F448939
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 462 | 270 | 462 | 90 |
Family's Representative Sequence
| Representative Sequence | 3300031728|Ga0316578_10205360|Ga0316578_102053602 |
| Length | 111 |
| Sequence | MTDPSVALLTDATIAAEAVTGPILAGALGIGFLLVSAALLMSLARLVIGPDKPDRILALDTLYVNTVALLVLLGIHLSNDLFFEAALLIALIGFIGTVALAKFLTRGDIIE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300003405 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM | Metagenome | Rhizosphere |
| 4 | 3300003503 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 176 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 177 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 178 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 179 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 180 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 181 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 182 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 183 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 184 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 188 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 190 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 191 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 192 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 194 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 200 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 201 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 202 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 203 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 204 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 205 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 206 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 210 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 211 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 212 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 213 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 214 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 215 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 216 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 217 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 218 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 219 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 220 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 221 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 222 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 223 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 224 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 225 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 226 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 227 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 228 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 229 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 230 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 231 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 232 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 234 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 235 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 236 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 237 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 240 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 241 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 242 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 243 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 259 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 265 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 270 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.97 |
| Metatranscriptomes | 3.03 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.25 |
| Rhizosphere | 96.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24034J26672_10068129 | 3300002239 | Bacteria | 634 |
| 2 | JGI24742J22300_10118869 | 3300002244 | Bacteria | 521 |
| 3 | JGI26132J50249_104774 | 3300003405 | Bacteria | 512 |
| 4 | JGI26141J51220_1011613 | 3300003503 | Bacteria | 583 |
| 5 | Ga0065704_10164877 | 3300005289 | Bacteria | 1329 |
| 6 | Ga0070676_10000774 | 3300005328 | Bacteria | 15756 |
| 7 | Ga0070676_10001175 | 3300005328 | Bacteria | 13119 |
| 8 | Ga0070683_100054794 | 3300005329 | Bacteria | 3698 |
| 9 | Ga0070690_100046925 | 3300005330 | Bacteria | 2747 |
| 10 | Ga0070670_100026878 | 3300005331 | Bacteria | 4950 |
| 11 | Ga0070670_100036317 | 3300005331 | Bacteria | 4240 |
| 12 | Ga0070677_10444375 | 3300005333 | Bacteria | 692 |
| 13 | Ga0068869_100003142 | 3300005334 | Bacteria | 10073 |
| 14 | Ga0068869_100004518 | 3300005334 | Bacteria | 8655 |
| 15 | Ga0070666_10000716 | 3300005335 | Bacteria | 20098 |
| 16 | Ga0070680_100030043 | 3300005336 | Bacteria | 4364 |
| 17 | Ga0070682_100006507 | 3300005337 | Bacteria | 6557 |
| 18 | Ga0068868_100015154 | 3300005338 | Bacteria | 5695 |
| 19 | Ga0068868_100076397 | 3300005338 | Bacteria | 2678 |
| 20 | Ga0070660_100003613 | 3300005339 | Bacteria | 10688 |
| 21 | Ga0070689_100107834 | 3300005340 | Bacteria | 2212 |
| 22 | Ga0070689_100506128 | 3300005340 | Bacteria | 1035 |
| 23 | Ga0070691_10083633 | 3300005341 | Bacteria | 1566 |
| 24 | Ga0070661_100003491 | 3300005344 | Bacteria | 10822 |
| 25 | Ga0070668_100001323 | 3300005347 | Bacteria | 17744 |
| 26 | Ga0070669_100001499 | 3300005353 | Bacteria | 16886 |
| 27 | Ga0070669_100009363 | 3300005353 | Bacteria | 6978 |
| 28 | Ga0070675_100003394 | 3300005354 | Bacteria | 12063 |
| 29 | Ga0070675_100125437 | 3300005354 | Bacteria | 2184 |
| 30 | Ga0070671_100008745 | 3300005355 | Bacteria | 8123 |
| 31 | Ga0070671_100171937 | 3300005355 | Bacteria | 1833 |
| 32 | Ga0070674_100024859 | 3300005356 | Bacteria | 3891 |
| 33 | Ga0070673_100001645 | 3300005364 | Bacteria | 13242 |
| 34 | Ga0070688_100024809 | 3300005365 | Bacteria | 3543 |
| 35 | Ga0070688_101017671 | 3300005365 | Bacteria | 659 |
| 36 | Ga0070659_100011644 | 3300005366 | Bacteria | 6508 |
| 37 | Ga0070667_100001885 | 3300005367 | Bacteria | 18604 |
| 38 | Ga0070667_100047541 | 3300005367 | Bacteria | 3610 |
| 39 | Ga0070703_10008355 | 3300005406 | Bacteria | 2910 |
| 40 | Ga0070701_10019598 | 3300005438 | Bacteria | 3197 |
| 41 | Ga0070705_100015847 | 3300005440 | Bacteria | 3903 |
| 42 | Ga0070700_100120228 | 3300005441 | Bacteria | 1759 |
| 43 | Ga0070694_100078319 | 3300005444 | Bacteria | 2292 |
