F448974

General Info

Members Datasets Scaffolds Average Seq Length
462 294 925 258

Family's Representative Sequence

Representative Sequence 3300046543|Ga0495645_0155467|Ga0495645_0155467_711_1562
Length 283
Sequence MNAARMPAGTRTAVRNAELVHVTAPRFKDKVVIVTGAAQGIGRGVALRIAAEGGTVLAVDRADIVEEVVQEIKACGGTAAAFQADLETFAGAQAMVAECLARFRRVDVLVNNVGGTIWAKPYEHYEEAQIEAEIRRSLFPTLWSCRAALPFMVKKKRGVIVNVSSVATRGVHRVPYSAAKGGVNALTASLAMEHTRNGIRINATAPGGTEAPPRRVPRNQAKVKAGARDTAWYQGVVDQTVDSSLMHRYGTIDEQVAPILFLASDDASYLTGTVVPVGGGDLG

Samples

Sample ID Description Type Environment
1 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
65 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
68 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
73 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
81 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
84 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
134 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
135 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
136 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
137 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
138 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
139 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
140 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
141 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
142 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
169 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
170 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
171 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
172 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
173 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
174 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
179 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
182 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
183 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
190 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
191 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
197 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
200 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
208 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
217 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
218 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
221 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
222 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
225 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
228 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
244 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
247 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
250 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
251 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
252 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
255 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
256 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
262 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
263 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
264 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
265 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
266 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
267 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
268 2643221556 Massilia sp. Root1485 Isolate Unclassified
269 2643221645 Massilia sp. Root351 Isolate Unclassified
270 2643221684 Massilia sp. Root133 Isolate Unclassified
271 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
272 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
273 2738541300 Massilia sp. GV016 Isolate Unclassified
274 2738543018 Massilia sp. GV045 Isolate Unclassified
275 2738543030 Massilia sp. GV097 Isolate Unclassified
276 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
277 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
278 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
279 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
280 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
281 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
282 2885266251 Ralstonia sp. SET104 Isolate Nodule
283 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
284 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
285 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
286 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
287 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
288 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
289 2920879853 Kocuria salina CV6 Isolate Unclassified
290 2928058823 Ralstonia sp. 1138 Isolate Unclassified
291 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
292 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
293 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
