F448943

General Info

Members Datasets Scaffolds Average Seq Length
462 254 924 111

Family's Representative Sequence

Representative Sequence 3300031903|Ga0307407_10064193|Ga0307407_100641933
Length 135
Sequence MLSPRPVLSDAFPLNRPPPRLEAPVIFITAKFQVLPEHADSWPEITREFTAATRGEAGCLWFDWSRSLDDPNEYVLVEAFRDDAAGAAHVQSDHFRKAQRDLPPHLAETPRIVNFTVPQDDWSELGELAVPDRGR

Samples

Sample ID Description Type Environment
1 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
89 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
90 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
91 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
92 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
93 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
94 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
95 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
96 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
97 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
98 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
99 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
102 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
103 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
104 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
105 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
106 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
107 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
112 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
113 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
114 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
125 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
126 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
127 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
128 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
129 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
130 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
131 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
132 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
133 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
134 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
163 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
244 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
245 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
248 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
249 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
253 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
254 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 3.03
Rhizosphere 95.45
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307407_10064193 3300031903 Bacteria 2157
2 rootL2_10060310 3300003322 Bacteria 5997
3 JGI25407J50210_10003434 3300003373 Bacteria 3789
4 Ga0070683_100999312 3300005329 Bacteria 803
5 Ga0070682_100217890 3300005337 Bacteria 1357
6 Ga0068868_100252800 3300005338 Bacteria 1484
7 Ga0070661_100529775 3300005344 Bacteria 946
8 Ga0070659_101684948 3300005366 Bacteria 567
9 Ga0070709_10044660 3300005434 Bacteria 2745
10 Ga0070713_100104880 3300005436 Bacteria 2455
11 Ga0070713_100409408 3300005436 Bacteria 1268
12 Ga0070710_10044414 3300005437 Bacteria 2465
13 Ga0070711_100023113 3300005439 Bacteria 4039
14 Ga0070711_100208250 3300005439 Bacteria 1513
15 Ga0070694_100916964 3300005444 Bacteria 724
16 Ga0070678_100624536 3300005456 Bacteria 964
17 Ga0070706_100354687 3300005467 Bacteria 1367
18 Ga0070707_100104621 3300005468 Bacteria 2744
19 Ga0070707_100391876 3300005468 Bacteria 1349
20 Ga0070698_100005536 3300005471 Bacteria 13800
21 Ga0070698_100013957 3300005471 Bacteria 8495
22 Ga0070698_100115726 3300005471 Bacteria 2645
23 Ga0070699_100032185 3300005518 Bacteria 4528
24 Ga0070684_100916538 3300005535 Bacteria 821
25 Ga0070695_100412358 3300005545 Bacteria 1027
26 Ga0070696_100195930 3300005546 Bacteria 1506
27 Ga0070693_100196943 3300005547 Bacteria 1306
28 Ga0070665_101126766 3300005548 Bacteria 796
29 Ga0070704_100595680 3300005549 Bacteria 971
30 Ga0068852_101519338 3300005616 Bacteria 692
31 Ga0068859_101970966 3300005617 Bacteria 645
32 Ga0068863_100237830 3300005841 Bacteria 1758
33 Ga0081455_10008771 3300005937 Bacteria 10467
34 Ga0081455_10023948 3300005937 Bacteria 5667
35 Ga0081538_10007670 3300005981 Bacteria 9303
36 Ga0081538_10008551 3300005981 Bacteria 8667
37 Ga0081540_1103470 3300005983 Bacteria 1221
38 Ga0081540_1173944 3300005983 Bacteria 815
39 Ga0081539_10000137 3300005985 Bacteria 171821
40 Ga0081539_10004150 3300005985 Bacteria 16459