| 44 | Ga0070708_100000735 | 3300005445 | Bacteria | 24829 |
| 45 | Ga0070708_100591724 | 3300005445 | Bacteria | 1046 |
| 46 | Ga0070663_100018630 | 3300005455 | Bacteria | 4556 |
| 47 | Ga0070678_100001250 | 3300005456 | Bacteria | 13457 |
| 48 | Ga0070662_101372432 | 3300005457 | Bacteria | 609 |
| 49 | Ga0070681_10025228 | 3300005458 | Bacteria | 5979 |
| 50 | Ga0070681_10590122 | 3300005458 | Bacteria | 1025 |
| 51 | Ga0068867_100013240 | 3300005459 | Bacteria | 5842 |
| 52 | Ga0070685_10053447 | 3300005466 | Bacteria | 2340 |
| 53 | Ga0070707_101865562 | 3300005468 | Bacteria | 568 |
| 54 | Ga0070679_100001879 | 3300005530 | Bacteria | 18896 |
| 55 | Ga0068853_100011113 | 3300005539 | Bacteria | 7303 |
| 56 | Ga0068853_100315486 | 3300005539 | Bacteria | 1448 |
| 57 | Ga0068853_100341055 | 3300005539 | Bacteria | 1392 |
| 58 | Ga0070672_100001970 | 3300005543 | Bacteria | 12859 |
| 59 | Ga0070672_100248023 | 3300005543 | Bacteria | 1499 |
| 60 | Ga0070686_101562126 | 3300005544 | Bacteria | 557 |
| 61 | Ga0070695_100012223 | 3300005545 | Bacteria | 5149 |
| 62 | Ga0070696_100018398 | 3300005546 | Bacteria | 4721 |
| 63 | Ga0070693_100202346 | 3300005547 | Bacteria | 1290 |
| 64 | Ga0070665_100009908 | 3300005548 | Bacteria | 9637 |
| 65 | Ga0070704_100001689 | 3300005549 | Bacteria | 12011 |
| 66 | Ga0070704_101194675 | 3300005549 | Bacteria | 693 |
| 67 | Ga0068855_100011388 | 3300005563 | Bacteria | 10740 |
| 68 | Ga0070664_100036940 | 3300005564 | Bacteria | 4105 |
| 69 | Ga0068857_100197024 | 3300005577 | Bacteria | 1835 |
| 70 | Ga0068854_100002332 | 3300005578 | Bacteria | 11706 |
| 71 | Ga0068856_100154544 | 3300005614 | Bacteria | 2304 |
| 72 | Ga0070702_100236596 | 3300005615 | Bacteria | 1230 |
| 73 | Ga0068852_100436931 | 3300005616 | Bacteria | 1293 |
| 74 | Ga0068859_100006568 | 3300005617 | Bacteria | 11803 |
| 75 | Ga0068859_100007175 | 3300005617 | Bacteria | 11313 |
| 76 | Ga0068864_100006114 | 3300005618 | Bacteria | 9876 |
| 77 | Ga0068864_100025840 | 3300005618 | Bacteria | 4948 |
| 78 | Ga0068866_10566168 | 3300005718 | Bacteria | 762 |
| 79 | Ga0068866_10710406 | 3300005718 | Bacteria | 690 |
| 80 | Ga0068861_100006024 | 3300005719 | Bacteria | 8244 |
| 81 | Ga0068861_100025326 | 3300005719 | Bacteria | 4302 |
| 82 | Ga0068870_10003489 | 3300005840 | Bacteria | 6669 |
| 83 | Ga0068870_10254225 | 3300005840 | Bacteria | 1090 |
| 84 | Ga0068863_100002793 | 3300005841 | Bacteria | 17293 |
| 85 | Ga0068863_100029243 | 3300005841 | Bacteria | 5260 |
| 86 | Ga0068858_100005140 | 3300005842 | Bacteria | 12823 |
| 87 | Ga0068858_100016786 | 3300005842 | Bacteria | 6874 |
| 88 | Ga0068860_100005023 | 3300005843 | Bacteria | 13463 |
| 89 | Ga0068860_100007534 | 3300005843 | Bacteria | 10888 |
| 90 | Ga0068862_100009111 | 3300005844 | Bacteria | 8217 |
| 91 | Ga0070716_100895512 | 3300006173 | Bacteria | 694 |
| 92 | Ga0097621_100001779 | 3300006237 | Bacteria | 14785 |
| 93 | Ga0068871_100003595 | 3300006358 | Bacteria | 10651 |
| 94 | Ga0075428_100478377 | 3300006844 | Bacteria | 1333 |
| 95 | Ga0075431_100463165 | 3300006847 | Bacteria | 1262 |
| 96 | Ga0075431_100650680 | 3300006847 | Unclassified | 1034 |
| 97 | Ga0075433_10007076 | 3300006852 | Bacteria | 8881 |
| 98 | Ga0075434_100041765 | 3300006871 | Bacteria | 4544 |
| 99 | Ga0075429_100425903 | 3300006880 | Bacteria | 1162 |
| 100 | Ga0068865_100001873 | 3300006881 | Bacteria | 12369 |
| 101 | Ga0097620_100006568 | 3300006931 | Bacteria | 11803 |
| 102 | Ga0097620_100007175 | 3300006931 | Bacteria | 11313 |
| 103 | Ga0105244_10008784 | 3300009036 | Bacteria | 6274 |
| 104 | Ga0105250_10551260 | 3300009092 | Bacteria | 529 |
| 105 | Ga0105240_10260136 | 3300009093 | Bacteria | 2002 |
| 106 | Ga0105245_10041799 | 3300009098 | Bacteria | 4087 |
| 107 | Ga0114129_11180619 | 3300009147 | Bacteria | 954 |
| 108 | Ga0105243_10498303 | 3300009148 | Bacteria | 1153 |
| 109 | Ga0105243_11213910 | 3300009148 | Bacteria | 768 |
| 110 | Ga0105241_10009352 | 3300009174 | Bacteria | 7203 |
| 111 | Ga0105248_10018359 | 3300009177 | Bacteria | 7726 |
| 112 | Ga0105237_10052739 | 3300009545 | Bacteria | 4081 |
| 113 | Ga0105249_10459918 | 3300009553 | Bacteria | 1312 |
| 114 | Ga0105246_12099753 | 3300011119 | Bacteria | 547 |
| 115 | Ga0157373_10020097 | 3300013100 | Bacteria | 4858 |
| 116 | Ga0157373_10069426 | 3300013100 | Bacteria | 2491 |
| 117 | Ga0157373_10372844 | 3300013100 | Bacteria | 1020 |
| 118 | Ga0157371_10011030 | 3300013102 | Bacteria | 7001 |
| 119 | Ga0157371_10040071 | 3300013102 | Bacteria | 3348 |
| 120 | Ga0157371_10079814 | 3300013102 | Bacteria | 2317 |
| 121 | Ga0157371_10338413 | 3300013102 | Bacteria | 1094 |
| 122 | Ga0157370_10127411 | 3300013104 | Bacteria | 2376 |
| 123 | Ga0157369_10001875 | 3300013105 | Bacteria | 25352 |
| 124 | Ga0157369_10005244 | 3300013105 | Bacteria | 15117 |
| 125 | Ga0157374_10003539 | 3300013296 | Bacteria | 13142 |
| 126 | Ga0157378_10056099 | 3300013297 | Bacteria | 3509 |
| 127 | Ga0157378_10244106 | 3300013297 | Bacteria | 1717 |
| 128 | Ga0163162_10054335 | 3300013306 | Bacteria | 4029 |
| 129 | Ga0157372_10003171 | 3300013307 | Bacteria | 17732 |
| 130 | Ga0157372_10212337 | 3300013307 | Bacteria | 2243 |
| 131 | Ga0157372_10389706 | 3300013307 | Bacteria | 1623 |
| 132 | Ga0157375_10006411 | 3300013308 | Bacteria | 10256 |
| 133 | Ga0163163_10096096 | 3300014325 | Bacteria | 2983 |
| 134 | Ga0163163_10202503 | 3300014325 | Bacteria | 2033 |
| 135 | Ga0157380_10243505 | 3300014326 | Bacteria | 1623 |
| 136 | Ga0157380_10734070 | 3300014326 | Bacteria | 997 |
| 137 | Ga0157377_10128870 | 3300014745 | Bacteria | 1543 |
| 138 | Ga0157379_10004073 | 3300014968 | Bacteria | 12470 |
| 139 | Ga0157376_10003562 | 3300014969 | Bacteria | 10737 |
| 140 | Ga0182006_1142703 | 3300015261 | Bacteria | 817 |
| 141 | Ga0182007_10008129 | 3300015262 | Bacteria | 4330 |
| 142 | Ga0163161_10223478 | 3300017792 | Unclassified | 1459 |
| 143 | Ga0207697_10028171 | 3300025315 | Bacteria | 2298 |
| 144 | Ga0207697_10240665 | 3300025315 | Bacteria | 800 |
| 145 | Ga0207713_1005333 | 3300025735 | Bacteria | 8074 |
| 146 | Ga0207653_10002179 | 3300025885 | Bacteria | 6234 |
| 147 | Ga0207642_10906431 | 3300025899 | Bacteria | 565 |
| 148 | Ga0207688_10009535 | 3300025901 | Bacteria | 5285 |
| 149 | Ga0207680_10044818 | 3300025903 | Bacteria | 2604 |
| 150 | Ga0207680_10395679 | 3300025903 | Bacteria | 976 |
| 151 | Ga0207647_10028049 | 3300025904 | Bacteria | 3663 |