294 642555112 Paraburkholderia phymatum STM815 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.13
Metatranscriptomes 1.52
Isolates 7.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.07
Nodule 1.73
Rhizoplane 5.41
Rhizosphere 67.32
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495645_0155467 3300046543 Bacteria 1585
2 JGI24741J21665_1000284 3300001915 Bacteria 15328
3 JGI24740J21852_10000914 3300001979 Bacteria 13096
4 JGI25156J39149_1011898 3300002705 Bacteria 1945
5 JGI25154J39366_1000375 3300002738 Bacteria 24806
6 JGI25151J46595_10000065 3300003187 Bacteria 145136
7 rootL2_10011935 3300003322 Bacteria 9880
8 rootH1_10084316 3300003316 Bacteria 4478
9 rootH1_10084316 3300003323 Bacteria 5128
10 JGI25160J50197_1000036 3300003354 Bacteria 166820
11 Ga0055538_1001132 3300003751 Bacteria 5745
12 Ga0055538_1003336 3300003751 Bacteria 2062
13 Ga0055539_1000071 3300003752 Bacteria 131539
14 Ga0055533_1006653 3300003756 Bacteria 1671
15 Ga0055532_1000019 3300003758 Bacteria 286358
16 Ga0055525_1000371 3300003759 Bacteria 29809
17 Ga0055527_1001224 3300003760 Bacteria 5696
18 Ga0055535_1000014 3300003761 Bacteria 286358
19 Ga0055542_1000739 3300003762 Bacteria 25276
20 Ga0055529_1000096 3300003763 Bacteria 133329
21 Ga0055526_1000344 3300003771 Bacteria 38140
22 Ga0055526_1020490 3300003771 Bacteria 2351
23 Ga0055537_1000066 3300003773 Bacteria 76478
24 Ga0055537_1001530 3300003773 Bacteria 8878
25 Ga0055524_1000422 3300003775 Bacteria 35586
26 Ga0055524_1016123 3300003775 Bacteria 2695
27 Ga0055534_1000057 3300003784 Bacteria 85576
28 Ga0055534_1000135 3300003784 Bacteria 55272
29 Ga0055528_1000069 3300003790 Bacteria 83002
30 Ga0055541_1008226 3300003841 Bacteria 1671
31 Ga0055541_1010059 3300003841 Bacteria 1438
32 Ga0065165_1000533 3300005262 Bacteria 57970
33 Ga0070683_100098827 3300005329 Bacteria 2747
34 Ga0068869_100506474 3300005334 Bacteria 1009
35 Ga0068868_100433052 3300005338 Bacteria 1141
36 Ga0070661_100001350 3300005344 Bacteria 17160
37 Ga0070673_100501613 3300005364 Bacteria 1098
38 Ga0070711_100003718 3300005439 Bacteria 8943
39 Ga0070663_100000036 3300005455 Bacteria 63282
40 Ga0068867_100058186 3300005459 Bacteria 2864
41 Ga0068853_100132669 3300005539 Bacteria 2231
42 Ga0070672_100306209 3300005543 Bacteria 1348
43 Ga0070665_100676577 3300005548 Bacteria 1045
44 Ga0070664_100000096 3300005564 Bacteria 56242
45 Ga0068854_100000076 3300005578 Bacteria 70578
46 Ga0068856_100000203 3300005614 Bacteria 63370
47 Ga0068870_10188543 3300005840 Bacteria 1243
48 Ga0075366_10005964 3300006195 Bacteria 6633
49 Ga0075430_100358071 3300006846 Bacteria 1205
50 Ga0075434_100604111 3300006871 Bacteria 1116
51 Ga0075434_100629851 3300006871 Bacteria 1091
52 Ga0105240_10002809 3300009093 Bacteria 27496
53 Ga0105240_10036242 3300009093 Bacteria 6347
54 Ga0105240_10380718 3300009093 Bacteria 1594
55 Ga0111539_10723057 3300009094 Bacteria 1159
56 Ga0105245_10393821 3300009098 Bacteria 1383
57 Ga0105245_10493626 3300009098 Bacteria 1239
58 Ga0105247_10315060 3300009101 Bacteria 1090
59 Ga0105248_10009097 3300009177 Bacteria 10926
60 Ga0105248_10834187 3300009177 Bacteria 1040
61 Ga0105237_10002917 3300009545 Bacteria 20717
62 Ga0105238_10039182 3300009551 Bacteria 4806
63 Ga0105147_102850 3300009982 Bacteria 1436
64 Ga0105239_10001353 3300010375 Bacteria 32991
65 Ga0105246_10079930 3300011119 Bacteria 2326
66 Ga0157373_10042483 3300013100 Bacteria 3249
67 Ga0157371_10000501 3300013102 Bacteria 47393
68 Ga0157370_10000363 3300013104 Bacteria 57197
69 Ga0157370_10237608 3300013104 Bacteria 1686
70 Ga0157369_10006498 3300013105 Bacteria 13550
71 Ga0163162_10115827 3300013306 Bacteria 2780
72 Ga0163162_10196761 3300013306 Bacteria 2144
73 Ga0157375_10595368 3300013308 Bacteria 1265
74 Ga0182008_10006607 3300014497 Bacteria 6466
75 Ga0157377_10293663 3300014745 Bacteria 1070
76 Ga0182006_1034234 3300015261 Bacteria 2033
77 Ga0182007_10012217 3300015262 Bacteria 3312
78 Ga0183361_10021 3300016635 Bacteria 114065
79 Ga0197907_11189099 3300020069 Bacteria 3346
80 Ga0206356_10834160 3300020070 Bacteria 1917
81 Ga0206355_1620200 3300020076 Bacteria 2127
82 Ga0206351_10400843 3300020077 Bacteria 3412
83 Ga0206354_10180779 3300020081 Bacteria 3813
84 Ga0206353_11231673 3300020082 Bacteria 1780
85 Ga0154015_1250880 3300020610 Bacteria 13258
86 Ga0213872_10167220 3300021361 Bacteria 955
87 Ga0213872_10193416 3300021361 Bacteria 874
88 Ga0209784_100003 3300025224 Bacteria 1379451
89 Ga0209784_100644 3300025224 Bacteria 10493
90 Ga0209784_102084 3300025224 Bacteria 2188
91 Ga0209566_100002 3300025225 Bacteria 2614868
92 Ga0209566_100822 3300025225 Bacteria 15779
93 Ga0209674_100008 3300025226 Bacteria 1076909
94 Ga0209674_100118 3300025226 Bacteria 135635
95 Ga0209674_104406 3300025226 Bacteria 2300
96 Ga0209672_100379 3300025228 Bacteria 27206
97 Ga0209147_100002 3300025229 Bacteria 2158988