41 Ga0081539_10359949 3300005985 Bacteria 610
42 Ga0070717_10095967 3300006028 Bacteria 2510
43 Ga0070717_10940278 3300006028 Bacteria 787
44 Ga0070715_10040880 3300006163 Bacteria 1941
45 Ga0070716_100031178 3300006173 Bacteria 2897
46 Ga0097621_100134182 3300006237 Bacteria 2110
47 Ga0068871_100322948 3300006358 Bacteria 1360
48 Ga0075428_100011051 3300006844 Bacteria 10043
49 Ga0075428_100135384 3300006844 Bacteria 2679
50 Ga0075430_100005320 3300006846 Bacteria 10860
51 Ga0075430_100320580 3300006846 Bacteria 1281
52 Ga0075431_100002427 3300006847 Bacteria 17942
53 Ga0075431_100502235 3300006847 Bacteria 1204
54 Ga0075429_100004395 3300006880 Bacteria 12109
55 Ga0075429_101303565 3300006880 Bacteria 633
56 Ga0075436_101217016 3300006914 Bacteria 569
57 Ga0097620_101969953 3300006931 Bacteria 645
58 Ga0111539_10643299 3300009094 Bacteria 1235
59 Ga0105245_10403361 3300009098 Bacteria 1367
60 Ga0114129_10005389 3300009147 Bacteria 18059
61 Ga0114129_10057379 3300009147 Bacteria 5448
62 Ga0114129_11162104 3300009147 Bacteria 963
63 Ga0105243_10678091 3300009148 Bacteria 1002
64 Ga0157370_11194019 3300013104 Bacteria 686
65 Ga0157370_11757266 3300013104 Bacteria 557
66 Ga0157369_12415803 3300013105 Bacteria 532
67 Ga0157372_10188682 3300013307 Bacteria 2387
68 Ga0157372_10968939 3300013307 Bacteria 986
69 Ga0157375_12879145 3300013308 Bacteria 575
70 Ga0157377_10395113 3300014745 Bacteria 940
71 Ga0157376_10370709 3300014969 Bacteria 1376
72 Ga0197907_10676975 3300020069 Bacteria 1432
73 Ga0224712_10013374 3300022467 Bacteria 2611
74 Ga0207692_10046789 3300025898 Bacteria 2170
75 Ga0207692_10147937 3300025898 Bacteria 1342
76 Ga0207680_10848939 3300025903 Bacteria 655
77 Ga0207685_10105284 3300025905 Bacteria 1214
78 Ga0207699_10013720 3300025906 Bacteria 4156
79 Ga0207699_10027315 3300025906 Bacteria 3158
80 Ga0207699_10595922 3300025906 Bacteria 804
81 Ga0207684_10441588 3300025910 Bacteria 1117
82 Ga0207684_10622836 3300025910 Bacteria 920
83 Ga0207693_10087146 3300025915 Bacteria 2446
84 Ga0207693_10305155 3300025915 Bacteria 1247
85 Ga0207663_10124783 3300025916 Bacteria 1769
86 Ga0207663_10603855 3300025916 Bacteria 862
87 Ga0207662_10621568 3300025918 Bacteria 753
88 Ga0207649_10962683 3300025920 Bacteria 671
89 Ga0207646_10018523 3300025922 Bacteria 6492
90 Ga0207646_10086499 3300025922 Bacteria 2805
91 Ga0207646_10088961 3300025922 Bacteria 2764
92 Ga0207700_10068671 3300025928 Bacteria 2717
93 Ga0207700_10074592 3300025928 Bacteria 2625
94 Ga0207700_10101326 3300025928 Bacteria 2297
95 Ga0207700_10138894 3300025928 Bacteria 1994
96 Ga0207700_10304382 3300025928 Bacteria 1377
97 Ga0207700_11283975 3300025928 Bacteria 652
98 Ga0207664_10054323 3300025929 Bacteria 3173
99 Ga0207664_10081304 3300025929 Bacteria 2636
100 Ga0207664_10100284 3300025929 Bacteria 2391
101 Ga0207664_10398772 3300025929 Bacteria 1223
102 Ga0207644_10163997 3300025931 Bacteria 1730
103 Ga0207690_11088151 3300025932 Bacteria 666
104 Ga0207709_10507328 3300025935 Bacteria 942
105 Ga0207665_10013277 3300025939 Bacteria 5415
106 Ga0207665_10046641 3300025939 Bacteria 2903
107 Ga0207677_11231108 3300026023 Bacteria 686
108 Ga0207678_10126683 3300026067 Bacteria 2178
109 Ga0207702_10731550 3300026078 Bacteria 976
110 Ga0207683_10590986 3300026121 Bacteria 1027
111 Ga0207698_11901926 3300026142 Bacteria 610
112 Ga0268266_11089041 3300028379 Bacteria 773
113 Ga0307511_10359326 3300030521 Bacteria 621
114 Ga0307405_10135800 3300031731 Bacteria 1707
115 Ga0307405_10741938 3300031731 Bacteria 817
116 Ga0307405_11719255 3300031731 Bacteria 556
117 Ga0307413_10093721 3300031824 Bacteria 1964
118 Ga0307413_10436528 3300031824 Bacteria 1035
119 Ga0307413_11011538 3300031824 Bacteria 713
120 Ga0307413_11560305 3300031824 Bacteria 585
121 Ga0307413_12197753 3300031824 Bacteria 500
122 Ga0307410_10020295 3300031852 Bacteria 4061
123 Ga0307410_10383543 3300031852 Bacteria 1131
124 Ga0307410_10457601 3300031852 Bacteria 1042
125 Ga0307406_10163007 3300031901 Bacteria 1605
126 Ga0307406_10181356 3300031901 Bacteria 1533
127 Ga0307406_10483882 3300031901 Bacteria 1000
128 Ga0307406_10492339 3300031901 Bacteria 992
129 Ga0307407_11619586 3300031903 Bacteria 514
130 Ga0307412_10257718 3300031911 Bacteria 1358
131 Ga0307412_10554112 3300031911 Bacteria 966
132 Ga0307412_10890769 3300031911 Bacteria 779
133 Ga0307409_100040369 3300031995 Bacteria 3473
134 Ga0307409_100281030 3300031995 Bacteria 1538
135 Ga0307409_100564552 3300031995 Bacteria 1119
136 Ga0307409_100716257 3300031995 Bacteria 1001