| 152 | Ga0207645_10000812 | 3300025907 | Bacteria | 26130 |
| 153 | Ga0207645_10002937 | 3300025907 | Bacteria | 13175 |
| 154 | Ga0207643_10000722 | 3300025908 | Bacteria | 20289 |
| 155 | Ga0207654_10061354 | 3300025911 | Bacteria | 2200 |
| 156 | Ga0207707_10002355 | 3300025912 | Bacteria | 17022 |
| 157 | Ga0207695_10204409 | 3300025913 | Bacteria | 1888 |
| 158 | Ga0207660_10014617 | 3300025917 | Bacteria | 5167 |
| 159 | Ga0207662_10059424 | 3300025918 | Bacteria | 2291 |
| 160 | Ga0207657_10000385 | 3300025919 | Bacteria | 46501 |
| 161 | Ga0207649_10015334 | 3300025920 | Bacteria | 4307 |
| 162 | Ga0207652_10016056 | 3300025921 | Bacteria | 6105 |
| 163 | Ga0207646_11749377 | 3300025922 | Bacteria | 533 |
| 164 | Ga0207681_10002868 | 3300025923 | Bacteria | 10891 |
| 165 | Ga0207650_10034483 | 3300025925 | Bacteria | 3670 |
| 166 | Ga0207650_10072929 | 3300025925 | Bacteria | 2585 |
| 167 | Ga0207659_10002225 | 3300025926 | Bacteria | 11551 |
| 168 | Ga0207659_10452460 | 3300025926 | Bacteria | 1082 |
| 169 | Ga0207687_11282719 | 3300025927 | Bacteria | 630 |
| 170 | Ga0207644_10006005 | 3300025931 | Bacteria | 7915 |
| 171 | Ga0207644_10525031 | 3300025931 | Bacteria | 978 |
| 172 | Ga0207706_10003911 | 3300025933 | Bacteria | 14137 |
| 173 | Ga0207706_10506718 | 3300025933 | Bacteria | 1041 |
| 174 | Ga0207709_10743267 | 3300025935 | Bacteria | 788 |
| 175 | Ga0207709_11053032 | 3300025935 | Bacteria | 667 |
| 176 | Ga0207670_10084284 | 3300025936 | Bacteria | 2231 |
| 177 | Ga0207670_10622446 | 3300025936 | Bacteria | 888 |
| 178 | Ga0207669_10014819 | 3300025937 | Bacteria | 3917 |
| 179 | Ga0207704_10003782 | 3300025938 | Bacteria | 6892 |
| 180 | Ga0207691_10000041 | 3300025940 | Bacteria | 106275 |
| 181 | Ga0207691_10260034 | 3300025940 | Bacteria | 1496 |
| 182 | Ga0207711_10054791 | 3300025941 | Bacteria | 3423 |
| 183 | Ga0207689_10000204 | 3300025942 | Bacteria | 52389 |
| 184 | Ga0207689_10030654 | 3300025942 | Bacteria | 4481 |
| 185 | Ga0207661_10411109 | 3300025944 | Bacteria | 1228 |
| 186 | Ga0207679_10035706 | 3300025945 | Bacteria | 3519 |
| 187 | Ga0207667_10007006 | 3300025949 | Bacteria | 13616 |
| 188 | Ga0207651_10029214 | 3300025960 | Bacteria | 3490 |
| 189 | Ga0207712_10291253 | 3300025961 | Bacteria | 1336 |
| 190 | Ga0207668_10010094 | 3300025972 | Bacteria | 5689 |
| 191 | Ga0207668_10821323 | 3300025972 | Bacteria | 824 |
| 192 | Ga0207640_10066771 | 3300025981 | Bacteria | 2404 |
| 193 | Ga0207658_10004908 | 3300025986 | Bacteria | 9226 |
| 194 | Ga0207658_10263507 | 3300025986 | Bacteria | 1470 |
| 195 | Ga0207677_10006748 | 3300026023 | Bacteria | 6304 |
| 196 | Ga0207677_10056106 | 3300026023 | Bacteria | 2697 |
| 197 | Ga0207703_10004130 | 3300026035 | Bacteria | 11981 |
| 198 | Ga0207639_10011721 | 3300026041 | Bacteria | 6096 |
| 199 | Ga0207639_10372952 | 3300026041 | Bacteria | 1280 |
| 200 | Ga0207678_10041350 | 3300026067 | Bacteria | 3997 |
| 201 | Ga0207708_10236409 | 3300026075 | Bacteria | 1468 |
| 202 | Ga0207702_10033285 | 3300026078 | Bacteria | 4305 |
| 203 | Ga0207641_10001249 | 3300026088 | Bacteria | 25369 |
| 204 | Ga0207648_10001461 | 3300026089 | Bacteria | 25990 |
| 205 | Ga0207648_10004390 | 3300026089 | Bacteria | 14500 |
| 206 | Ga0207676_10005257 | 3300026095 | Bacteria | 9163 |
| 207 | Ga0207676_10017371 | 3300026095 | Bacteria | 5213 |
| 208 | Ga0207674_10001950 | 3300026116 | Bacteria | 26184 |
| 209 | Ga0207675_100005135 | 3300026118 | Bacteria | 12603 |
| 210 | Ga0207675_100008371 | 3300026118 | Bacteria | 9748 |
| 211 | Ga0207683_10000011 | 3300026121 | Bacteria | 140261 |
| 212 | Ga0209371_1000135 | 3300027312 | Bacteria | 121718 |
| 213 | Ga0209969_1009261 | 3300027360 | Bacteria | 1401 |
| 214 | Ga0209981_1046028 | 3300027378 | Bacteria | 656 |
| 215 | Ga0209996_1000510 | 3300027395 | Bacteria | 4668 |
| 216 | Ga0209984_1001665 | 3300027424 | Bacteria | 2424 |
| 217 | Ga0210000_1053272 | 3300027462 | Bacteria | 651 |
| 218 | Ga0209995_1053270 | 3300027471 | Bacteria | 687 |
| 219 | Ga0209968_1067782 | 3300027526 | Bacteria | 634 |
| 220 | Ga0209999_1034324 | 3300027543 | Bacteria | 944 |
| 221 | Ga0209982_1090629 | 3300027552 | Bacteria | 507 |
| 222 | Ga0209970_1064884 | 3300027614 | Bacteria | 673 |
| 223 | Ga0210002_1006419 | 3300027617 | Bacteria | 1774 |
| 224 | Ga0209983_1002354 | 3300027665 | Bacteria | 4148 |
| 225 | Ga0209971_1004302 | 3300027682 | Bacteria | 3380 |
| 226 | Ga0209971_1192739 | 3300027682 | Bacteria | 502 |
| 227 | Ga0209974_10016365 | 3300027876 | Bacteria | 2463 |
| 228 | Ga0268266_10009550 | 3300028379 | Bacteria | 8536 |
| 229 | Ga0268265_10133019 | 3300028380 | Bacteria | 2070 |
| 230 | Ga0268264_10011762 | 3300028381 | Bacteria | 7216 |
| 231 | Ga0268264_10037926 | 3300028381 | Bacteria | 3975 |
| 232 | Ga0268256_1000148 | 3300030500 | Bacteria | 94347 |
| 233 | Ga0307408_100000005 | 3300031548 | Bacteria | 529098 |
| 234 | Ga0307408_100954931 | 3300031548 | Bacteria | 788 |
| 235 | Ga0316579_10006926 | 3300031691 | Bacteria | 4653 |
| 236 | Ga0316579_10182880 | 3300031691 | Bacteria | 1013 |
| 237 | Ga0316579_10221246 | 3300031691 | Bacteria | 916 |
| 238 | Ga0316579_10485042 | 3300031691 | Bacteria | 598 |
| 239 | Ga0316576_10000526 | 3300031727 | Bacteria | 17908 |
| 240 | Ga0316576_10025645 | 3300031727 | Bacteria | 4130 |
| 241 | Ga0316576_10052640 | 3300031727 | Bacteria | 2964 |
| 242 | Ga0316576_10054830 | 3300031727 | Bacteria | 2907 |
| 243 | Ga0316576_10077273 | 3300031727 | Bacteria | 2465 |
| 244 | Ga0316576_10130658 | 3300031727 | Bacteria | 1889 |
| 245 | Ga0316576_10145946 | 3300031727 | Bacteria | 1782 |
| 246 | Ga0316576_10164301 | 3300031727 | Bacteria | 1675 |
| 247 | Ga0316576_10261132 | 3300031727 | Bacteria | 1299 |
| 248 | Ga0316576_10496834 | 3300031727 | Bacteria | 897 |
| 249 | Ga0316576_10804794 | 3300031727 | Unclassified | 676 |
| 250 | Ga0316576_10869668 | 3300031727 | Bacteria | 646 |
| 251 | Ga0316578_10007930 | 3300031728 | Bacteria | 5365 |
| 252 | Ga0316578_10008122 | 3300031728 | Bacteria | 5316 |
| 253 | Ga0316578_10012798 | 3300031728 | Bacteria | 4430 |
| 254 | Ga0316578_10029330 | 3300031728 | Bacteria | 3122 |
| 255 | Ga0316578_10043372 | 3300031728 | Bacteria | 2612 |
| 256 | Ga0316578_10047387 | 3300031728 | Bacteria | 2507 |
| 257 | Ga0316578_10054639 | 3300031728 | Bacteria | 2343 |
| 258 | Ga0316578_10066182 | 3300031728 | Bacteria | 2134 |
| 259 | Ga0316578_10130558 | 3300031728 | Bacteria | 1512 |
| 260 | Ga0316578_10139890 | 3300031728 | Bacteria | 1457 |
