10355450
574 Ga0373935_0018059
575 Ga0395898_0036579
576 Ga0395898_0345444
577 Ga0395898_0764534
578 Ga0395901_0021537
579 Ga0395901_0057315
580 Ga0395901_0259982
581 Ga0439438_022771
582 Ga0439466_0111644
583 Ga0451789_0060067
584 Ga0451789_0997067
585 Ga0451791_0077492
586 Ga0451791_0381482
587 Ga0451793_1768735
588 Ga0451797_0668506
589 Ga0451807_1652371
590 Ga0451837_1090609
591 Ga0451837_1808306
592 Ga0451839_0692888
593 Ga0451841_0387088
594 Ga0451843_0744411
595 Ga0451853_1127399
596 Ga0439455_0006712
597 Ga0439457_046037
598 Ga0450894_000149
599 Ga0450896_002049
600 Ga0450898_027737
601 Ga0450899_000455
602 Ga0450900_008934
603 Ga0450902_010444
604 Ga0450903_000008
605 Ga0450906_000591
606 Ga0439458_0000093
607 Ga0439458_0045392
608 Ga0450901_009529
609 Ga0466969_0017911
610 Ga0466972_0019896
611 Ga0466972_0020895
612 Ga0466972_0024669
613 Ga0466972_0040971
614 Ga0466965_0068832
615 Ga0466965_0128170
616 Ga0466965_0379200
617 Ga0466966_0023774
618 Ga0466966_0029411
619 Ga0466961_0010395
620 Ga0466961_0019484
621 Ga0466961_0039844
622 Ga0466963_0002412
623 Ga0466963_0026360
624 Ga0466963_0091845
625 Ga0466964_0016623
626 Ga0466964_0093536
627 Ga0466971_0003866
628 Ga0466971_0038227
629 Ga0466971_0038444
630 Ga0466971_0087184
631 Ga0466968_0005347
632 Ga0466968_0116871
633 Ga0466970_0033502
634 Ga0466970_0055248
635 Ga0466970_0139847
636 Ga0466970_0264623
637 Ga0466970_0266521
638 Ga0466957_0001811
639 Ga0466957_0393771
640 Ga0466960_0073673
641 Ga0466960_0101376
642 Ga0466959_0173070
643 Ga0466958_0006367
644 Ga0466958_0094291
645 Ga0466958_0493477
646 Ga0466967_0001656
647 Ga0466967_0004873
648 Ga0466967_0012352
649 Ga0466967_0058691
650 Ga0466967_0086551
651 Ga0466967_0149194
652 Ga0495592_0080621
653 Ga0495603_0004220
654 Ga0495603_0014053
655 Ga0495603_0014817
656 Ga0495603_0023736
657 Ga0495629_0002208
658 Ga0495629_0038569
659 Ga0495629_0126088
660 Ga0495629_0180190
661 Ga0495638_0152867
662 Ga0495651_0011388
663 Ga0495651_0044210
664 Ga0495651_0179225
665 Ga0495651_0198530
666 Ga0495653_0009606
667 Ga0495580_0065657
668 Ga0495605_0039502
669 Ga0495662_0007088
670 Ga0495662_0035761
671 Ga0495662_0049576
672 Ga0495662_0095121
673 Ga0495664_0028284
674 Ga0495585_0015711
675 Ga0495594_0001139
676 Ga0495594_0006795
677 Ga0495594_0145571
678 Ga0495596_0040519
679 Ga0495583_0008560
680 Ga0495583_0035892
681 Ga0495583_0158978
682 Ga0495606_0013058
683 Ga0495608_0001061
684 Ga0495608_0114150
685 Ga0495610_0007038
686 Ga0495616_0021961
687 Ga0495618_0002300
688 Ga0495618_0084611
689 Ga0495618_0288135
690 Ga0495620_0121844
691 Ga0495628_0004626
692 Ga0495628_0132296
693 Ga0495628_0179750
694 Ga0495631_0067455
695 Ga0495632_0040811
696 Ga0495637_0020890
697 Ga0495666_0001304
698 Ga0495666_0165276
699 Ga0495652_0015292
700 Ga0495652_0033557
701 Ga0495652_0077589
702 Ga0495654_0022316
703 Ga0495665_0002501
704 Ga0495640_0000167
705 Ga0495640_0019352
706 Ga0495640_0123285
707 Ga0495640_0145859
708 Ga0495587_0005512
709 Ga0495645_0003929
710 Ga0495645_0039484
711 Ga0495622_0002733
712 Ga0495633_0013816
713 Ga0495667_0120345
714 Ga0495667_0141217
715 Ga0495667_0164447
716 Ga0495634_0024343
717 Ga0495634_0077672
718 Ga0495611_0012798
719 Ga0495611_0023155
720 Ga0495611_0042736
721 Ga0495611_0102376
722 Ga0495625_0003109
723 Ga0495625_0014028
724 Ga0495625_0108840
725 Ga0495635_0007091
726 Ga0495661_0008634
727 Ga0495657_0002270
728 Ga0495657_0006398
729 Ga0495657_0018901
730 Ga0495657_0168969
731 Ga0495623_0031067
732 Ga0495623_0185817
733 Ga0495646_0000979
734 Ga0495646_0128842
735 Ga0495646_0228529
736 Ga0495613_0008163
737 Ga0495613_0016279
738 Ga0495613_0083299
739 Ga0495613_0117986
740 Ga0495613_0364455