98 Ga0209563_100004 3300025230 Bacteria 1814108
99 Ga0209563_100007 3300025230 Bacteria 1579402
100 Ga0209563_112044 3300025230 Bacteria 1199
101 Ga0209258_100002 3300025242 Bacteria 2158988
102 Ga0209646_1000203 3300025246 Bacteria 70126
103 Ga0209677_100009 3300025253 Bacteria 749530
104 Ga0209677_105523 3300025253 Bacteria 3274
105 Ga0209677_109448 3300025253 Bacteria 1749
106 Ga0209148_1000021 3300025254 Bacteria 714645
107 Ga0209148_1000386 3300025254 Bacteria 52794
108 Ga0209148_1004628 3300025254 Bacteria 3333
109 Ga0209759_1002446 3300025256 Bacteria 8142
110 Ga0209565_1000006 3300025263 Bacteria 897294
111 Ga0209565_1000109 3300025263 Bacteria 120345
112 Ga0209455_1000076 3300025272 Bacteria 284092
113 Ga0209673_1000004 3300025273 Bacteria 896155
114 Ga0209673_1027751 3300025273 Bacteria 1836
115 Ga0209130_1006039 3300025284 Bacteria 4026
116 Ga0209675_1000006 3300025291 Bacteria 732267
117 Ga0209675_1000118 3300025291 Bacteria 110507
118 Ga0209025_1000159 3300025294 Bacteria 167081
119 Ga0209564_1000102 3300025295 Bacteria 222597
120 Ga0209564_1002619 3300025295 Bacteria 13760
121 Ga0209564_1005614 3300025295 Bacteria 7058
122 Ga0209758_1013848 3300025297 Bacteria 4350
123 Ga0209256_1000037 3300025299 Bacteria 377661
124 Ga0209256_1005672 3300025299 Bacteria 7029
125 Ga0207426_1000014 3300025302 Bacteria 649413
126 Ga0209051_1030921 3300025303 Bacteria 2070
127 Ga0207688_10080444 3300025901 Bacteria 1860
128 Ga0207695_10000558 3300025913 Bacteria 76735
129 Ga0207695_10014353 3300025913 Bacteria 9392
130 Ga0207695_10279159 3300025913 Bacteria 1564
131 Ga0207671_10001552 3300025914 Bacteria 26284
132 Ga0207649_10001028 3300025920 Bacteria 17169
133 Ga0207649_10356298 3300025920 Bacteria 1084
134 Ga0207694_10023185 3300025924 Bacteria 4712
135 Ga0207687_10115073 3300025927 Bacteria 2003
136 Ga0207690_10012131 3300025932 Bacteria 5155
137 Ga0207704_10102051 3300025938 Bacteria 1915
138 Ga0207691_10044040 3300025940 Bacteria 4110
139 Ga0207711_10033030 3300025941 Bacteria 4377
140 Ga0207661_10253347 3300025944 Bacteria 1566
141 Ga0207679_10000122 3300025945 Bacteria 63505
142 Ga0207640_10000017 3300025981 Bacteria 208145
143 Ga0207703_10172686 3300026035 Bacteria 1902
144 Ga0207639_10105142 3300026041 Bacteria 2290
145 Ga0207678_10000129 3300026067 Bacteria 63305
146 Ga0207708_10327244 3300026075 Bacteria 1252
147 Ga0207702_10000024 3300026078 Bacteria 187719
148 Ga0207648_10126807 3300026089 Bacteria 2245
149 Ga0207674_10091743 3300026116 Bacteria 3027
150 Ga0207674_10440198 3300026116 Bacteria 1260
151 Ga0207683_10042692 3300026121 Bacteria 3961
152 Ga0207698_10864230 3300026142 Bacteria 910
153 Ga0265332_10010325 3300031238 Bacteria 4158
154 Ga0307513_10000684 3300031456 Bacteria 48768
155 Ga0307408_100027775 3300031548 Bacteria 3903
156 Ga0307408_100064357 3300031548 Bacteria 2685
157 Ga0307408_100082003 3300031548 Bacteria 2413
158 Ga0307405_10004257 3300031731 Bacteria 6735
159 Ga0307405_10197386 3300031731 Bacteria 1458
160 Ga0307405_10442927 3300031731 Bacteria 1028
161 Ga0307410_10033297 3300031852 Bacteria 3326
162 Ga0307410_10065104 3300031852 Bacteria 2507
163 Ga0307410_10098368 3300031852 Bacteria 2092
164 Ga0307406_10009976 3300031901 Bacteria 5342
165 Ga0307406_10049679 3300031901 Bacteria 2655
166 Ga0307407_10145364 3300031903 Bacteria 1534
167 Ga0307412_10086025 3300031911 Bacteria 2186
168 Ga0307409_100025621 3300031995 Bacteria 4140
169 Ga0307409_100204766 3300031995 Bacteria 1768
170 Ga0307409_100287134 3300031995 Bacteria 1524
171 Ga0307416_100237917 3300032002 Bacteria 1761
172 Ga0307415_100076250 3300032126 Bacteria 2376
173 Ga0307415_100105974 3300032126 Bacteria 2074
174 Ga0395899_0000970 3300037312 Bacteria 26551
175 Ga0395899_0002475 3300037312 Bacteria 14988
176 Ga0395899_0243631 3300037312 Bacteria 1236
177 Ga0395900_0000602 3300037418 Bacteria 49161
178 Ga0395900_0000914 3300037418 Bacteria 38831
179 Ga0395900_0024556 3300037418 Bacteria 6171
180 Ga0395900_0034290 3300037418 Bacteria 5225
181 Ga0395900_0054170 3300037418 Bacteria 4130
182 Ga0395900_0069298 3300037418 Bacteria 3625
183 Ga0395898_0006888 3300037466 Bacteria 12090
184 Ga0395898_0117339 3300037466 Bacteria 2550
185 Ga0395898_0130218 3300037466 Bacteria 2410
186 Ga0395898_0192090 3300037466 Bacteria 1951
187 Ga0395905_0000009 3300037471 Bacteria 488729
188 Ga0395905_0004377 3300037471 Bacteria 14702
189 Ga0395905_0011187 3300037471 Bacteria 8676
190 Ga0395905_0019980 3300037471 Bacteria 6348
191 Ga0395905_0075915 3300037471 Bacteria 3149
192 Ga0395905_0423957 3300037471 Bacteria 1227
193 Ga0395901_0000246 3300038443 Bacteria 67512
194 Ga0395901_0025152 3300038443 Bacteria 6111
195 Ga0395901_0117947 3300038443 Bacteria 2789
196 Ga0395901_0222947 3300038443 Bacteria 1970
197 Ga0395901_0284938 3300038443 Bacteria 1716