| 261 | Ga0316578_10156880 | 3300031728 | Bacteria | 1371 |
| 262 | Ga0316578_10194416 | 3300031728 | Bacteria | 1222 |
| 263 | Ga0316578_10205360 | 3300031728 | Bacteria | 1186 |
| 264 | Ga0316578_10230852 | 3300031728 | Bacteria | 1111 |
| 265 | Ga0316578_10276289 | 3300031728 | Bacteria | 1006 |
| 266 | Ga0316577_10015253 | 3300031733 | Bacteria | 4226 |
| 267 | Ga0316577_10015859 | 3300031733 | Bacteria | 4147 |
| 268 | Ga0316577_10023832 | 3300031733 | Bacteria | 3398 |
| 269 | Ga0316577_10123391 | 3300031733 | Bacteria | 1456 |
| 270 | Ga0316577_10311833 | 3300031733 | Bacteria | 892 |
| 271 | Ga0316577_10347275 | 3300031733 | Bacteria | 842 |
| 272 | Ga0316577_10397618 | 3300031733 | Bacteria | 783 |
| 273 | Ga0316577_10421352 | 3300031733 | Bacteria | 758 |
| 274 | Ga0316577_10655854 | 3300031733 | Bacteria | 596 |
| 275 | Ga0316577_10709813 | 3300031733 | Bacteria | 571 |
| 276 | Ga0316577_10724964 | 3300031733 | Bacteria | 564 |
| 277 | Ga0307406_10000700 | 3300031901 | Bacteria | 18926 |
| 278 | Ga0307406_10601568 | 3300031901 | Bacteria | 907 |
| 279 | Ga0316583_10004764 | 3300032133 | Bacteria | 4849 |
| 280 | Ga0316583_10060104 | 3300032133 | Bacteria | 1332 |
| 281 | Ga0316583_10119462 | 3300032133 | Bacteria | 919 |
| 282 | Ga0316583_10296583 | 3300032133 | Unclassified | 559 |
| 283 | Ga0316585_10005021 | 3300032137 | Bacteria | 3720 |
| 284 | Ga0316585_10065243 | 3300032137 | Bacteria | 1179 |
| 285 | Ga0316585_10083287 | 3300032137 | Bacteria | 1043 |
| 286 | Ga0316585_10093495 | 3300032137 | Bacteria | 984 |
| 287 | Ga0316585_10105099 | 3300032137 | Bacteria | 927 |
| 288 | Ga0316580_10004071 | 3300032139 | Bacteria | 4213 |
| 289 | Ga0316580_10010047 | 3300032139 | Bacteria | 2851 |
| 290 | Ga0316580_10013867 | 3300032139 | Bacteria | 2456 |
| 291 | Ga0316580_10018053 | 3300032139 | Bacteria | 2170 |
| 292 | Ga0316580_10022901 | 3300032139 | Bacteria | 1928 |
| 293 | Ga0316580_10054900 | 3300032139 | Bacteria | 1225 |
| 294 | Ga0316580_10060526 | 3300032139 | Bacteria | 1163 |
| 295 | Ga0316580_10067492 | 3300032139 | Bacteria | 1096 |
| 296 | Ga0316580_10092838 | 3300032139 | Bacteria | 924 |
| 297 | Ga0316580_10173072 | 3300032139 | Bacteria | 663 |
| 298 | Ga0316593_10019682 | 3300032168 | Bacteria | 2089 |
| 299 | Ga0316593_10026378 | 3300032168 | Bacteria | 1857 |
| 300 | Ga0316593_10061858 | 3300032168 | Bacteria | 1281 |
| 301 | Ga0316593_10078007 | 3300032168 | Bacteria | 1153 |
| 302 | Ga0316592_1004112 | 3300033524 | Bacteria | 2681 |
| 303 | Ga0316592_1123290 | 3300033524 | Bacteria | 602 |
| 304 | Ga0316588_1017143 | 3300033528 | Bacteria | 1612 |
| 305 | Ga0316588_1181053 | 3300033528 | Bacteria | 547 |
| 306 | Ga0316587_1015201 | 3300033529 | Bacteria | 1276 |
| 307 | Ga0316596_1000810 | 3300033541 | Bacteria | 5790 |
| 308 | Ga0316596_1006474 | 3300033541 | Bacteria | 2725 |
| 309 | Ga0316596_1019803 | 3300033541 | Bacteria | 1709 |
| 310 | Ga0316596_1145304 | 3300033541 | Bacteria | 650 |
| 311 | Ga0316596_1196606 | 3300033541 | Unclassified | 560 |
| 312 | Ga0373930_0052665 | 3300034816 | Bacteria | 892 |
| 313 | Ga0373948_0100055 | 3300034817 | Bacteria | 682 |
| 314 | Ga0373958_0028645 | 3300034819 | Bacteria | 1079 |
| 315 | Ga0373959_0040166 | 3300034820 | Bacteria | 979 |
| 316 | Ga0373949_0005972 | 3300035090 | Bacteria | 2704 |
| 317 | Ga0373951_0006144 | 3300035091 | Bacteria | 2757 |
| 318 | Ga0373960_0015681 | 3300035121 | Bacteria | 1938 |
| 319 | Ga0316574_0015612 | 3300035398 | Bacteria | 4408 |
| 320 | Ga0316574_0070958 | 3300035398 | Bacteria | 2199 |
| 321 | Ga0316574_0269787 | 3300035398 | Bacteria | 1085 |
| 322 | Ga0316574_0279312 | 3300035398 | Bacteria | 1064 |
| 323 | Ga0316574_0313237 | 3300035398 | Bacteria | 997 |
| 324 | Ga0316574_0324412 | 3300035398 | Bacteria | 977 |
| 325 | Ga0316574_0464367 | 3300035398 | Bacteria | 792 |
| 326 | Ga0316574_0508626 | 3300035398 | Bacteria | 750 |
| 327 | Ga0316574_0587098 | 3300035398 | Bacteria | 689 |
| 328 | Ga0316574_0870927 | 3300035398 | Unclassified | 546 |
| 329 | Ga0373931_0262611 | 3300035691 | Unclassified | 1054 |
| 330 | Ga0373931_0352674 | 3300035691 | Bacteria | 921 |
| 331 | Ga0373937_0281135 | 3300036401 | Bacteria | 1572 |
| 332 | Ga0316582_0020796 | 3300036647 | Bacteria | 3866 |
| 333 | Ga0316582_0042852 | 3300036647 | Bacteria | 2837 |
| 334 | Ga0316582_0112500 | 3300036647 | Bacteria | 1814 |
| 335 | Ga0316582_0141652 | 3300036647 | Bacteria | 1621 |
| 336 | Ga0316582_0203050 | 3300036647 | Bacteria | 1352 |
| 337 | Ga0316582_0266253 | 3300036647 | Bacteria | 1175 |
| 338 | Ga0316582_0594890 | 3300036647 | Bacteria | 761 |
| 339 | Ga0316582_0932133 | 3300036647 | Bacteria | 594 |
| 340 | Ga0316584_0004497 | 3300036712 | Bacteria | 9230 |
| 341 | Ga0316584_0009304 | 3300036712 | Bacteria | 6815 |
| 342 | Ga0316584_0009994 | 3300036712 | Bacteria | 6612 |
| 343 | Ga0316584_0014968 | 3300036712 | Bacteria | 5539 |
| 344 | Ga0316584_0020077 | 3300036712 | Bacteria | 4839 |
| 345 | Ga0316584_0030384 | 3300036712 | Bacteria | 3990 |
| 346 | Ga0316584_0048007 | 3300036712 | Bacteria | 3189 |
| 347 | Ga0316584_0061957 | 3300036712 | Bacteria | 2802 |
| 348 | Ga0316584_0066820 | 3300036712 | Bacteria | 2694 |
| 349 | Ga0316584_0075823 | 3300036712 | Bacteria | 2520 |
| 350 | Ga0316584_0182628 | 3300036712 | Bacteria | 1553 |
| 351 | Ga0316584_0329937 | 3300036712 | Bacteria | 1099 |
| 352 | Ga0316581_0038722 | 3300037588 | Bacteria | 1450 |
| 353 | Ga0316581_0068440 | 3300037588 | Bacteria | 1090 |
| 354 | Ga0439436_0000830 | 3300041404 | Bacteria | 8413 |
| 355 | Ga0439438_004091 | 3300041405 | Bacteria | 5704 |
| 356 | Ga0439447_013306 | 3300041407 | Bacteria | 2338 |
| 357 | Ga0439466_0002812 | 3300041411 | Bacteria | 6816 |
| 358 | Ga0439466_0005862 | 3300041411 | Bacteria | 4680 |
| 359 | Ga0451795_0567030 | 3300041456 | Bacteria | 698 |
| 360 | Ga0451802_0735241 | 3300041460 | Bacteria | 672 |
| 361 | Ga0451807_0147622 | 3300041486 | Bacteria | 510 |
| 362 | Ga0439431_0013990 | 3300041997 | Bacteria | 1856 |
| 363 | Ga0439431_0030818 | 3300041997 | Bacteria | 1330 |
| 364 | Ga0439448_0006423 | 3300042005 | Bacteria | 3380 |
| 365 | Ga0439432_000779 | 3300042006 | Bacteria | 11955 |
| 366 | Ga0439456_032414 | 3300042013 | Bacteria | 1122 |
| 367 | Ga0450911_000002 | 3300042115 | Bacteria | 277703 |
| 368 | Ga0450913_002648 | 3300042117 | Bacteria | 1117 |
| 369 | Ga0450914_051973 | 3300042118 | Bacteria | 541 |