741 Ga0495624_0030296
742 Ga0495624_0044684
743 Ga0495624_0257919
744 Ga0495670_0000953
745 Ga0495671_0074402
746 Ga0495649_0032461
747 Ga0495589_0011643
748 Ga0495589_0011969
749 Ga0495589_0017947
750 Ga0495589_0219611
751 Ga0495600_0020767
752 Ga0495581_0000894
753 Ga0495581_0014115
754 Ga0495581_0042327
755 Ga0495581_0185087
756 Ga0495604_0004680
757 Ga0495604_0092208
758 Ga0495604_0104853
759 Ga0495636_0006254
760 Ga0495636_0016155
761 Ga0495636_0113996
762 Ga0495636_0219917
763 Ga0495636_0356043
764 Ga0495674_0296400
765 Ga0495674_0480570
766 Ga0495672_0181111
767 Ga0495676_0003750
768 Ga0495676_0006687
769 Ga0495676_0011527
770 Ga0495676_0019227
771 Ga0495676_0025690
772 Ga0495683_0020995
773 Ga0495687_001818
774 Ga0495687_006121
775 Ga0495687_020730
776 Ga0495687_028816
777 Ga0495687_077566
778 Ga0495675_0031331
779 Ga0495675_0039569
780 Ga0495677_0025565
781 Ga0495685_003754
782 Ga0495685_090420
783 Ga0495685_184281
784 Ga0495681_0015828
785 Ga0495684_0350959
786 Ga0495686_0061902
787 Ga0495593_0001606
788 Ga0495593_0053006
789 Ga0495593_0062245
790 Ga0495602_0136305
791 Ga0495602_0311515
792 Ga0495614_0031833
793 Ga0495626_0010921
794 Ga0496107_0846577
795 Ga0496114_0122120
796 Ga0496117_0000235
797 Ga0496118_0281534
798 Ga0496123_0018745
799 Ga0496124_0114751
800 Ga0496126_0715351
801 Ga0501309_017118
802 Ga0501307_002331
803 Ga0501307_021983
804 Ga0501311_003066
805 Ga0501317_000671
806 Ga0501318_000540
807 Ga0501318_023186
808 Ga0501318_032933
809 Ga0501321_016235
810 Ga0501031_0079699
811 Ga0501031_0101322
812 Ga0501032_0107449
813 Ga0501032_0329208
814 Ga0501034_0075751
815 Ga0501036_0212734
816 Ga0501038_0001543
817 Ga0501038_0119456
818 Ga0501039_0112348
819 Ga0501039_0566570
820 Ga0501043_0087837
821 Ga0501048_0247273
822 Ga0501067_0044783
823 Ga0501069_0201377
824 Ga0501069_0309377
825 Ga0501070_0085159
826 Ga0501070_0184544
827 Ga0501070_0385130
828 Ga0501071_0325981
829 Ga0501075_0166703
830 Ga0501076_0093977
831 Ga0501080_0381291
832 Ga0501035_0223198
833 Ga0501044_0142418
834 Ga0501045_0609360
835 nmdc:mga0yw44_1576_c1
836 nmdc:mga0yw44_163727_c1
837 nmdc:mga0yw44_389862_c1
838 nmdc:mga0yw44_41392_c1
839 nmdc:mga0yw44_518811_c1
840 nmdc:mga06z11_169269_c1
841 nmdc:mga06z11_1861_c1
842 nmdc:mga04h51_3474_c1
843 Ga0495601_0022746
844 Ga0495601_0044991
845 Ga0495601_0381113
846 Ga0495612_0022288
847 Ga0495655_0052630
848 Ga0495619_0018524
849 Ga0500651_0101452
850 Ga0500641_0077812
851 Ga0500650_0191090
852 Ga0500660_082493
853 Ga0500553_030021
854 Ga0500556_0000971
855 Ga0500560_000528
856 Ga0500560_031365
857 Ga0500593_000263
858 Ga0500594_0003181
859 Ga0500573_0000842
860 Ga0500573_0065301
861 Ga0500616_0000088
862 Ga0501082_0725073
863 Ga0466962_0008126
864 Ga0466962_0011048
865 Ga0466962_0012797
866 Ga0530510_0242875
867 2676477450
868 2547410176
869 2583152655
870 2585308290
871 2585312212
872 2585321522
873 2616703239
874 2623499838
875 2643763272
876 2644228034
877 2644439144
878 2644463858
879 2644632385
880 2738697249
881 2739326851
882 2740165545
883 2784589510
884 2786671751
885 2804845748
886 2808843147
887 2808921507
888 2809233173
889 2812479631
890 2819698492
891 2827634707
892 2842891828
893 2857733516
894 2862181494
895 2862283565
896 2863411750
897 2866555028
898 2867436836
899 2875395038
900 2895452492
901 2912718620
902 2912729299
903 2919475807
904 2946049343
905 2954002876
906 2954678036
907 2954686122
908 2966602235
909 2984580204
910 2990089298
911 2990259054
912 3006488950
913 3006494357
914 3006499759
915 8008566329
916 8008577970
917 8023630016
918 8025416912
919 8048132664
920 8054611943
921 8055180893
922 8056833792
923 8057348913
924 8057569749