198 Ga0395901_0508276 3300038443 Bacteria 1226
199 Ga0436361_0171477 3300039447 Bacteria 5625
200 Ga0436361_0233403 3300039447 Bacteria 2232
201 Ga0436361_0612111 3300039447 Bacteria 11842
202 Ga0451789_1172055 3300041443 Bacteria 930
203 Ga0439433_0017721 3300041999 Bacteria 1582
204 Ga0439449_0032357 3300042007 Bacteria 1950
205 Ga0450904_000505 3300042139 Bacteria 7585
206 Ga0439434_0023529 3300042435 Bacteria 1856
207 Ga0466972_0016260 3300044658 Bacteria 3718
208 Ga0466978_0033871 3300044671 Bacteria 3132
209 Ga0466982_0142136 3300044672 Bacteria 1472
210 Ga0466965_0009212 3300044683 Bacteria 4586
211 Ga0466965_0029490 3300044683 Bacteria 2670
212 Ga0466965_0064428 3300044683 Bacteria 1835
213 Ga0466966_0011140 3300044684 Bacteria 5966
214 Ga0466961_0000059 3300044693 Bacteria 65381
215 Ga0466964_0006591 3300044706 Bacteria 4330
216 Ga0466957_0001017 3300044842 Bacteria 14447
217 Ga0466957_0251366 3300044842 Bacteria 1175
218 Ga0466960_0018030 3300044901 Bacteria 3088
219 Ga0466960_0143624 3300044901 Bacteria 1270
220 Ga0466959_0000594 3300045049 Bacteria 21087
221 Ga0466967_0027413 3300045976 Bacteria 4738
222 Ga0495617_001694 3300046452 Bacteria 9461
223 Ga0495592_0002627 3300046454 Bacteria 12701
224 Ga0495603_0000940 3300046455 Bacteria 16757
225 Ga0495590_0067847 3300046457 Bacteria 1250
226 Ga0495629_0004842 3300046459 Bacteria 10096
227 Ga0495629_0015962 3300046459 Bacteria 5396
228 Ga0495638_0025386 3300046460 Bacteria 3853
229 Ga0495638_0068118 3300046460 Bacteria 2183
230 Ga0495641_0008515 3300046461 Bacteria 6238
231 Ga0495651_0048644 3300046462 Bacteria 3274
232 Ga0495651_0108266 3300046462 Bacteria 2058
233 Ga0495653_0015578 3300046463 Bacteria 6197
234 Ga0495653_0108389 3300046463 Bacteria 2000
235 Ga0495653_0163913 3300046463 Bacteria 1541
236 Ga0495650_0000279 3300046471 Bacteria 97669
237 Ga0495580_0000801 3300046472 Bacteria 27182
238 Ga0495580_0010592 3300046472 Bacteria 7175
239 Ga0495580_0571670 3300046472 Bacteria 749
240 Ga0495582_0004114 3300046473 Bacteria 8176
241 Ga0495582_0056502 3300046473 Bacteria 2163
242 Ga0495582_0069861 3300046473 Bacteria 1942
243 Ga0495605_0000252 3300046474 Bacteria 63405
244 Ga0495605_0071373 3300046474 Bacteria 1640
245 Ga0495639_0002549 3300046475 Bacteria 7943
246 Ga0495639_0093991 3300046475 Bacteria 1410
247 Ga0495662_0004048 3300046476 Bacteria 7383
248 Ga0495664_0002721 3300046477 Bacteria 9501
249 Ga0495584_0028033 3300046491 Bacteria 2852
250 Ga0495585_0047192 3300046492 Bacteria 2399
251 Ga0495594_0001009 3300046499 Bacteria 14669
252 Ga0495594_0062428 3300046499 Bacteria 2063
253 Ga0495596_0007364 3300046500 Bacteria 4968
254 Ga0495607_0011213 3300046501 Bacteria 5978
255 Ga0495607_0101269 3300046501 Bacteria 1542
256 Ga0495583_0042654 3300046506 Bacteria 2117
257 Ga0495606_0012877 3300046507 Bacteria 6659
258 Ga0495606_0088385 3300046507 Bacteria 1910
259 Ga0495610_0163925 3300046512 Bacteria 937
260 Ga0495616_0007222 3300046513 Bacteria 6658
261 Ga0495616_0010304 3300046513 Bacteria 5416
262 Ga0495618_0011461 3300046514 Bacteria 5377
263 Ga0495628_0006259 3300046516 Bacteria 10402
264 Ga0495628_0006743 3300046516 Bacteria 10003
265 Ga0495628_0012450 3300046516 Bacteria 7173
266 Ga0495630_0025892 3300046517 Bacteria 4340
267 Ga0495630_0027030 3300046517 Bacteria 4252
268 Ga0495631_0015152 3300046518 Bacteria 3703
269 Ga0495637_0008800 3300046520 Bacteria 4943
270 Ga0495643_0000134 3300046522 Bacteria 119143
271 Ga0495643_0014424 3300046522 Bacteria 4702
272 Ga0495643_0043844 3300046522 Bacteria 2432
273 Ga0495643_0171051 3300046522 Bacteria 1062
274 Ga0495648_0008312 3300046524 Bacteria 8181
275 Ga0495648_0037888 3300046524 Bacteria 3093
276 Ga0495666_0000123 3300046526 Bacteria 32371
277 Ga0495666_0002587 3300046526 Bacteria 9000
278 Ga0495666_0008988 3300046526 Bacteria 4998
279 Ga0495666_0017530 3300046526 Bacteria 3566
280 Ga0495666_0028166 3300046526 Bacteria 2765
281 Ga0495666_0045002 3300046526 Bacteria 2129
282 Ga0495642_0000570 3300046528 Bacteria 18511
283 Ga0495642_0013077 3300046528 Bacteria 3206
284 Ga0495652_0035686 3300046529 Bacteria 4326
285 Ga0495652_0036902 3300046529 Bacteria 4244
286 Ga0495652_0053638 3300046529 Bacteria 3436
287 Ga0495665_0003925 3300046531 Bacteria 8046
288 Ga0495665_0020749 3300046531 Bacteria 3529
289 Ga0495665_0023919 3300046531 Bacteria 3282
290 Ga0495640_0007527 3300046533 Bacteria 8557
291 Ga0495586_0001013 3300046535 Bacteria 15854
292 Ga0495586_0010219 3300046535 Bacteria 4990
293 Ga0495586_0163630 3300046535 Bacteria 1255
294 Ga0495587_0000637 3300046536 Bacteria 23606
295 Ga0495609_0003166 3300046538 Bacteria 9585
296 Ga0495609_0003921 3300046538 Bacteria 8342
297 Ga0495621_0004569 3300046539 Bacteria 3907
298 Ga0495645_0001107 3300046543 Bacteria 18247
299 Ga0495645_0057240 3300046543 Bacteria 2830
300 Ga0495622_0053633 3300046557 Bacteria 1871