| 370 | Ga0450917_002513 | 3300042120 | Bacteria | 1312 |
| 371 | Ga0450923_000487 | 3300042125 | Bacteria | 4372 |
| 372 | Ga0450892_017721 | 3300042130 | Bacteria | 679 |
| 373 | Ga0450904_000036 | 3300042139 | Bacteria | 30421 |
| 374 | Ga0450889_006048 | 3300042144 | Bacteria | 1212 |
| 375 | Ga0439446_0007073 | 3300042156 | Bacteria | 2940 |
| 376 | Ga0439446_0014280 | 3300042156 | Bacteria | 2190 |
| 377 | Ga0439446_0223398 | 3300042156 | Bacteria | 642 |
| 378 | Ga0450909_083248 | 3300042185 | Bacteria | 519 |
| 379 | Ga0439459_0027725 | 3300042438 | Bacteria | 1132 |
| 380 | Ga0439464_0003612 | 3300042439 | Bacteria | 3920 |
| 381 | Ga0450893_0001318 | 3300042532 | Bacteria | 3766 |
| 382 | Ga0450893_0013164 | 3300042532 | Bacteria | 1377 |
| 383 | Ga0451577_0017761 | 3300042876 | Bacteria | 6563 |
| 384 | Ga0451577_0018905 | 3300042876 | Bacteria | 6343 |
| 385 | Ga0451577_0020696 | 3300042876 | Bacteria | 6033 |
| 386 | Ga0451577_0029460 | 3300042876 | Bacteria | 4962 |
| 387 | Ga0451577_0220398 | 3300042876 | Bacteria | 1715 |
| 388 | Ga0451577_0775379 | 3300042876 | Bacteria | 867 |
| 389 | Ga0451577_1295757 | 3300042876 | Bacteria | 648 |
| 390 | Ga0453684_0329672 | 3300044712 | Bacteria | 1726 |
| 391 | Ga0453684_0375996 | 3300044712 | Bacteria | 1596 |
| 392 | Ga0453684_0991192 | 3300044712 | Bacteria | 894 |
| 393 | Ga0453684_1047869 | 3300044712 | Bacteria | 865 |
| 394 | Ga0453684_1670318 | 3300044712 | Bacteria | 651 |
| 395 | Ga0453684_1753045 | 3300044712 | Bacteria | 633 |
| 396 | Ga0453684_1973335 | 3300044712 | Bacteria | 588 |
| 397 | Ga0466971_0700988 | 3300044719 | Bacteria | 509 |
| 398 | Ga0466957_1038814 | 3300044842 | Bacteria | 589 |
| 399 | Ga0451576_0002027 | 3300045051 | Bacteria | 31971 |
| 400 | Ga0451576_0009363 | 3300045051 | Bacteria | 11360 |
| 401 | Ga0451576_0035370 | 3300045051 | Bacteria | 5300 |
| 402 | Ga0451576_0487669 | 3300045051 | Bacteria | 1295 |
| 403 | Ga0451576_0620389 | 3300045051 | Bacteria | 1136 |
| 404 | Ga0451576_0792212 | 3300045051 | Bacteria | 995 |
| 405 | Ga0451576_1921852 | 3300045051 | Bacteria | 610 |
| 406 | Ga0466967_0021359 | 3300045976 | Bacteria | 5256 |
| 407 | Ga0496101_0101511 | 3300048904 | Bacteria | 2154 |
| 408 | Ga0496101_0951329 | 3300048904 | Bacteria | 676 |
| 409 | Ga0496102_0123913 | 3300048905 | Bacteria | 2415 |
| 410 | Ga0496104_0081017 | 3300048907 | Bacteria | 3095 |
| 411 | Ga0496106_0379840 | 3300048909 | Bacteria | 1135 |
| 412 | Ga0496107_0174147 | 3300048910 | Bacteria | 1597 |
| 413 | Ga0496108_1431538 | 3300048911 | Bacteria | 577 |
| 414 | Ga0496109_0273765 | 3300048912 | Bacteria | 1591 |
| 415 | Ga0496109_1051622 | 3300048912 | Bacteria | 751 |
| 416 | Ga0496110_0091463 | 3300048913 | Bacteria | 2722 |
| 417 | Ga0496113_1079772 | 3300048916 | Bacteria | 630 |
| 418 | Ga0496114_0124939 | 3300048917 | Bacteria | 2217 |
| 419 | Ga0496117_0198713 | 3300048920 | Bacteria | 1135 |
| 420 | Ga0501031_0128128 | 3300049568 | Bacteria | 1658 |
| 421 | Ga0501031_0593471 | 3300049568 | Bacteria | 713 |
| 422 | Ga0501032_0000863 | 3300049569 | Bacteria | 24630 |
| 423 | Ga0501032_0007624 | 3300049569 | Bacteria | 7891 |
| 424 | Ga0501034_0051254 | 3300049571 | Bacteria | 4161 |
| 425 | Ga0501034_0244724 | 3300049571 | Bacteria | 1739 |
| 426 | Ga0501034_0341520 | 3300049571 | Bacteria | 1427 |
| 427 | Ga0501034_0438614 | 3300049571 | Bacteria | 1225 |
| 428 | Ga0501034_0889253 | 3300049571 | Bacteria | 779 |
| 429 | Ga0501038_0057638 | 3300049574 | Bacteria | 3334 |
| 430 | Ga0501038_0860503 | 3300049574 | Bacteria | 671 |
| 431 | Ga0501039_0030902 | 3300049575 | Bacteria | 4129 |
| 432 | Ga0501039_0582805 | 3300049575 | Bacteria | 877 |
| 433 | Ga0501039_0851211 | 3300049575 | Bacteria | 711 |
| 434 | Ga0501040_0452684 | 3300049576 | Bacteria | 924 |
| 435 | Ga0501041_1117660 | 3300049577 | Bacteria | 508 |
| 436 | Ga0501043_0689809 | 3300049579 | Bacteria | 747 |
| 437 | Ga0501047_0208371 | 3300049581 | Bacteria | 1814 |
| 438 | Ga0501047_0275445 | 3300049581 | Bacteria | 1528 |
| 439 | Ga0501048_0755510 | 3300049582 | Bacteria | 698 |
| 440 | Ga0501067_0000127 | 3300049583 | Bacteria | 41508 |
| 441 | Ga0501068_0009147 | 3300049584 | Bacteria | 5532 |
| 442 | Ga0501073_0000006 | 3300049589 | Bacteria | 228761 |
| 443 | Ga0501075_0395989 | 3300049591 | Bacteria | 1053 |
| 444 | Ga0501076_1450874 | 3300049592 | Bacteria | 564 |
| 445 | Ga0501225_0063452 | 3300049705 | Bacteria | 1042 |
| 446 | Ga0501080_0002191 | 3300049742 | Bacteria | 16972 |
| 447 | Ga0501080_0737550 | 3300049742 | Bacteria | 867 |
| 448 | Ga0501080_1797873 | 3300049742 | Bacteria | 515 |
| 449 | Ga0501083_0954645 | 3300049744 | Bacteria | 558 |
| 450 | Ga0501035_0358368 | 3300049822 | Bacteria | 1219 |
| 451 | Ga0501044_0015081 | 3300049823 | Bacteria | 8326 |
| 452 | Ga0501045_0888142 | 3300049824 | Bacteria | 655 |
| 453 | Ga0501045_0975159 | 3300049824 | Bacteria | 622 |
| 454 | Ga0501226_000007 | 3300049853 | Bacteria | 227827 |
| 455 | nmdc:mga0qj67_1574449_c1 | 3300050509 | Bacteria | 504 |
| 456 | nmdc:mga06r32_345585_c1 | 3300050510 | Bacteria | 1472 |
| 457 | nmdc:mga0a205_80220_c1 | 3300050515 | Bacteria | 3154 |
| 458 | Ga0501084_0642191 | 3300054114 | Bacteria | 896 |
| 459 | Ga0501084_1241533 | 3300054114 | Bacteria | 625 |
| 460 | Ga0590074_012583 | 3300059423 | Bacteria | 1424 |
| 461 | Ga0501082_0148347 | 3300060353 | Bacteria | 2037 |
| 462 | Ga0501082_1625332 | 3300060353 | Bacteria | 564 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300002239 | JGI24034J26672_10068129 | JGI24034J26672_100681292 | 89 |
| 2 | 3300002244 | JGI24742J22300_10118869 | JGI24742J22300_101188692 | 89 |
| 3 | 3300003405 | JGI26132J50249_104774 | JGI26132J50249_1047741 | 89 |
| 4 | 3300003503 | JGI26141J51220_1011613 | JGI26141J51220_10116132 | 89 |
| 5 | 3300005289 | Ga0065704_10164877 | Ga0065704_101648772 | 89 |
| 6 | 3300005328 | Ga0070676_10000774 | Ga0070676_100007746 | 89 |
| 7 | 3300005328 | Ga0070676_10001175 | Ga0070676_1000117512 | 89 |
| 8 | 3300005329 | Ga0070683_100054794 | Ga0070683_1000547942 | 89 |
| 9 | 3300005330 | Ga0070690_100046925 | Ga0070690_1000469254 | 89 |
| 10 | 3300005331 | Ga0070670_100026878 | Ga0070670_1000268783 | 89 |
| 11 | 3300005331 | Ga0070670_100036317 | Ga0070670_1000363175 | 89 |
| 12 | 3300005333 | Ga0070677_10444375 | Ga0070677_104443752 | 89 |
| 13 | 3300005334 | Ga0068869_100003142 | Ga0068869_1000031427 | 89 |
| 14 | 3300005334 | Ga0068869_100004518 | Ga0068869_1000045188 | 89 |