137 Ga0307409_100870029 3300031995 Bacteria 913
138 Ga0307409_101144114 3300031995 Bacteria 800
139 Ga0307416_100037324 3300032002 Bacteria 3737
140 Ga0307416_100047770 3300032002 Bacteria 3390
141 Ga0307416_100551080 3300032002 Bacteria 1226
142 Ga0307416_100931377 3300032002 Bacteria 970
143 Ga0307416_100960942 3300032002 Bacteria 956
144 Ga0307414_10331726 3300032004 Bacteria 1299
145 Ga0307411_10235871 3300032005 Bacteria 1429
146 Ga0307415_100000639 3300032126 Bacteria 15379
147 Ga0307415_100003929 3300032126 Bacteria 7639
148 Ga0307415_100075586 3300032126 Bacteria 2384
149 Ga0307415_100091407 3300032126 Bacteria 2204
150 Ga0307415_100414764 3300032126 Bacteria 1154
151 Ga0307415_100645215 3300032126 Bacteria 948
152 Ga0307415_101160144 3300032126 Bacteria 726
153 Ga0373930_0012369 3300034816 Bacteria 1556
154 Ga0373950_0084848 3300034818 Bacteria 666
155 Ga0373958_0098383 3300034819 Bacteria 683
156 Ga0373926_0002431 3300035083 Bacteria 5901
157 Ga0373926_0117322 3300035083 Bacteria 1002
158 Ga0373928_0006930 3300035084 Bacteria 2183
159 Ga0373929_0012222 3300035085 Bacteria 1629
160 Ga0373934_0013637 3300035086 Bacteria 3076
161 Ga0373940_0041727 3300035088 Bacteria 1262
162 Ga0373949_0292757 3300035090 Bacteria 514
163 Ga0373951_0007194 3300035091 Bacteria 2532
164 Ga0373952_0027069 3300035092 Bacteria 1249
165 Ga0373923_0012370 3300035111 Bacteria 3153
166 Ga0373923_0017056 3300035111 Bacteria 2771
167 Ga0373936_0008625 3300035113 Bacteria 3840
168 Ga0373936_0166185 3300035113 Bacteria 963
169 Ga0373939_0027043 3300035114 Bacteria 1622
170 Ga0373945_0075333 3300035116 Bacteria 1284
171 Ga0373953_0014921 3300035117 Bacteria 2804
172 Ga0373953_0071109 3300035117 Bacteria 1435
173 Ga0373954_0013444 3300035118 Bacteria 3647
174 Ga0373954_0075670 3300035118 Bacteria 1603
175 Ga0373956_0005238 3300035119 Bacteria 5191
176 Ga0373956_0398531 3300035119 Bacteria 656
177 Ga0373957_0011837 3300035120 Bacteria 2923
178 Ga0373957_0043210 3300035120 Bacteria 1702
179 Ga0373960_0025140 3300035121 Bacteria 1616
180 Ga0373943_0119259 3300035170 Bacteria 1400
181 Ga0373946_0083997 3300035171 Bacteria 1399
182 Ga0373946_0145876 3300035171 Bacteria 1100
183 Ga0373946_0467371 3300035171 Bacteria 644
184 Ga0373955_0003650 3300035172 Bacteria 6775
185 Ga0373955_0040381 3300035172 Bacteria 2495
186 Ga0373955_0070251 3300035172 Bacteria 1956
187 Ga0373942_0024087 3300035207 Bacteria 1559
188 Ga0373942_0071021 3300035207 Bacteria 1017
189 Ga0373961_0028445 3300035241 Bacteria 1541
190 Ga0373962_0008769 3300035242 Bacteria 2496
191 Ga0373924_0001226 3300035410 Bacteria 8220
192 Ga0373931_0099739 3300035691 Bacteria 1631
193 Ga0373931_0789257 3300035691 Bacteria 632
194 Ga0373935_0034479 3300035692 Bacteria 3155
195 Ga0373935_0268437 3300035692 Bacteria 1198
196 Ga0373927_0589884 3300035695 Bacteria 734
197 Ga0373933_0004173 3300035724 Bacteria 7959
198 Ga0373947_0000014 3300035725 Bacteria 135749
199 Ga0373947_0261215 3300035725 Bacteria 1147
200 Ga0373947_0747198 3300035725 Bacteria 667
201 Ga0373937_0010502 3300036401 Bacteria 8085
202 Ga0373937_0237540 3300036401 Bacteria 1716
203 Ga0373925_0067504 3300037068 Bacteria 2697
204 Ga0373925_0330086 3300037068 Bacteria 1235
205 Ga0373925_0372675 3300037068 Bacteria 1162
206 Ga0436364_0002345 3300037853 Bacteria 1131
207 Ga0436363_0515487 3300039450 Bacteria 865
208 Ga0439436_0002780 3300041404 Bacteria 5294
209 Ga0439439_0006028 3300041406 Bacteria 2791
210 Ga0439433_0003834 3300041999 Bacteria 3235
211 Ga0439449_0012249 3300042007 Bacteria 3223
212 Ga0439455_0234755 3300042012 Bacteria 535
213 Ga0439457_003810 3300042014 Bacteria 4045
214 Ga0439462_0013113 3300042015 Bacteria 2123
215 Ga0450916_045402 3300042530 Bacteria 679
216 Ga0439440_0022865 3300042993 Bacteria 1420
217 Ga0466972_0118211 3300044658 Bacteria 1251
218 Ga0466965_0083096 3300044683 Bacteria 1621
219 Ga0466965_0220809 3300044683 Bacteria 1010
220 Ga0466966_0191567 3300044684 Bacteria 1239
221 Ga0466966_0582738 3300044684 Bacteria 673
222 Ga0466961_0078125 3300044693 Bacteria 2096
223 Ga0466963_0081958 3300044694 Bacteria 2186
224 Ga0466963_0953539 3300044694 Bacteria 604
225 Ga0466963_1217118 3300044694 Bacteria 529
226 Ga0466964_0033492 3300044706 Bacteria 2047
227 Ga0466971_0010253 3300044719 Bacteria 4093
228 Ga0466971_0134264 3300044719 Bacteria 1150
229 Ga0466970_0011850 3300044765 Bacteria 4447
230 Ga0466970_0112983 3300044765 Bacteria 1484
231 Ga0466970_0197475 3300044765 Bacteria 1119
232 Ga0466970_0234895 3300044765 Bacteria 1025