301 Ga0495633_0000749 3300046558 Bacteria 29299
302 Ga0495656_0000649 3300046615 Bacteria 11136
303 Ga0495668_0000008 3300046616 Bacteria 498364
304 Ga0495668_0175211 3300046616 Bacteria 1175
305 Ga0495634_0001364 3300046642 Bacteria 22159
306 Ga0495634_0093985 3300046642 Bacteria 1944
307 Ga0495611_0008501 3300046648 Bacteria 4340
308 Ga0495625_0006690 3300046660 Bacteria 10225
309 Ga0495635_0003978 3300046663 Bacteria 10275
310 Ga0495659_0007018 3300046664 Bacteria 3566
311 Ga0495661_0000362 3300046665 Bacteria 49179
312 Ga0495661_0002939 3300046665 Bacteria 12873
313 Ga0495661_0002952 3300046665 Bacteria 12848
314 Ga0495661_0010257 3300046665 Bacteria 6400
315 Ga0495661_0015627 3300046665 Bacteria 5063
316 Ga0495661_0034052 3300046665 Bacteria 3208
317 Ga0495661_0040660 3300046665 Bacteria 2881
318 Ga0495588_0000055 3300046674 Bacteria 280059
319 Ga0495588_0000581 3300046674 Bacteria 17433
320 Ga0495588_0025854 3300046674 Bacteria 2928
321 Ga0495599_0003997 3300046678 Bacteria 8684
322 Ga0495599_0026164 3300046678 Bacteria 3656
323 Ga0495646_0002417 3300046680 Bacteria 11462
324 Ga0495646_0067643 3300046680 Bacteria 2111
325 Ga0495669_0008875 3300046684 Bacteria 4234
326 Ga0495613_0008731 3300046689 Bacteria 7514
327 Ga0495624_0000446 3300046690 Bacteria 32513
328 Ga0495624_0001300 3300046690 Bacteria 19638
329 Ga0495624_0043047 3300046690 Bacteria 2881
330 Ga0495670_0008661 3300046691 Bacteria 5006
331 Ga0495670_0019367 3300046691 Bacteria 3353
332 Ga0495670_0129104 3300046691 Bacteria 1317
333 Ga0495589_0000046 3300046794 Bacteria 122544
334 Ga0495600_0018275 3300046809 Bacteria 4465
335 Ga0495660_0000040 3300046810 Bacteria 172614
336 Ga0495660_0015575 3300046810 Bacteria 4392
337 Ga0495660_0019059 3300046810 Bacteria 3940
338 Ga0495581_0008161 3300047315 Bacteria 6062
339 Ga0495604_0004478 3300047317 Bacteria 11065
340 Ga0495604_0020469 3300047317 Bacteria 5284
341 Ga0495604_0072833 3300047317 Bacteria 2595
342 Ga0495604_0078655 3300047317 Bacteria 2474
343 Ga0495674_0033201 3300047319 Bacteria 4677
344 Ga0495672_0000031 3300047320 Bacteria 298258
345 Ga0495672_0005919 3300047320 Bacteria 9584
346 Ga0495676_0018266 3300047321 Bacteria 6183
347 Ga0495680_0010452 3300047322 Bacteria 8282
348 Ga0495680_0018839 3300047322 Bacteria 5849
349 Ga0495680_0070329 3300047322 Bacteria 2669
350 Ga0495680_0238038 3300047322 Bacteria 1294
351 Ga0495683_0006234 3300047323 Bacteria 6525
352 Ga0495687_000012 3300047443 Bacteria 391586
353 Ga0495687_000100 3300047443 Bacteria 130324
354 Ga0495687_001567 3300047443 Bacteria 20762
355 Ga0495687_055541 3300047443 Bacteria 1655
356 Ga0495687_108481 3300047443 Bacteria 1025
357 Ga0495675_0025285 3300047444 Bacteria 3786
358 Ga0495677_0001643 3300047445 Bacteria 8982
359 Ga0495679_000445 3300047446 Bacteria 30497
360 Ga0495679_002909 3300047446 Bacteria 8478
361 Ga0495681_0060795 3300047470 Bacteria 1742
362 Ga0495684_0032552 3300047471 Bacteria 4003
363 Ga0495684_0316265 3300047471 Bacteria 1117
364 Ga0495686_0087490 3300047472 Bacteria 1895
365 Ga0495686_0106040 3300047472 Bacteria 1690
366 Ga0495686_0165572 3300047472 Bacteria 1289
367 Ga0495593_0004796 3300047673 Bacteria 8023
368 Ga0495602_0008957 3300048088 Bacteria 10429
369 Ga0495602_0051337 3300048088 Bacteria 3673
370 Ga0495614_0002203 3300048089 Bacteria 8632
371 Ga0495626_0000799 3300048091 Bacteria 28497
372 Ga0495626_0001312 3300048091 Bacteria 20235
373 Ga0495626_0007963 3300048091 Bacteria 5859
374 Ga0495626_0064525 3300048091 Bacteria 1659
375 Ga0496100_0001154 3300048903 Bacteria 12846
376 Ga0496100_0132941 3300048903 Bacteria 1754
377 Ga0496100_0151199 3300048903 Bacteria 1656
378 Ga0496101_0000147 3300048904 Bacteria 60811
379 Ga0496101_0005792 3300048904 Bacteria 7900
380 Ga0496101_0228747 3300048904 Bacteria 1445
381 Ga0496102_0000057 3300048905 Bacteria 171634
382 Ga0496102_0022548 3300048905 Bacteria 5579
383 Ga0496102_0099135 3300048905 Bacteria 2704
384 Ga0496103_0000142 3300048906 Bacteria 75004
385 Ga0496104_0187455 3300048907 Bacteria 1979
386 Ga0496105_0079642 3300048908 Bacteria 2705
387 Ga0496106_0203947 3300048909 Bacteria 1574
388 Ga0496107_0061700 3300048910 Bacteria 2715
389 Ga0496108_0210997 3300048911 Bacteria 1686
390 Ga0496109_0010598 3300048912 Bacteria 7884
391 Ga0496109_0107653 3300048912 Bacteria 2590
392 Ga0496109_0446543 3300048912 Bacteria 1222
393 Ga0496110_0536160 3300048913 Bacteria 1064
394 Ga0496110_0570955 3300048913 Bacteria 1027
395 Ga0496112_0012830 3300048915 Bacteria 7711
396 Ga0496113_0349629 3300048916 Bacteria 1186
397 Ga0496115_0118478 3300048918 Bacteria 2177
398 Ga0496116_0000540 3300048919 Bacteria 50890
399 Ga0496116_0037788 3300048919 Bacteria 3362
400 Ga0496117_0000118 3300048920 Bacteria 173803
401 Ga0496117_0001006 3300048920 Bacteria 43135
402 Ga0496118_0000068 3300048921 Bacteria 204242