| 15 | 3300005335 | Ga0070666_10000716 | Ga0070666_100007161 | 89 |
| 16 | 3300005336 | Ga0070680_100030043 | Ga0070680_1000300433 | 89 |
| 17 | 3300005337 | Ga0070682_100006507 | Ga0070682_1000065075 | 89 |
| 18 | 3300005338 | Ga0068868_100015154 | Ga0068868_1000151545 | 89 |
| 19 | 3300005338 | Ga0068868_100076397 | Ga0068868_1000763974 | 89 |
| 20 | 3300005339 | Ga0070660_100003613 | Ga0070660_1000036137 | 89 |
| 21 | 3300005340 | Ga0070689_100107834 | Ga0070689_1001078343 | 89 |
| 22 | 3300005340 | Ga0070689_100506128 | Ga0070689_1005061283 | 89 |
| 23 | 3300005341 | Ga0070691_10083633 | Ga0070691_100836332 | 89 |
| 24 | 3300005344 | Ga0070661_100003491 | Ga0070661_1000034917 | 89 |
| 25 | 3300005347 | Ga0070668_100001323 | Ga0070668_10000132310 | 89 |
| 26 | 3300005353 | Ga0070669_100001499 | Ga0070669_1000014997 | 89 |
| 27 | 3300005353 | Ga0070669_100009363 | Ga0070669_1000093637 | 89 |
| 28 | 3300005354 | Ga0070675_100003394 | Ga0070675_1000033947 | 89 |
| 29 | 3300005354 | Ga0070675_100125437 | Ga0070675_1001254373 | 89 |
| 30 | 3300005355 | Ga0070671_100008745 | Ga0070671_1000087453 | 89 |
| 31 | 3300005355 | Ga0070671_100171937 | Ga0070671_1001719371 | 89 |
| 32 | 3300005356 | Ga0070674_100024859 | Ga0070674_1000248595 | 89 |
| 33 | 3300005364 | Ga0070673_100001645 | Ga0070673_1000016458 | 89 |
| 34 | 3300005365 | Ga0070688_100024809 | Ga0070688_1000248093 | 89 |
| 35 | 3300005365 | Ga0070688_101017671 | Ga0070688_1010176712 | 89 |
| 36 | 3300005366 | Ga0070659_100011644 | Ga0070659_1000116445 | 89 |
| 37 | 3300005367 | Ga0070667_100001885 | Ga0070667_1000018858 | 89 |
| 38 | 3300005367 | Ga0070667_100047541 | Ga0070667_1000475414 | 89 |
| 39 | 3300005406 | Ga0070703_10008355 | Ga0070703_100083552 | 89 |
| 40 | 3300005438 | Ga0070701_10019598 | Ga0070701_100195983 | 89 |
| 41 | 3300005440 | Ga0070705_100015847 | Ga0070705_1000158475 | 89 |
| 42 | 3300005441 | Ga0070700_100120228 | Ga0070700_1001202283 | 89 |
| 43 | 3300005444 | Ga0070694_100078319 | Ga0070694_1000783192 | 89 |
| 44 | 3300005445 | Ga0070708_100000735 | Ga0070708_10000073524 | 89 |
| 45 | 3300005445 | Ga0070708_100591724 | Ga0070708_1005917242 | 89 |
| 46 | 3300005455 | Ga0070663_100018630 | Ga0070663_1000186303 | 89 |
| 47 | 3300005456 | Ga0070678_100001250 | Ga0070678_1000012506 | 89 |
| 48 | 3300005457 | Ga0070662_101372432 | Ga0070662_1013724322 | 89 |
| 49 | 3300005458 | Ga0070681_10025228 | Ga0070681_100252284 | 89 |
| 50 | 3300005458 | Ga0070681_10590122 | Ga0070681_105901221 | 89 |
| 51 | 3300005459 | Ga0068867_100013240 | Ga0068867_1000132403 | 89 |
| 52 | 3300005466 | Ga0070685_10053447 | Ga0070685_100534473 | 89 |
| 53 | 3300005468 | Ga0070707_101865562 | Ga0070707_1018655621 | 89 |
| 54 | 3300005530 | Ga0070679_100001879 | Ga0070679_10000187917 | 89 |
| 55 | 3300005539 | Ga0068853_100011113 | Ga0068853_1000111132 | 89 |
| 56 | 3300005539 | Ga0068853_100315486 | Ga0068853_1003154862 | 89 |
| 57 | 3300005539 | Ga0068853_100341055 | Ga0068853_1003410553 | 89 |
| 58 | 3300005543 | Ga0070672_100001970 | Ga0070672_1000019703 | 89 |
| 59 | 3300005543 | Ga0070672_100248023 | Ga0070672_1002480232 | 89 |
| 60 | 3300005544 | Ga0070686_101562126 | Ga0070686_1015621261 | 89 |
| 61 | 3300005545 | Ga0070695_100012223 | Ga0070695_1000122232 | 89 |
| 62 | 3300005546 | Ga0070696_100018398 | Ga0070696_1000183982 | 89 |
| 63 | 3300005547 | Ga0070693_100202346 | Ga0070693_1002023462 | 89 |
| 64 | 3300005548 | Ga0070665_100009908 | Ga0070665_1000099083 | 89 |
| 65 | 3300005549 | Ga0070704_100001689 | Ga0070704_1000016895 | 89 |
| 66 | 3300005549 | Ga0070704_101194675 | Ga0070704_1011946752 | 89 |
| 67 | 3300005563 | Ga0068855_100011388 | Ga0068855_1000113887 | 89 |
| 68 | 3300005564 | Ga0070664_100036940 | Ga0070664_1000369405 | 89 |
| 69 | 3300005577 | Ga0068857_100197024 | Ga0068857_1001970243 | 89 |
| 70 | 3300005578 | Ga0068854_100002332 | Ga0068854_1000023323 | 89 |
| 71 | 3300005614 | Ga0068856_100154544 | Ga0068856_1001545442 | 89 |
| 72 | 3300005615 | Ga0070702_100236596 | Ga0070702_1002365963 | 89 |
| 73 | 3300005616 | Ga0068852_100436931 | Ga0068852_1004369313 | 89 |
| 74 | 3300005617 | Ga0068859_100006568 | Ga0068859_1000065685 | 89 |
| 75 | 3300005617 | Ga0068859_100007175 | Ga0068859_1000071757 | 89 |
| 76 | 3300005618 | Ga0068864_100006114 | Ga0068864_1000061147 | 89 |
| 77 | 3300005618 | Ga0068864_100025840 | Ga0068864_1000258405 | 89 |
| 78 | 3300005718 | Ga0068866_10566168 | Ga0068866_105661682 | 89 |
| 79 | 3300005718 | Ga0068866_10710406 | Ga0068866_107104062 | 89 |
| 80 | 3300005719 | Ga0068861_100006024 | Ga0068861_1000060245 | 89 |
| 81 | 3300005719 | Ga0068861_100025326 | Ga0068861_1000253262 | 89 |
| 82 | 3300005840 | Ga0068870_10003489 | Ga0068870_100034895 | 89 |
| 83 | 3300005840 | Ga0068870_10254225 | Ga0068870_102542252 | 89 |
| 84 | 3300005841 | Ga0068863_100002793 | Ga0068863_10000279312 | 89 |
| 85 | 3300005841 | Ga0068863_100029243 | Ga0068863_1000292434 | 89 |
| 86 | 3300005842 | Ga0068858_100005140 | Ga0068858_1000051405 | 89 |
| 87 | 3300005842 | Ga0068858_100016786 | Ga0068858_1000167865 | 89 |
| 88 | 3300005843 | Ga0068860_100005023 | Ga0068860_1000050236 | 89 |
| 89 | 3300005843 | Ga0068860_100007534 | Ga0068860_1000075345 | 89 |
| 90 | 3300005844 | Ga0068862_100009111 | Ga0068862_1000091117 | 89 |
| 91 | 3300006173 | Ga0070716_100895512 | Ga0070716_1008955122 | 89 |
| 92 | 3300006237 | Ga0097621_100001779 | Ga0097621_1000017799 | 89 |
| 93 | 3300006358 | Ga0068871_100003595 | Ga0068871_1000035955 | 89 |
| 94 | 3300006844 | Ga0075428_100478377 | Ga0075428_1004783772 | 89 |
| 95 | 3300006847 | Ga0075431_100463165 | Ga0075431_1004631653 | 89 |
| 96 | 3300006847 | Ga0075431_100650680 | Ga0075431_1006506802 | 89 |
| 97 | 3300006852 | Ga0075433_10007076 | Ga0075433_100070767 | 89 |
| 98 | 3300006871 | Ga0075434_100041765 | Ga0075434_1000417655 | 89 |
| 99 | 3300006880 | Ga0075429_100425903 | Ga0075429_1004259032 | 89 |
| 100 | 3300006881 | Ga0068865_100001873 | Ga0068865_1000018732 | 89 |
| 101 | 3300006931 | Ga0097620_100006568 | Ga0097620_1000065685 | 89 |
| 102 | 3300006931 | Ga0097620_100007175 | Ga0097620_1000071757 | 89 |
| 103 | 3300009036 | Ga0105244_10008784 | Ga0105244_100087845 | 89 |
| 104 | 3300009092 | Ga0105250_10551260 | Ga0105250_105512602 | 89 |
| 105 | 3300009093 | Ga0105240_10260136 | Ga0105240_102601363 | 89 |
| 106 | 3300009098 | Ga0105245_10041799 | Ga0105245_100417993 | 89 |
| 107 | 3300009147 | Ga0114129_11180619 | Ga0114129_111806191 | 89 |