233 Ga0466957_0013380 3300044842 Bacteria 4760
234 Ga0466957_1176397 3300044842 Bacteria 554
235 Ga0466960_0533723 3300044901 Bacteria 691
236 Ga0466959_0117912 3300045049 Bacteria 1889
237 Ga0466959_0211380 3300045049 Bacteria 1348
238 Ga0466958_0035718 3300045836 Bacteria 2970
239 Ga0466958_0066523 3300045836 Bacteria 2201
240 Ga0466958_0310740 3300045836 Bacteria 1012
241 Ga0466967_0000641 3300045976 Bacteria 17576
242 Ga0466967_0006339 3300045976 Bacteria 8356
243 Ga0466967_0215016 3300045976 Bacteria 1824
244 Ga0466967_0623522 3300045976 Bacteria 1065
245 Ga0466967_2196570 3300045976 Bacteria 548
246 Ga0495592_0041720 3300046454 Bacteria 3438
247 Ga0495592_0146818 3300046454 Bacteria 1634
248 Ga0495603_0046151 3300046455 Bacteria 2597
249 Ga0495629_0002479 3300046459 Bacteria 14154
250 Ga0495629_0140358 3300046459 Bacteria 1681
251 Ga0495641_0004811 3300046461 Bacteria 9388
252 Ga0495641_0017766 3300046461 Bacteria 3694
253 Ga0495651_0009665 3300046462 Bacteria 7416
254 Ga0495651_0018163 3300046462 Bacteria 5444
255 Ga0495651_0365647 3300046462 Bacteria 949
256 Ga0495653_0011082 3300046463 Bacteria 7370
257 Ga0495653_0041764 3300046463 Bacteria 3577
258 Ga0495580_0034049 3300046472 Bacteria 3668
259 Ga0495580_0614641 3300046472 Bacteria 717
260 Ga0495582_0007220 3300046473 Bacteria 6162
261 Ga0495582_0035808 3300046473 Bacteria 2730
262 Ga0495639_0010120 3300046475 Bacteria 4056
263 Ga0495662_0007668 3300046476 Bacteria 5319
264 Ga0495662_0029797 3300046476 Bacteria 2633
265 Ga0495664_0006524 3300046477 Bacteria 6450
266 Ga0495664_0056613 3300046477 Bacteria 2332
267 Ga0495594_0317138 3300046499 Bacteria 888
268 Ga0495608_0038188 3300046511 Bacteria 3226
269 Ga0495608_0206362 3300046511 Bacteria 1236
270 Ga0495618_0016278 3300046514 Bacteria 4547
271 Ga0495618_0034714 3300046514 Bacteria 3164
272 Ga0495618_0038593 3300046514 Bacteria 3002
273 Ga0495628_0034053 3300046516 Bacteria 4101
274 Ga0495628_0067917 3300046516 Bacteria 2782
275 Ga0495630_0003733 3300046517 Bacteria 10620
276 Ga0495630_0071190 3300046517 Bacteria 2616
277 Ga0495631_0474146 3300046518 Bacteria 533
278 Ga0495666_0027964 3300046526 Bacteria 2775
279 Ga0495652_0026368 3300046529 Bacteria 5135
280 Ga0495652_0045539 3300046529 Bacteria 3770
281 Ga0495665_0002626 3300046531 Bacteria 9692
282 Ga0495665_0201870 3300046531 Bacteria 1030
283 Ga0495640_0028266 3300046533 Bacteria 4038
284 Ga0495640_0039624 3300046533 Bacteria 3304
285 Ga0495640_0400702 3300046533 Bacteria 842
286 Ga0495586_0014824 3300046535 Bacteria 4142
287 Ga0495586_0293270 3300046535 Bacteria 931
288 Ga0495587_0014306 3300046536 Bacteria 4980
289 Ga0495587_0023440 3300046536 Bacteria 3792
290 Ga0495645_0094715 3300046543 Bacteria 2129
291 Ga0495645_0239575 3300046543 Bacteria 1211
292 Ga0495645_0329680 3300046543 Bacteria 988
293 Ga0495667_0032864 3300046559 Bacteria 3473
294 Ga0495656_0639581 3300046615 Unclassified 571
295 Ga0495634_0012601 3300046642 Bacteria 6121
296 Ga0495634_0023695 3300046642 Bacteria 4312
297 Ga0495634_0080185 3300046642 Bacteria 2136
298 Ga0495635_0023825 3300046663 Bacteria 4265
299 Ga0495635_0031178 3300046663 Bacteria 3703
300 Ga0495657_0034298 3300046675 Bacteria 3525
301 Ga0495657_0574472 3300046675 Bacteria 653
302 Ga0495599_0023199 3300046678 Bacteria 3877
303 Ga0495599_0026352 3300046678 Bacteria 3642
304 Ga0495599_0275237 3300046678 Bacteria 1020
305 Ga0495623_0011274 3300046679 Bacteria 5782
306 Ga0495623_0109815 3300046679 Bacteria 1673
307 Ga0495646_0007263 3300046680 Bacteria 7038
308 Ga0495646_0043388 3300046680 Bacteria 2754
309 Ga0495647_0049501 3300046681 Bacteria 1628
310 Ga0495647_0176980 3300046681 Bacteria 926
311 Ga0495658_0003103 3300046683 Bacteria 8305
312 Ga0495658_0041846 3300046683 Bacteria 2555
313 Ga0495613_0110822 3300046689 Bacteria 1977
314 Ga0495613_0343586 3300046689 Bacteria 1026
315 Ga0495624_0052548 3300046690 Bacteria 2574
316 Ga0495600_0010078 3300046809 Bacteria 5858
317 Ga0495600_0028588 3300046809 Bacteria 3607
318 Ga0495581_0003056 3300047315 Bacteria 9582
319 Ga0495581_0008812 3300047315 Bacteria 5839
320 Ga0495604_0010113 3300047317 Bacteria 7474
321 Ga0495604_0107157 3300047317 Bacteria 2043
322 Ga0495604_0459054 3300047317 Bacteria 831
323 Ga0495674_0020387 3300047319 Bacteria 6138
324 Ga0495674_0075900 3300047319 Bacteria 2891
325 Ga0495672_0086325 3300047320 Bacteria 1736
326 Ga0495676_0033438 3300047321 Bacteria 4330
327 Ga0495676_0764031 3300047321 Bacteria 623
328 Ga0495676_0841262 3300047321 Bacteria 589
329 Ga0495680_0010102 3300047322 Bacteria 8440