403 Ga0496118_0002190 3300048921 Bacteria 27152
404 Ga0496119_0001133 3300048922 Bacteria 33548
405 Ga0496119_0076956 3300048922 Bacteria 1934
406 Ga0496120_0000773 3300048923 Bacteria 46227
407 Ga0496121_0000956 3300048924 Bacteria 52211
408 Ga0496121_0002363 3300048924 Bacteria 29039
409 Ga0496121_0170875 3300048924 Bacteria 1579
410 Ga0496122_0000971 3300048925 Bacteria 51480
411 Ga0496122_0004155 3300048925 Bacteria 18276
412 Ga0496122_0046883 3300048925 Bacteria 3342
413 Ga0496123_0000786 3300048926 Bacteria 51250
414 Ga0496123_0053203 3300048926 Bacteria 2678
415 Ga0496124_0000111 3300048927 Bacteria 166285
416 Ga0496124_0131910 3300048927 Bacteria 1984
417 Ga0496125_0019894 3300048928 Bacteria 6314
418 Ga0496125_0087420 3300048928 Bacteria 2354
419 Ga0496126_0002556 3300048929 Bacteria 24359
420 Ga0496126_0003720 3300048929 Bacteria 19021
421 Ga0495678_018116 3300049459 Bacteria 3174
422 Ga0495682_0007421 3300049460 Bacteria 4362
423 Ga0495682_0050493 3300049460 Bacteria 1513
424 Ga0501037_0034456 3300049573 Bacteria 3736
425 Ga0501279_015085 3300049775 Bacteria 1068
426 nmdc:mga00v17_333_c1 3300050491 Bacteria 26573
427 nmdc:mga0k408_17067_c1 3300050493 Bacteria 4037
428 nmdc:mga0n895_606194_c1 3300050512 Bacteria 1097
429 Ga0500594_0009292 3300053118 Bacteria 2260
430 2510247306 2510065045 Bacteria 7761063
431 2512351114 2512047030 Bacteria 9031815
432 2513891111 2513237141 Bacteria 8496279
433 2515685382 2515154122 Bacteria 8609520
434 2597028429 2596583598 Bacteria 5251611
435 2599444432 2599185178 Bacteria 5365746
436 2643802515 2643221556 Bacteria 7251154
437 2644252069 2643221645 Bacteria 7207331
438 2644475938 2643221684 Bacteria 7145183
439 2691513717 2690315906 Bacteria 4517044
440 2719638516 2718217991 Bacteria 7829542
441 2738843517 2738541300 Bacteria 6675882
442 2739275409 2738543018 Bacteria 6718814
443 2739344453 2738543030 Bacteria 6719714
444 2746085187 2744054900 Bacteria 8399525
445 2746096561 2744054901 Bacteria 8397047
446 2772439635 2772190666 Bacteria 5117644
447 2792833898 2791355137 Bacteria 9654227
448 2808898775 2808606371 Bacteria 4251511
449 2858689721 2858688981 Bacteria 8184122
450 2885268636 2885266251 Bacteria 4796748
451 2885274720 2885270888 Bacteria 9831543
452 2888377613 2888373701 Bacteria 5098052
453 2902689372 2902682994 Bacteria 8951596
454 2903731789 2903727486 Bacteria 8281579
455 2904622550 2904615490 Bacteria 10047340
456 2919395201 2919391150 Bacteria 4884741
457 2920881574 2920879853 Bacteria 4216831
458 2928063087 2928058823 Bacteria 5520022
459 2939599314 2939598168 Bacteria 4687164
460 2941535798 2941531003 Bacteria 7653939
461 2945956878 2945956166 Bacteria 5110334
462 2945958918 2945956166 Bacteria 5110334
463 642597070 642555112 Bacteria 8676562
464 Ga0495645_0155467
465 JGI24741J21665_1000284
466 JGI24740J21852_10000914
467 JGI25156J39149_1011898
468 JGI25154J39366_1000375
469 JGI25151J46595_10000065
470 rootL2_10011935
471 rootH1_10084316
472 JGI25160J50197_1000036
473 Ga0055538_1001132
474 Ga0055538_1003336
475 Ga0055539_1000071
476 Ga0055533_1006653
477 Ga0055532_1000019
478 Ga0055525_1000371
479 Ga0055527_1001224
480 Ga0055535_1000014
481 Ga0055542_1000739
482 Ga0055529_1000096
483 Ga0055526_1000344
484 Ga0055526_1020490
485 Ga0055537_1000066
486 Ga0055537_1001530
487 Ga0055524_1000422
488 Ga0055524_1016123
489 Ga0055534_1000057
490 Ga0055534_1000135
491 Ga0055528_1000069
492 Ga0055541_1008226
493 Ga0055541_1010059
494 Ga0065165_1000533
495 Ga0070683_100098827
496 Ga0068869_100506474
497 Ga0068868_100433052
498 Ga0070661_100001350
499 Ga0070673_100501613
500 Ga0070711_100003718
501 Ga0070663_100000036
502 Ga0068867_100058186
503 Ga0068853_100132669
504 Ga0070672_100306209
505 Ga0070665_100676577
506 Ga0070664_100000096
507 Ga0068854_100000076
508 Ga0068856_100000203
509 Ga0068870_10188543
510 Ga0075366_10005964
511 Ga0075430_100358071
512 Ga0075434_100604111
513 Ga0075434_100629851
514 Ga0105240_10002809
515 Ga0105240_10036242
516 Ga0105240_10380718
517 Ga0111539_10723057
518 Ga0105245_10393821
519 Ga0105245_10493626
520 Ga0105247_10315060
521 Ga0105248_10009097
522 Ga0105248_10834187
523 Ga0105237_10002917
524 Ga0105238_10039182
525 Ga0105147_102850
526 Ga0105239_10001353
527 Ga0105246_10079930
528 Ga0157373_10042483
529 Ga0157371_10000501
530 Ga0157370_10000363
531 Ga0157370_10237608
532 Ga0157369_10006498
533 Ga0163162_10115827
534 Ga0163162_10196761
535 Ga0157375_10595368
536 Ga0182008_10006607
537 Ga0157377_10293663
538 Ga0182006_1034234
539 Ga0182007_10012217
540 Ga0183361_10021
541 Ga0197907_11189099
542 Ga0206356_10834160
543 Ga0206355_1620200
544 Ga0206351_10400843
545 Ga0206354_10180779
546 Ga0206353_11231673
547 Ga0154015_1250880
548 Ga0213872_10167220
549 Ga0213872_10193416
550 Ga0209784_100003
551 Ga0209784_100644
552 Ga0209784_102084
553 Ga0209566_100002
554 Ga0209566_100822