| 108 | 3300009148 | Ga0105243_10498303 | Ga0105243_104983032 | 89 |
| 109 | 3300009148 | Ga0105243_11213910 | Ga0105243_112139102 | 89 |
| 110 | 3300009174 | Ga0105241_10009352 | Ga0105241_100093527 | 89 |
| 111 | 3300009177 | Ga0105248_10018359 | Ga0105248_100183596 | 89 |
| 112 | 3300009545 | Ga0105237_10052739 | Ga0105237_100527393 | 89 |
| 113 | 3300009553 | Ga0105249_10459918 | Ga0105249_104599182 | 89 |
| 114 | 3300011119 | Ga0105246_12099753 | Ga0105246_120997532 | 89 |
| 115 | 3300013100 | Ga0157373_10020097 | Ga0157373_100200972 | 89 |
| 116 | 3300013100 | Ga0157373_10069426 | Ga0157373_100694263 | 89 |
| 117 | 3300013100 | Ga0157373_10372844 | Ga0157373_103728443 | 89 |
| 118 | 3300013102 | Ga0157371_10011030 | Ga0157371_100110303 | 89 |
| 119 | 3300013102 | Ga0157371_10040071 | Ga0157371_100400712 | 89 |
| 120 | 3300013102 | Ga0157371_10079814 | Ga0157371_100798142 | 89 |
| 121 | 3300013102 | Ga0157371_10338413 | Ga0157371_103384132 | 89 |
| 122 | 3300013104 | Ga0157370_10127411 | Ga0157370_101274114 | 89 |
| 123 | 3300013105 | Ga0157369_10001875 | Ga0157369_1000187518 | 89 |
| 124 | 3300013105 | Ga0157369_10005244 | Ga0157369_1000524413 | 89 |
| 125 | 3300013296 | Ga0157374_10003539 | Ga0157374_100035394 | 89 |
| 126 | 3300013297 | Ga0157378_10056099 | Ga0157378_100560993 | 89 |
| 127 | 3300013297 | Ga0157378_10244106 | Ga0157378_102441063 | 89 |
| 128 | 3300013306 | Ga0163162_10054335 | Ga0163162_100543353 | 89 |
| 129 | 3300013307 | Ga0157372_10003171 | Ga0157372_100031715 | 89 |
| 130 | 3300013307 | Ga0157372_10212337 | Ga0157372_102123371 | 89 |
| 131 | 3300013307 | Ga0157372_10389706 | Ga0157372_103897061 | 89 |
| 132 | 3300013308 | Ga0157375_10006411 | Ga0157375_100064115 | 89 |
| 133 | 3300014325 | Ga0163163_10096096 | Ga0163163_100960963 | 89 |
| 134 | 3300014325 | Ga0163163_10202503 | Ga0163163_102025033 | 89 |
| 135 | 3300014326 | Ga0157380_10243505 | Ga0157380_102435052 | 89 |
| 136 | 3300014326 | Ga0157380_10734070 | Ga0157380_107340702 | 89 |
| 137 | 3300014745 | Ga0157377_10128870 | Ga0157377_101288702 | 89 |
| 138 | 3300014968 | Ga0157379_10004073 | Ga0157379_1000407311 | 89 |
| 139 | 3300014969 | Ga0157376_10003562 | Ga0157376_100035625 | 89 |
| 140 | 3300015261 | Ga0182006_1142703 | Ga0182006_11427032 | 89 |
| 141 | 3300015262 | Ga0182007_10008129 | Ga0182007_100081295 | 89 |
| 142 | 3300017792 | Ga0163161_10223478 | Ga0163161_102234783 | 89 |
| 143 | 3300025315 | Ga0207697_10028171 | Ga0207697_100281712 | 89 |
| 144 | 3300025315 | Ga0207697_10240665 | Ga0207697_102406652 | 89 |
| 145 | 3300025735 | Ga0207713_1005333 | Ga0207713_10053338 | 89 |
| 146 | 3300025885 | Ga0207653_10002179 | Ga0207653_100021794 | 89 |
| 147 | 3300025899 | Ga0207642_10906431 | Ga0207642_109064312 | 89 |
| 148 | 3300025901 | Ga0207688_10009535 | Ga0207688_100095354 | 89 |
| 149 | 3300025903 | Ga0207680_10044818 | Ga0207680_100448184 | 89 |
| 150 | 3300025903 | Ga0207680_10395679 | Ga0207680_103956793 | 89 |
| 151 | 3300025904 | Ga0207647_10028049 | Ga0207647_100280495 | 89 |
| 152 | 3300025907 | Ga0207645_10000812 | Ga0207645_1000081219 | 89 |
| 153 | 3300025907 | Ga0207645_10002937 | Ga0207645_1000293712 | 89 |
| 154 | 3300025908 | Ga0207643_10000722 | Ga0207643_100007226 | 89 |
| 155 | 3300025911 | Ga0207654_10061354 | Ga0207654_100613543 | 89 |
| 156 | 3300025912 | Ga0207707_10002355 | Ga0207707_100023556 | 89 |
| 157 | 3300025913 | Ga0207695_10204409 | Ga0207695_102044093 | 89 |
| 158 | 3300025917 | Ga0207660_10014617 | Ga0207660_100146171 | 89 |
| 159 | 3300025918 | Ga0207662_10059424 | Ga0207662_100594242 | 89 |
| 160 | 3300025919 | Ga0207657_10000385 | Ga0207657_1000038537 | 89 |
| 161 | 3300025920 | Ga0207649_10015334 | Ga0207649_100153341 | 89 |
| 162 | 3300025921 | Ga0207652_10016056 | Ga0207652_100160565 | 89 |
| 163 | 3300025922 | Ga0207646_11749377 | Ga0207646_117493772 | 89 |
| 164 | 3300025923 | Ga0207681_10002868 | Ga0207681_100028687 | 89 |
| 165 | 3300025925 | Ga0207650_10034483 | Ga0207650_100344832 | 89 |
| 166 | 3300025925 | Ga0207650_10072929 | Ga0207650_100729293 | 89 |
| 167 | 3300025926 | Ga0207659_10002225 | Ga0207659_100022256 | 89 |
| 168 | 3300025926 | Ga0207659_10452460 | Ga0207659_104524602 | 89 |
| 169 | 3300025927 | Ga0207687_11282719 | Ga0207687_112827192 | 89 |
| 170 | 3300025931 | Ga0207644_10006005 | Ga0207644_100060055 | 89 |
| 171 | 3300025931 | Ga0207644_10525031 | Ga0207644_105250313 | 89 |
| 172 | 3300025933 | Ga0207706_10003911 | Ga0207706_100039117 | 89 |
| 173 | 3300025933 | Ga0207706_10506718 | Ga0207706_105067182 | 89 |
| 174 | 3300025935 | Ga0207709_10743267 | Ga0207709_107432672 | 89 |
| 175 | 3300025935 | Ga0207709_11053032 | Ga0207709_110530322 | 89 |
| 176 | 3300025936 | Ga0207670_10084284 | Ga0207670_100842843 | 89 |
| 177 | 3300025936 | Ga0207670_10622446 | Ga0207670_106224462 | 89 |
| 178 | 3300025937 | Ga0207669_10014819 | Ga0207669_100148193 | 89 |
| 179 | 3300025938 | Ga0207704_10003782 | Ga0207704_100037822 | 89 |
| 180 | 3300025940 | Ga0207691_10000041 | Ga0207691_1000004118 | 89 |
| 181 | 3300025940 | Ga0207691_10260034 | Ga0207691_102600342 | 89 |
| 182 | 3300025941 | Ga0207711_10054791 | Ga0207711_100547913 | 89 |
| 183 | 3300025942 | Ga0207689_10000204 | Ga0207689_1000020447 | 89 |
| 184 | 3300025942 | Ga0207689_10030654 | Ga0207689_100306544 | 89 |
| 185 | 3300025944 | Ga0207661_10411109 | Ga0207661_104111092 | 89 |
| 186 | 3300025945 | Ga0207679_10035706 | Ga0207679_100357063 | 89 |
| 187 | 3300025949 | Ga0207667_10007006 | Ga0207667_100070066 | 89 |
| 188 | 3300025960 | Ga0207651_10029214 | Ga0207651_100292143 | 89 |
| 189 | 3300025961 | Ga0207712_10291253 | Ga0207712_102912533 | 89 |
| 190 | 3300025972 | Ga0207668_10010094 | Ga0207668_100100943 | 89 |
| 191 | 3300025972 | Ga0207668_10821323 | Ga0207668_108213232 | 89 |
| 192 | 3300025981 | Ga0207640_10066771 | Ga0207640_100667713 | 89 |
| 193 | 3300025986 | Ga0207658_10004908 | Ga0207658_100049086 | 89 |
| 194 | 3300025986 | Ga0207658_10263507 | Ga0207658_102635072 | 89 |
| 195 | 3300026023 | Ga0207677_10006748 | Ga0207677_100067483 | 89 |
| 196 | 3300026023 | Ga0207677_10056106 | Ga0207677_100561064 | 89 |
| 197 | 3300026035 | Ga0207703_10004130 | Ga0207703_100041305 | 89 |
| 198 | 3300026041 | Ga0207639_10011721 | Ga0207639_100117213 | 89 |
| 199 | 3300026041 | Ga0207639_10372952 | Ga0207639_103729521 | 89 |
| 200 | 3300026067 | Ga0207678_10041350 | Ga0207678_100413503 | 89 |
| 201 | 3300026075 | Ga0207708_10236409 | Ga0207708_102364092 | 89 |
| 202 | 3300026078 | Ga0207702_10033285 | Ga0207702_100332855 | 89 |