330 Ga0495680_0048420 3300047322 Bacteria 3337
331 Ga0495680_0133513 3300047322 Bacteria 1821
332 Ga0495675_0039220 3300047444 Bacteria 3016
333 Ga0495684_0006104 3300047471 Bacteria 9375
334 Ga0495684_0021922 3300047471 Bacteria 4918
335 Ga0495684_0170947 3300047471 Bacteria 1616
336 Ga0495593_0004694 3300047673 Bacteria 8127
337 Ga0495593_0687849 3300047673 Bacteria 513
338 Ga0495602_0055982 3300048088 Bacteria 3470
339 Ga0495602_0065731 3300048088 Bacteria 3128
340 Ga0495614_0039373 3300048089 Bacteria 2028
341 Ga0495614_0352202 3300048089 Bacteria 686
342 Ga0496102_0201711 3300048905 Bacteria 1875
343 Ga0496103_0023923 3300048906 Bacteria 3685
344 Ga0496103_0033281 3300048906 Bacteria 3149
345 Ga0496104_0217527 3300048907 Bacteria 1822
346 Ga0496105_0065064 3300048908 Bacteria 3009
347 Ga0496106_0012056 3300048909 Bacteria 6378
348 Ga0496107_0157136 3300048910 Bacteria 1684
349 Ga0496108_0302089 3300048911 Bacteria 1394
350 Ga0496109_0174165 3300048912 Bacteria 2019
351 Ga0496110_0942177 3300048913 Bacteria 770
352 Ga0496111_0038261 3300048914 Bacteria 3437
353 Ga0496112_0032245 3300048915 Bacteria 5087
354 Ga0496113_0076659 3300048916 Bacteria 2554
355 Ga0496114_0008833 3300048917 Bacteria 7987
356 Ga0501031_0003602 3300049568 Bacteria 9960
357 Ga0501031_0008588 3300049568 Bacteria 6648
358 Ga0501033_0022498 3300049570 Bacteria 4756
359 Ga0501033_0152382 3300049570 Bacteria 1667
360 Ga0501033_0172101 3300049570 Bacteria 1555
361 Ga0501034_0029997 3300049571 Bacteria 5528
362 Ga0501036_0001366 3300049572 Bacteria 18709
363 Ga0501036_0009328 3300049572 Bacteria 8070
364 Ga0501036_0042878 3300049572 Bacteria 3830
365 Ga0501037_0012337 3300049573 Bacteria 6291
366 Ga0501037_0134919 3300049573 Bacteria 1768
367 Ga0501038_0004464 3300049574 Bacteria 13007
368 Ga0501038_0014866 3300049574 Bacteria 7088
369 Ga0501039_0000308 3300049575 Bacteria 34630
370 Ga0501039_0001649 3300049575 Bacteria 16458
371 Ga0501039_0076446 3300049575 Bacteria 2603
372 Ga0501040_0000660 3300049576 Bacteria 21282
373 Ga0501040_0114303 3300049576 Bacteria 1889
374 Ga0501041_0000409 3300049577 Bacteria 21641
375 Ga0501041_0006693 3300049577 Bacteria 6752
376 Ga0501041_0163453 3300049577 Bacteria 1392
377 Ga0501042_0001689 3300049578 Bacteria 13158
378 Ga0501042_0047639 3300049578 Bacteria 3056
379 Ga0501042_0085492 3300049578 Bacteria 2262
380 Ga0501042_0893843 3300049578 Bacteria 647
381 Ga0501043_0003929 3300049579 Bacteria 12191
382 Ga0501043_0019095 3300049579 Bacteria 5381
383 Ga0501043_0031943 3300049579 Bacteria 4138
384 Ga0501046_0002687 3300049580 Bacteria 16569
385 Ga0501046_0002905 3300049580 Bacteria 15888
386 Ga0501047_0016881 3300049581 Bacteria 6977
387 Ga0501047_0084617 3300049581 Bacteria 3048
388 Ga0501048_0001354 3300049582 Bacteria 18585
389 Ga0501048_0015764 3300049582 Bacteria 5577
390 Ga0501048_0065476 3300049582 Bacteria 2569
391 Ga0501048_0297659 3300049582 Bacteria 1148
392 Ga0501068_0443381 3300049584 Bacteria 839
393 Ga0501068_1007689 3300049584 Bacteria 550
394 Ga0501069_0023333 3300049585 Bacteria 3373
395 Ga0501069_0066359 3300049585 Bacteria 2018
396 Ga0501069_0147852 3300049585 Bacteria 1349
397 Ga0501070_0087365 3300049586 Bacteria 2581
398 Ga0501071_0005045 3300049587 Bacteria 8445
399 Ga0501071_0015892 3300049587 Bacteria 5169
400 Ga0501071_0247451 3300049587 Bacteria 1345
401 Ga0501072_0009311 3300049588 Bacteria 7466
402 Ga0501072_0036644 3300049588 Bacteria 3845
403 Ga0501073_0008253 3300049589 Bacteria 7725
404 Ga0501074_0000402 3300049590 Bacteria 25817
405 Ga0501074_0014249 3300049590 Bacteria 5782
406 Ga0501074_0032112 3300049590 Bacteria 3805
407 Ga0501074_0317142 3300049590 Bacteria 1107
408 Ga0501075_0004632 3300049591 Bacteria 9332
409 Ga0501075_0006093 3300049591 Bacteria 8279
410 Ga0501075_0639730 3300049591 Bacteria 811
411 Ga0501076_0001450 3300049592 Bacteria 15952
412 Ga0501076_0001737 3300049592 Bacteria 14740
413 Ga0501076_0517147 3300049592 Bacteria 984
414 Ga0501077_0001907 3300049593 Bacteria 12618
415 Ga0501077_0004181 3300049593 Bacteria 8722
416 Ga0501077_0066045 3300049593 Bacteria 2295
417 Ga0501250_101064 3300049680 Bacteria 514
418 Ga0501079_0001136 3300049741 Bacteria 18590
419 Ga0501079_0010523 3300049741 Bacteria 7032
420 Ga0501079_0050077 3300049741 Bacteria 3225
421 Ga0501080_0007074 3300049742 Bacteria 10135
422 Ga0501080_0113167 3300049742 Bacteria 2516
423 Ga0501081_0000325 3300049743 Bacteria 25549
424 Ga0501081_0016328 3300049743 Bacteria 4907
425 Ga0501083_0047010 3300049744 Bacteria 2918
426 Ga0501035_0012836 3300049822 Bacteria 7737