555 Ga0209674_100008
556 Ga0209674_100118
557 Ga0209674_104406
558 Ga0209672_100379
559 Ga0209147_100002
560 Ga0209563_100004
561 Ga0209563_100007
562 Ga0209563_112044
563 Ga0209258_100002
564 Ga0209646_1000203
565 Ga0209677_100009
566 Ga0209677_105523
567 Ga0209677_109448
568 Ga0209148_1000021
569 Ga0209148_1000386
570 Ga0209148_1004628
571 Ga0209759_1002446
572 Ga0209565_1000006
573 Ga0209565_1000109
574 Ga0209455_1000076
575 Ga0209673_1000004
576 Ga0209673_1027751
577 Ga0209130_1006039
578 Ga0209675_1000006
579 Ga0209675_1000118
580 Ga0209025_1000159
581 Ga0209564_1000102
582 Ga0209564_1002619
583 Ga0209564_1005614
584 Ga0209758_1013848
585 Ga0209256_1000037
586 Ga0209256_1005672
587 Ga0207426_1000014
588 Ga0209051_1030921
589 Ga0207688_10080444
590 Ga0207695_10000558
591 Ga0207695_10014353
592 Ga0207695_10279159
593 Ga0207671_10001552
594 Ga0207649_10001028
595 Ga0207649_10356298
596 Ga0207694_10023185
597 Ga0207687_10115073
598 Ga0207690_10012131
599 Ga0207704_10102051
600 Ga0207691_10044040
601 Ga0207711_10033030
602 Ga0207661_10253347
603 Ga0207679_10000122
604 Ga0207640_10000017
605 Ga0207703_10172686
606 Ga0207639_10105142
607 Ga0207678_10000129
608 Ga0207708_10327244
609 Ga0207702_10000024
610 Ga0207648_10126807
611 Ga0207674_10091743
612 Ga0207674_10440198
613 Ga0207683_10042692
614 Ga0207698_10864230
615 Ga0265332_10010325
616 Ga0307513_10000684
617 Ga0307408_100027775
618 Ga0307408_100064357
619 Ga0307408_100082003
620 Ga0307405_10004257
621 Ga0307405_10197386
622 Ga0307405_10442927
623 Ga0307410_10033297
624 Ga0307410_10065104
625 Ga0307410_10098368
626 Ga0307406_10009976
627 Ga0307406_10049679
628 Ga0307407_10145364
629 Ga0307412_10086025
630 Ga0307409_100025621
631 Ga0307409_100204766
632 Ga0307409_100287134
633 Ga0307416_100237917
634 Ga0307415_100076250
635 Ga0307415_100105974
636 Ga0395899_0000970
637 Ga0395899_0002475
638 Ga0395899_0243631
639 Ga0395900_0000602
640 Ga0395900_0000914
641 Ga0395900_0024556
642 Ga0395900_0034290
643 Ga0395900_0054170
644 Ga0395900_0069298
645 Ga0395898_0006888
646 Ga0395898_0117339
647 Ga0395898_0130218
648 Ga0395898_0192090
649 Ga0395905_0000009
650 Ga0395905_0004377
651 Ga0395905_0011187
652 Ga0395905_0019980
653 Ga0395905_0075915
654 Ga0395905_0423957
655 Ga0395901_0000246
656 Ga0395901_0025152
657 Ga0395901_0117947
658 Ga0395901_0222947
659 Ga0395901_0284938
660 Ga0395901_0508276
661 Ga0436361_0171477
662 Ga0436361_0233403
663 Ga0436361_0612111
664 Ga0451789_1172055
665 Ga0439433_0017721
666 Ga0439449_0032357
667 Ga0450904_000505
668 Ga0439434_0023529
669 Ga0466972_0016260
670 Ga0466978_0033871
671 Ga0466982_0142136
672 Ga0466965_0009212
673 Ga0466965_0029490
674 Ga0466965_0064428
675 Ga0466966_0011140
676 Ga0466961_0000059
677 Ga0466964_0006591
678 Ga0466957_0001017
679 Ga0466957_0251366
680 Ga0466960_0018030
681 Ga0466960_0143624
682 Ga0466959_0000594
683 Ga0466967_0027413
684 Ga0495617_001694
685 Ga0495592_0002627
686 Ga0495603_0000940
687 Ga0495590_0067847
688 Ga0495629_0004842
689 Ga0495629_0015962
690 Ga0495638_0025386
691 Ga0495638_0068118
692 Ga0495641_0008515
693 Ga0495651_0048644
694 Ga0495651_0108266
695 Ga0495653_0015578
696 Ga0495653_0108389
697 Ga0495653_0163913
698 Ga0495650_0000279
699 Ga0495580_0000801
700 Ga0495580_0010592
701 Ga0495580_0571670
702 Ga0495582_0004114
703 Ga0495582_0056502
704 Ga0495582_0069861
705 Ga0495605_0000252
706 Ga0495605_0071373
707 Ga0495639_0002549
708 Ga0495639_0093991
709 Ga0495662_0004048
710 Ga0495664_0002721
711 Ga0495584_0028033
712 Ga0495585_0047192
713 Ga0495594_0001009
714 Ga0495594_0062428
715 Ga0495596_0007364
716 Ga0495607_0011213
717 Ga0495607_0101269
718 Ga0495583_0042654
719 Ga0495606_0012877
720 Ga0495606_0088385
721 Ga0495610_0163925
722 Ga0495616_0007222
723 Ga0495616_0010304
724 Ga0495618_0011461
725 Ga0495628_0006259
726 Ga0495628_0006743
727 Ga0495628_0012450
728 Ga0495630_0025892
729 Ga0495630_0027030
730 Ga0495631_0015152
731 Ga0495637_0008800
732 Ga0495643_0000134
733 Ga0495643_0014424
734 Ga0495643_0043844
735 Ga0495643_0171051
736 Ga0495648_0008312
737 Ga0495648_0037888
738 Ga0495666_0000123
739 Ga0495666_0002587
740 Ga0495666_0008988
741 Ga0495666_0017530
742 Ga0495666_0028166
743 Ga0495666_0045002
744 Ga0495642_0000570
745 Ga0495642_0013077
746 Ga0495652_0035686
747 Ga0495652_0036902
748 Ga0495652_0053638
749 Ga0495665_0003925
750 Ga0495665_0020749
751 Ga0495665_0023919
752 Ga0495640_0007527
753 Ga0495586_0001013
754 Ga0495586_0010219
755 Ga0495586_0163630
756 Ga0495587_0000637
757 Ga0495609_0003166
758 Ga0495609_0003921
759 Ga0495621_0004569
760 Ga0495645_0001107
761 Ga0495645_0057240
762 Ga0495622_0053633
763 Ga0495633_0000749
764 Ga0495656_0000649
765 Ga0495668_0000008
766 Ga0495668_0175211
767 Ga0495634_0001364
768 Ga0495634_0093985
769 Ga0495611_0008501
770 Ga0495625_0006690
771 Ga0495635_0003978
772 Ga0495659_0007018