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

3

155

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k1y-assembly1.cif.gz_A x-ray structure of oxidoreductase from corynebacterium diphtheriae. orthorombic crystal form, northeast structural genomics consortium target cdr100d 0.9599 2 169
7qw4-assembly6.cif.gz_F pden_5119 protein 0.8983 2 165
3k1y-assembly1.cif.gz_A x-ray structure of oxidoreductase from corynebacterium diphtheriae. orthorombic crystal form, northeast structural genomics consortium target cdr100d 0.883 2 169
7qw4-assembly2.cif.gz_B pden_5119 protein 0.881 3 168
4pty-assembly1.cif.gz_D crystal structure of the escherichia coli alkanesulfonate fmn reductase ssue in apo form 0.88 1 167
ID Description Score Start End Superfamily
3k1yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9238 2 169 3.40.50.360
3k1yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8781 2 169 3.40.50.360
af_Q2G0L7_1_184_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8592 1 168 3.40.50.360
6dqpA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8426 1 167 3.40.50.360
4c76B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8351 1 179 3.40.50.360
ID Description Score Start End GO Terms
AF-B5I6V5-F1-model_v4 FMN reductase 0.9906 1 149 GO:0016491
AF-A0A660LDX6-F1-model_v4 FMN reductase 0.9893 2 169 GO:0016491
AF-A0A7X6HBX7-F1-model_v4 deleted 0.9873 2 143
AF-B5I6V5-F1-model_v4 FMN reductase 0.984 1 149 GO:0016491
AF-A0A0G3GY14-F1-model_v4 LLM-partnered FMN reductase, CE1759 family (EC 1.5.1.38) 0.979 2 167 GO:0052873

Map