427 Ga0501035_0012876 3300049822 Bacteria 7724
428 Ga0501044_0073532 3300049823 Bacteria 3474
429 Ga0501044_0160421 3300049823 Bacteria 2226
430 Ga0501045_0151365 3300049824 Bacteria 1726
431 Ga0501045_0192295 3300049824 Bacteria 1520
432 Ga0501045_0502200 3300049824 Bacteria 901
433 nmdc:mga05p37_53989_c1 3300050507 Bacteria 4944
434 nmdc:mga09592_10284_c1 3300050508 Bacteria 7615
435 nmdc:mga09592_1255775_c1 3300050508 Bacteria 610
436 nmdc:mga0qj67_13275_c1 3300050509 Bacteria 6216
437 nmdc:mga0qj67_304694_c1 3300050509 Bacteria 1290
438 nmdc:mga06r32_20664_c1 3300050510 Bacteria 6064
439 nmdc:mga06r32_509412_c1 3300050510 Bacteria 1180
440 Ga0495601_0044195 3300053077 Bacteria 2800
441 Ga0495601_0083826 3300053077 Bacteria 2047
442 Ga0495601_0280079 3300053077 Bacteria 1087
443 Ga0495612_0110236 3300053078 Bacteria 1177
444 Ga0495595_0052280 3300053084 Bacteria 1895
445 Ga0495619_0019599 3300053085 Bacteria 4302
446 Ga0495619_0399229 3300053085 Bacteria 949
447 Ga0495619_0584193 3300053085 Bacteria 765
448 Ga0500646_0001390 3300053090 Bacteria 6420
449 Ga0500577_0014143 3300053142 Bacteria 2458
450 Ga0500588_0000751 3300053146 Bacteria 5554
451 Ga0501084_0001640 3300054114 Bacteria 17776
452 Ga0501084_0014258 3300054114 Bacteria 6583
453 Ga0501084_0110654 3300054114 Bacteria 2308
454 Ga0590075_002119 3300059424 Bacteria 4775
455 Ga0501082_0000903 3300060353 Bacteria 26092
456 Ga0501082_0062851 3300060353 Bacteria 3197
457 Ga0501082_0304646 3300060353 Bacteria 1387
458 Ga0466962_0038630 3300061719 Bacteria 2286
459 Ga0466962_0310547 3300061719 Bacteria 781
460 Ga0530510_0000981 3300061734 Bacteria 18889
461 Ga0530510_0009679 3300061734 Bacteria 6762
462 Ga0530510_1113814 3300061734 Bacteria 605
463 Ga0307407_10064193
464 rootL2_10060310
465 JGI25407J50210_10003434
466 Ga0070683_100999312
467 Ga0070682_100217890
468 Ga0068868_100252800
469 Ga0070661_100529775
470 Ga0070659_101684948
471 Ga0070709_10044660
472 Ga0070713_100104880
473 Ga0070713_100409408
474 Ga0070710_10044414
475 Ga0070711_100023113
476 Ga0070711_100208250
477 Ga0070694_100916964
478 Ga0070678_100624536
479 Ga0070706_100354687
480 Ga0070707_100104621
481 Ga0070707_100391876
482 Ga0070698_100005536
483 Ga0070698_100013957
484 Ga0070698_100115726
485 Ga0070699_100032185
486 Ga0070684_100916538
487 Ga0070695_100412358
488 Ga0070696_100195930
489 Ga0070693_100196943
490 Ga0070665_101126766
491 Ga0070704_100595680
492 Ga0068852_101519338
493 Ga0068859_101970966
494 Ga0068863_100237830
495 Ga0081455_10008771
496 Ga0081455_10023948
497 Ga0081538_10007670
498 Ga0081538_10008551
499 Ga0081540_1103470
500 Ga0081540_1173944
501 Ga0081539_10000137
502 Ga0081539_10004150
503 Ga0081539_10359949
504 Ga0070717_10095967
505 Ga0070717_10940278
506 Ga0070715_10040880
507 Ga0070716_100031178
508 Ga0097621_100134182
509 Ga0068871_100322948
510 Ga0075428_100011051
511 Ga0075428_100135384
512 Ga0075430_100005320
513 Ga0075430_100320580
514 Ga0075431_100002427
515 Ga0075431_100502235
516 Ga0075429_100004395
517 Ga0075429_101303565
518 Ga0075436_101217016
519 Ga0097620_101969953
520 Ga0111539_10643299
521 Ga0105245_10403361
522 Ga0114129_10005389
523 Ga0114129_10057379
524 Ga0114129_11162104
525 Ga0105243_10678091
526 Ga0157370_11194019
527 Ga0157370_11757266
528 Ga0157369_12415803
529 Ga0157372_10188682
530 Ga0157372_10968939
531 Ga0157375_12879145
532 Ga0157377_10395113
533 Ga0157376_10370709
534 Ga0197907_10676975
535 Ga0224712_10013374
536 Ga0207692_10046789
537 Ga0207692_10147937
538 Ga0207680_10848939
539 Ga0207685_10105284
540 Ga0207699_10013720
541 Ga0207699_10027315
542 Ga0207699_10595922
543 Ga0207684_10441588
544 Ga0207684_10622836
545 Ga0207693_10087146
546 Ga0207693_10305155
547 Ga0207663_10124783
548 Ga0207663_10603855
549 Ga0207662_10621568
550 Ga0207649_10962683
551 Ga0207646_10018523
552 Ga0207646_10086499
553 Ga0207646_10088961
554 Ga0207700_10068671
555 Ga0207700_10074592
556 Ga0207700_10101326
557 Ga0207700_10138894
558 Ga0207700_10304382
559 Ga0207700_11283975
560 Ga0207664_10054323
561 Ga0207664_10081304
562 Ga0207664_10100284
563 Ga0207664_10398772
564 Ga0207644_10163997
565 Ga0207690_11088151
566 Ga0207709_10507328
567 Ga0207665_10013277
568 Ga0207665_10046641
569 Ga0207677_11231108
570 Ga0207678_10126683
571 Ga0207702_10731550
572 Ga0207683_10590986
573 Ga0207698_11901926
574 Ga0268266_11089041
575 Ga0307511_10359326
576 Ga0307405_10135800
577 Ga0307405_10741938
578 Ga0307405_11719255
579 Ga0307413_10093721
580 Ga0307413_10436528
581 Ga0307413_11011538
582 Ga0307413_11560305