773 Ga0495661_0000362
774 Ga0495661_0002939
775 Ga0495661_0002952
776 Ga0495661_0010257
777 Ga0495661_0015627
778 Ga0495661_0034052
779 Ga0495661_0040660
780 Ga0495588_0000055
781 Ga0495588_0000581
782 Ga0495588_0025854
783 Ga0495599_0003997
784 Ga0495599_0026164
785 Ga0495646_0002417
786 Ga0495646_0067643
787 Ga0495669_0008875
788 Ga0495613_0008731
789 Ga0495624_0000446
790 Ga0495624_0001300
791 Ga0495624_0043047
792 Ga0495670_0008661
793 Ga0495670_0019367
794 Ga0495670_0129104
795 Ga0495589_0000046
796 Ga0495600_0018275
797 Ga0495660_0000040
798 Ga0495660_0015575
799 Ga0495660_0019059
800 Ga0495581_0008161
801 Ga0495604_0004478
802 Ga0495604_0020469
803 Ga0495604_0072833
804 Ga0495604_0078655
805 Ga0495674_0033201
806 Ga0495672_0000031
807 Ga0495672_0005919
808 Ga0495676_0018266
809 Ga0495680_0010452
810 Ga0495680_0018839
811 Ga0495680_0070329
812 Ga0495680_0238038
813 Ga0495683_0006234
814 Ga0495687_000012
815 Ga0495687_000100
816 Ga0495687_001567
817 Ga0495687_055541
818 Ga0495687_108481
819 Ga0495675_0025285
820 Ga0495677_0001643
821 Ga0495679_000445
822 Ga0495679_002909
823 Ga0495681_0060795
824 Ga0495684_0032552
825 Ga0495684_0316265
826 Ga0495686_0087490
827 Ga0495686_0106040
828 Ga0495686_0165572
829 Ga0495593_0004796
830 Ga0495602_0008957
831 Ga0495602_0051337
832 Ga0495614_0002203
833 Ga0495626_0000799
834 Ga0495626_0001312
835 Ga0495626_0007963
836 Ga0495626_0064525
837 Ga0496100_0001154
838 Ga0496100_0132941
839 Ga0496100_0151199
840 Ga0496101_0000147
841 Ga0496101_0005792
842 Ga0496101_0228747
843 Ga0496102_0000057
844 Ga0496102_0022548
845 Ga0496102_0099135
846 Ga0496103_0000142
847 Ga0496104_0187455
848 Ga0496105_0079642
849 Ga0496106_0203947
850 Ga0496107_0061700
851 Ga0496108_0210997
852 Ga0496109_0010598
853 Ga0496109_0107653
854 Ga0496109_0446543
855 Ga0496110_0536160
856 Ga0496110_0570955
857 Ga0496112_0012830
858 Ga0496113_0349629
859 Ga0496115_0118478
860 Ga0496116_0000540
861 Ga0496116_0037788
862 Ga0496117_0000118
863 Ga0496117_0001006
864 Ga0496118_0000068
865 Ga0496118_0002190
866 Ga0496119_0001133
867 Ga0496119_0076956
868 Ga0496120_0000773
869 Ga0496121_0000956
870 Ga0496121_0002363
871 Ga0496121_0170875
872 Ga0496122_0000971
873 Ga0496122_0004155
874 Ga0496122_0046883
875 Ga0496123_0000786
876 Ga0496123_0053203
877 Ga0496124_0000111
878 Ga0496124_0131910
879 Ga0496125_0019894
880 Ga0496125_0087420
881 Ga0496126_0002556
882 Ga0496126_0003720
883 Ga0495678_018116
884 Ga0495682_0007421
885 Ga0495682_0050493
886 Ga0501037_0034456
887 Ga0501279_015085
888 nmdc:mga00v17_333_c1
889 nmdc:mga0k408_17067_c1
890 nmdc:mga0n895_606194_c1
891 Ga0500594_0009292
892 2510247306
893 2512351114
894 2513891111
895 2515685382
896 2597028429
897 2599444432
898 2643802515
899 2644252069
900 2644475938
901 2691513717
902 2719638516
903 2738843517
904 2739275409
905 2739344453
906 2746085187
907 2746096561
908 2772439635
909 2792833898
910 2808898775
911 2858689721
912 2885268636
913 2885274720
914 2888377613
915 2902689372
916 2903731789
917 2904622550
918 2919395201
919 2920881574
920 2928063087
921 2939599314
922 2941535798
923 2945956878
924 2945958918
925 642597070

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

30

222

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

36

281

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9307 9 166
3rkr-assembly1.cif.gz_A-2 crystal structure of a metagenomic short-chain oxidoreductase (sdr) in complex with nadp 0.9263 4 165
6k8s-assembly1.cif.gz_B crystal structure of c-domain of baterial malonyl-coa reductase 0.8806 2 176
8aet-assembly1.cif.gz_A-2 malonyl-coa reductase from chloroflexus aurantiacus - c-terminal e779w variant 0.8782 2 169
8a30-assembly1.cif.gz_A malonyl-coa reductase from chloroflexus aurantiacus - c-terminal apo 0.8781 2 169
ID Description Score Start End Superfamily
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9425 6 166 3.40.50.720
af_Q54N15_5_159_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9373 63 159 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9329 7 170 3.40.50.720
3tfoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9307 9 166 3.40.50.720
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9303 8 54 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A350CUC5-F1-model_v4 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase 0.9861 63 240 GO:0016616
GO:0030497
AF-X1H6B1-F1-model_v4 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase 0.9812 61 218 GO:0016616
GO:0030497
AF-A0A0Q6LCQ6-F1-model_v4 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase (EC 1.3.1.25) 0.9807 12 240 GO:0016616
GO:0030497
GO:0047116
AF-A0A485BG68-F1-model_v4 Levodione reductase (EC 1.1.1.-) 0.9803 12 240 GO:0016616
GO:0030497
AF-A0A3P4AXU9-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase FabG (EC 1.1.1.100) 0.9789 4 240 GO:0004316
GO:0030497

Map