583 Ga0307413_12197753
584 Ga0307410_10020295
585 Ga0307410_10383543
586 Ga0307410_10457601
587 Ga0307406_10163007
588 Ga0307406_10181356
589 Ga0307406_10483882
590 Ga0307406_10492339
591 Ga0307407_11619586
592 Ga0307412_10257718
593 Ga0307412_10554112
594 Ga0307412_10890769
595 Ga0307409_100040369
596 Ga0307409_100281030
597 Ga0307409_100564552
598 Ga0307409_100716257
599 Ga0307409_100870029
600 Ga0307409_101144114
601 Ga0307416_100037324
602 Ga0307416_100047770
603 Ga0307416_100551080
604 Ga0307416_100931377
605 Ga0307416_100960942
606 Ga0307414_10331726
607 Ga0307411_10235871
608 Ga0307415_100000639
609 Ga0307415_100003929
610 Ga0307415_100075586
611 Ga0307415_100091407
612 Ga0307415_100414764
613 Ga0307415_100645215
614 Ga0307415_101160144
615 Ga0373930_0012369
616 Ga0373950_0084848
617 Ga0373958_0098383
618 Ga0373926_0002431
619 Ga0373926_0117322
620 Ga0373928_0006930
621 Ga0373929_0012222
622 Ga0373934_0013637
623 Ga0373940_0041727
624 Ga0373949_0292757
625 Ga0373951_0007194
626 Ga0373952_0027069
627 Ga0373923_0012370
628 Ga0373923_0017056
629 Ga0373936_0008625
630 Ga0373936_0166185
631 Ga0373939_0027043
632 Ga0373945_0075333
633 Ga0373953_0014921
634 Ga0373953_0071109
635 Ga0373954_0013444
636 Ga0373954_0075670
637 Ga0373956_0005238
638 Ga0373956_0398531
639 Ga0373957_0011837
640 Ga0373957_0043210
641 Ga0373960_0025140
642 Ga0373943_0119259
643 Ga0373946_0083997
644 Ga0373946_0145876
645 Ga0373946_0467371
646 Ga0373955_0003650
647 Ga0373955_0040381
648 Ga0373955_0070251
649 Ga0373942_0024087
650 Ga0373942_0071021
651 Ga0373961_0028445
652 Ga0373962_0008769
653 Ga0373924_0001226
654 Ga0373931_0099739
655 Ga0373931_0789257
656 Ga0373935_0034479
657 Ga0373935_0268437
658 Ga0373927_0589884
659 Ga0373933_0004173
660 Ga0373947_0000014
661 Ga0373947_0261215
662 Ga0373947_0747198
663 Ga0373937_0010502
664 Ga0373937_0237540
665 Ga0373925_0067504
666 Ga0373925_0330086
667 Ga0373925_0372675
668 Ga0436364_0002345
669 Ga0436363_0515487
670 Ga0439436_0002780
671 Ga0439439_0006028
672 Ga0439433_0003834
673 Ga0439449_0012249
674 Ga0439455_0234755
675 Ga0439457_003810
676 Ga0439462_0013113
677 Ga0450916_045402
678 Ga0439440_0022865
679 Ga0466972_0118211
680 Ga0466965_0083096
681 Ga0466965_0220809
682 Ga0466966_0191567
683 Ga0466966_0582738
684 Ga0466961_0078125
685 Ga0466963_0081958
686 Ga0466963_0953539
687 Ga0466963_1217118
688 Ga0466964_0033492
689 Ga0466971_0010253
690 Ga0466971_0134264
691 Ga0466970_0011850
692 Ga0466970_0112983
693 Ga0466970_0197475
694 Ga0466970_0234895
695 Ga0466957_0013380
696 Ga0466957_1176397
697 Ga0466960_0533723
698 Ga0466959_0117912
699 Ga0466959_0211380
700 Ga0466958_0035718
701 Ga0466958_0066523
702 Ga0466958_0310740
703 Ga0466967_0000641
704 Ga0466967_0006339
705 Ga0466967_0215016
706 Ga0466967_0623522
707 Ga0466967_2196570
708 Ga0495592_0041720
709 Ga0495592_0146818
710 Ga0495603_0046151
711 Ga0495629_0002479
712 Ga0495629_0140358
713 Ga0495641_0004811
714 Ga0495641_0017766
715 Ga0495651_0009665
716 Ga0495651_0018163
717 Ga0495651_0365647
718 Ga0495653_0011082
719 Ga0495653_0041764
720 Ga0495580_0034049
721 Ga0495580_0614641
722 Ga0495582_0007220
723 Ga0495582_0035808
724 Ga0495639_0010120
725 Ga0495662_0007668
726 Ga0495662_0029797
727 Ga0495664_0006524
728 Ga0495664_0056613
729 Ga0495594_0317138
730 Ga0495608_0038188
731 Ga0495608_0206362
732 Ga0495618_0016278
733 Ga0495618_0034714
734 Ga0495618_0038593
735 Ga0495628_0034053
736 Ga0495628_0067917
737 Ga0495630_0003733
738 Ga0495630_0071190
739 Ga0495631_0474146
740 Ga0495666_0027964
741 Ga0495652_0026368
742 Ga0495652_0045539
743 Ga0495665_0002626
744 Ga0495665_0201870
745 Ga0495640_0028266
746 Ga0495640_0039624
747 Ga0495640_0400702
748 Ga0495586_0014824
749 Ga0495586_0293270
750 Ga0495587_0014306
751 Ga0495587_0023440
752 Ga0495645_0094715
753 Ga0495645_0239575
754 Ga0495645_0329680
755 Ga0495667_0032864
756 Ga0495656_0639581
757 Ga0495634_0012601
758 Ga0495634_0023695
759 Ga0495634_0080185
760 Ga0495635_0023825
761 Ga0495635_0031178
762 Ga0495657_0034298
763 Ga0495657_0574472
764 Ga0495599_0023199
765 Ga0495599_0026352
766 Ga0495599_0275237
767 Ga0495623_0011274
768 Ga0495623_0109815
769 Ga0495646_0007263
770 Ga0495646_0043388
771 Ga0495647_0049501
772 Ga0495647_0176980
773 Ga0495658_0003103
774 Ga0495658_0041846
775 Ga0495613_0110822
776 Ga0495613_0343586
777 Ga0495624_0052548
778 Ga0495600_0010078
779 Ga0495600_0028588
780 Ga0495581_0003056
781 Ga0495581_0008812
782 Ga0495604_0010113
783 Ga0495604_0107157
784 Ga0495604_0459054
785 Ga0495674_0020387
786 Ga0495674_0075900
787 Ga0495672_0086325
788 Ga0495676_0033438
789 Ga0495676_0764031
790 Ga0495676_0841262
791 Ga0495680_0010102
792 Ga0495680_0048420
793 Ga0495680_0133513
794 Ga0495675_0039220
795 Ga0495684_0006104
796 Ga0495684_0021922
797 Ga0495684_0170947
798 Ga0495593_0004694
799 Ga0495593_0687849
800 Ga0495602_0055982
801 Ga0495602_0065731
802 Ga0495614_0039373
803 Ga0495614_0352202
804 Ga0496102_0201711
805 Ga0496103_0023923
806 Ga0496103_0033281
807 Ga0496104_0217527
808 Ga0496105_0065064
809 Ga0496106_0012056
810 Ga0496107_0157136
811 Ga0496108_0302089
812 Ga0496109_0174165
813 Ga0496110_0942177
814 Ga0496111_0038261
815 Ga0496112_0032245
816 Ga0496113_0076659
817 Ga0496114_0008833
818 Ga0501031_0003602
819 Ga0501031_0008588
820 Ga0501033_0022498
821 Ga0501033_0152382
822 Ga0501033_0172101
823 Ga0501034_0029997
824 Ga0501036_0001366
825 Ga0501036_0009328
826 Ga0501036_0042878
827 Ga0501037_0012337
828 Ga0501037_0134919
829 Ga0501038_0004464
830 Ga0501038_0014866
831 Ga0501039_0000308
832 Ga0501039_0001649
833 Ga0501039_0076446
834 Ga0501040_0000660
835 Ga0501040_0114303
836 Ga0501041_0000409
837 Ga0501041_0006693
838 Ga0501041_0163453
839 Ga0501042_0001689
840 Ga0501042_0047639
841 Ga0501042_0085492
842 Ga0501042_0893843
843 Ga0501043_0003929
844 Ga0501043_0019095
845 Ga0501043_0031943
846 Ga0501046_0002687
847 Ga0501046_0002905
848 Ga0501047_0016881
849 Ga0501047_0084617
850 Ga0501048_0001354
851 Ga0501048_0015764
852 Ga0501048_0065476
853 Ga0501048_0297659
854 Ga0501068_0443381
855 Ga0501068_1007689
856 Ga0501069_0023333
857 Ga0501069_0066359
858 Ga0501069_0147852
859 Ga0501070_0087365
860 Ga0501071_0005045
861 Ga0501071_0015892
862 Ga0501071_0247451
863 Ga0501072_0009311
864 Ga0501072_0036644
865 Ga0501073_0008253
866 Ga0501074_0000402
867 Ga0501074_0014249
868 Ga0501074_0032112
869 Ga0501074_0317142
870 Ga0501075_0004632
871 Ga0501075_0006093
872 Ga0501075_0639730
873 Ga0501076_0001450
874 Ga0501076_0001737
875 Ga0501076_0517147
876 Ga0501077_0001907
877 Ga0501077_0004181
878 Ga0501077_0066045
879 Ga0501250_101064
880 Ga0501079_0001136
881 Ga0501079_0010523
882 Ga0501079_0050077
883 Ga0501080_0007074
884 Ga0501080_0113167
885 Ga0501081_0000325
886 Ga0501081_0016328
887 Ga0501083_0047010
888 Ga0501035_0012836
889 Ga0501035_0012876
890 Ga0501044_0073532
891 Ga0501044_0160421
892 Ga0501045_0151365
893 Ga0501045_0192295
894 Ga0501045_0502200
895 nmdc:mga05p37_53989_c1
896 nmdc:mga09592_10284_c1
897 nmdc:mga09592_1255775_c1
898 nmdc:mga0qj67_13275_c1
899 nmdc:mga0qj67_304694_c1
900 nmdc:mga06r32_20664_c1
901 nmdc:mga06r32_509412_c1
902 Ga0495601_0044195
903 Ga0495601_0083826
904 Ga0495601_0280079
905 Ga0495612_0110236
906 Ga0495595_0052280
907 Ga0495619_0019599
908 Ga0495619_0399229
909 Ga0495619_0584193
910 Ga0500646_0001390
911 Ga0500577_0014143
912 Ga0500588_0000751
913 Ga0501084_0001640
914 Ga0501084_0014258
915 Ga0501084_0110654
916 Ga0590075_002119
917 Ga0501082_0000903
918 Ga0501082_0062851
919 Ga0501082_0304646
920 Ga0466962_0038630
921 Ga0466962_0310547
922 Ga0530510_0000981
923 Ga0530510_0009679
924 Ga0530510_1113814

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03992

ABM

Antibiotic biosynthesis monooxygenase

25

101

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tvz-assembly2.cif.gz_B structure of bacillus subtilis hmob 0.8354 2 63
1iuj-assembly1.cif.gz_B the structure of tt1380 protein from thermus thermophilus 0.8149 1 93
4oz5-assembly1.cif.gz_A bacillus subtilis hmob 0.8102 2 90
4zos-assembly2.cif.gz_B 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] 0.8072 2 94
4zos-assembly1.cif.gz_C 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] 0.8038 2 93
ID Description Score Start End Superfamily
1iujA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8189 1 94 3.30.70.100
af_O06569_1_91_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8122 1 91 3.30.70.100
4zosB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8072 2 94 3.30.70.100
af_O06569_1_91_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8047 1 91 3.30.70.100
3kg1A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7972 2 95 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A6N7Z126-F1-model_v4 ABM domain-containing protein 0.8604 2 94
AF-A0A2S4M7J4-F1-model_v4 Heme-degrading monooxygenase HmoA 0.8596 1 94 GO:0004497
AF-A0A4R5LJZ1-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.8565 1 94 GO:0004497
AF-A0A838DIM9-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.84 1 95 GO:0004497
AF-A0A2E5PN22-F1-model_v4 ABM domain-containing protein 0.8397 1 94

Map