| 203 | 3300026088 | Ga0207641_10001249 | Ga0207641_100012499 | 89 |
| 204 | 3300026089 | Ga0207648_10001461 | Ga0207648_100014613 | 89 |
| 205 | 3300026089 | Ga0207648_10004390 | Ga0207648_100043909 | 89 |
| 206 | 3300026095 | Ga0207676_10005257 | Ga0207676_100052574 | 89 |
| 207 | 3300026095 | Ga0207676_10017371 | Ga0207676_100173713 | 89 |
| 208 | 3300026116 | Ga0207674_10001950 | Ga0207674_1000195021 | 89 |
| 209 | 3300026118 | Ga0207675_100005135 | Ga0207675_1000051358 | 89 |
| 210 | 3300026118 | Ga0207675_100008371 | Ga0207675_1000083717 | 89 |
| 211 | 3300026121 | Ga0207683_10000011 | Ga0207683_1000001199 | 89 |
| 212 | 3300027312 | Ga0209371_1000135 | Ga0209371_100013574 | 89 |
| 213 | 3300027360 | Ga0209969_1009261 | Ga0209969_10092613 | 89 |
| 214 | 3300027378 | Ga0209981_1046028 | Ga0209981_10460282 | 89 |
| 215 | 3300027395 | Ga0209996_1000510 | Ga0209996_10005105 | 89 |
| 216 | 3300027424 | Ga0209984_1001665 | Ga0209984_10016653 | 89 |
| 217 | 3300027462 | Ga0210000_1053272 | Ga0210000_10532722 | 89 |
| 218 | 3300027471 | Ga0209995_1053270 | Ga0209995_10532702 | 89 |
| 219 | 3300027526 | Ga0209968_1067782 | Ga0209968_10677822 | 89 |
| 220 | 3300027543 | Ga0209999_1034324 | Ga0209999_10343242 | 89 |
| 221 | 3300027552 | Ga0209982_1090629 | Ga0209982_10906292 | 89 |
| 222 | 3300027614 | Ga0209970_1064884 | Ga0209970_10648842 | 89 |
| 223 | 3300027617 | Ga0210002_1006419 | Ga0210002_10064192 | 89 |
| 224 | 3300027665 | Ga0209983_1002354 | Ga0209983_10023545 | 89 |
| 225 | 3300027682 | Ga0209971_1004302 | Ga0209971_10043023 | 89 |
| 226 | 3300027682 | Ga0209971_1192739 | Ga0209971_11927392 | 89 |
| 227 | 3300027876 | Ga0209974_10016365 | Ga0209974_100163653 | 89 |
| 228 | 3300028379 | Ga0268266_10009550 | Ga0268266_100095508 | 89 |
| 229 | 3300028380 | Ga0268265_10133019 | Ga0268265_101330192 | 89 |
| 230 | 3300028381 | Ga0268264_10011762 | Ga0268264_100117622 | 89 |
| 231 | 3300028381 | Ga0268264_10037926 | Ga0268264_100379265 | 89 |
| 232 | 3300030500 | Ga0268256_1000148 | Ga0268256_100014874 | 89 |
| 233 | 3300031548 | Ga0307408_100000005 | Ga0307408_10000000534 | 89 |
| 234 | 3300031548 | Ga0307408_100954931 | Ga0307408_1009549312 | 89 |
| 235 | 3300031691 | Ga0316579_10006926 | Ga0316579_100069265 | 89 |
| 236 | 3300031691 | Ga0316579_10182880 | Ga0316579_101828802 | 89 |
| 237 | 3300031691 | Ga0316579_10221246 | Ga0316579_102212462 | 89 |
| 238 | 3300031691 | Ga0316579_10485042 | Ga0316579_104850422 | 89 |
| 239 | 3300031727 | Ga0316576_10000526 | Ga0316576_100005263 | 89 |
| 240 | 3300031727 | Ga0316576_10025645 | Ga0316576_100256453 | 89 |
| 241 | 3300031727 | Ga0316576_10052640 | Ga0316576_100526403 | 89 |
| 242 | 3300031727 | Ga0316576_10054830 | Ga0316576_100548302 | 89 |
| 243 | 3300031727 | Ga0316576_10077273 | Ga0316576_100772734 | 89 |
| 244 | 3300031727 | Ga0316576_10130658 | Ga0316576_101306582 | 89 |
| 245 | 3300031727 | Ga0316576_10145946 | Ga0316576_101459463 | 89 |
| 246 | 3300031727 | Ga0316576_10164301 | Ga0316576_101643012 | 89 |
| 247 | 3300031727 | Ga0316576_10261132 | Ga0316576_102611322 | 89 |
| 248 | 3300031727 | Ga0316576_10496834 | Ga0316576_104968342 | 89 |
| 249 | 3300031727 | Ga0316576_10804794 | Ga0316576_108047942 | 89 |
| 250 | 3300031727 | Ga0316576_10869668 | Ga0316576_108696682 | 89 |
| 251 | 3300031728 | Ga0316578_10007930 | Ga0316578_100079303 | 89 |
| 252 | 3300031728 | Ga0316578_10008122 | Ga0316578_100081223 | 89 |
| 253 | 3300031728 | Ga0316578_10012798 | Ga0316578_100127984 | 89 |
| 254 | 3300031728 | Ga0316578_10029330 | Ga0316578_100293303 | 89 |
| 255 | 3300031728 | Ga0316578_10043372 | Ga0316578_100433723 | 89 |
| 256 | 3300031728 | Ga0316578_10047387 | Ga0316578_100473873 | 89 |
| 257 | 3300031728 | Ga0316578_10054639 | Ga0316578_100546392 | 89 |
| 258 | 3300031728 | Ga0316578_10066182 | Ga0316578_100661823 | 89 |
| 259 | 3300031728 | Ga0316578_10130558 | Ga0316578_101305583 | 89 |
| 260 | 3300031728 | Ga0316578_10139890 | Ga0316578_101398902 | 89 |
| 261 | 3300031728 | Ga0316578_10156880 | Ga0316578_101568801 | 89 |
| 262 | 3300031728 | Ga0316578_10194416 | Ga0316578_101944162 | 89 |
| 263 | 3300031728 | Ga0316578_10205360 | Ga0316578_102053602 | 89 |
| 264 | 3300031728 | Ga0316578_10230852 | Ga0316578_102308522 | 89 |
| 265 | 3300031728 | Ga0316578_10276289 | Ga0316578_102762892 | 89 |
| 266 | 3300031733 | Ga0316577_10015253 | Ga0316577_100152533 | 89 |
| 267 | 3300031733 | Ga0316577_10015859 | Ga0316577_100158595 | 89 |
| 268 | 3300031733 | Ga0316577_10023832 | Ga0316577_100238321 | 89 |
| 269 | 3300031733 | Ga0316577_10123391 | Ga0316577_101233912 | 89 |
| 270 | 3300031733 | Ga0316577_10311833 | Ga0316577_103118332 | 89 |
| 271 | 3300031733 | Ga0316577_10347275 | Ga0316577_103472752 | 89 |
| 272 | 3300031733 | Ga0316577_10397618 | Ga0316577_103976182 | 89 |
| 273 | 3300031733 | Ga0316577_10421352 | Ga0316577_104213522 | 89 |
| 274 | 3300031733 | Ga0316577_10655854 | Ga0316577_106558542 | 89 |
| 275 | 3300031733 | Ga0316577_10709813 | Ga0316577_107098132 | 89 |
| 276 | 3300031733 | Ga0316577_10724964 | Ga0316577_107249641 | 89 |
| 277 | 3300031901 | Ga0307406_10000700 | Ga0307406_100007006 | 89 |
| 278 | 3300031901 | Ga0307406_10601568 | Ga0307406_106015682 | 89 |
| 279 | 3300032133 | Ga0316583_10004764 | Ga0316583_100047643 | 89 |
| 280 | 3300032133 | Ga0316583_10060104 | Ga0316583_100601042 | 89 |
| 281 | 3300032133 | Ga0316583_10119462 | Ga0316583_101194622 | 89 |
| 282 | 3300032133 | Ga0316583_10296583 | Ga0316583_102965832 | 89 |
| 283 | 3300032137 | Ga0316585_10005021 | Ga0316585_100050213 | 89 |
| 284 | 3300032137 | Ga0316585_10065243 | Ga0316585_100652433 | 89 |
| 285 | 3300032137 | Ga0316585_10083287 | Ga0316585_100832872 | 89 |
| 286 | 3300032137 | Ga0316585_10093495 | Ga0316585_100934952 | 89 |
| 287 | 3300032137 | Ga0316585_10105099 | Ga0316585_101050992 | 89 |
| 288 | 3300032139 | Ga0316580_10004071 | Ga0316580_100040713 | 89 |
| 289 | 3300032139 | Ga0316580_10010047 | Ga0316580_100100473 | 89 |
| 290 | 3300032139 | Ga0316580_10013867 | Ga0316580_100138673 | 89 |
| 291 | 3300032139 | Ga0316580_10018053 | Ga0316580_100180533 | 89 |
| 292 | 3300032139 | Ga0316580_10022901 | Ga0316580_100229013 | 89 |
| 293 | 3300032139 | Ga0316580_10054900 | Ga0316580_100549002 | 89 |
| 294 | 3300032139 | Ga0316580_10060526 | Ga0316580_100605262 | 89 |
| 295 | 3300032139 | Ga0316580_10067492 | Ga0316580_100674921 | 89 |
| 296 | 3300032139 | Ga0316580_10092838 | Ga0316580_100928382 | 89 |
| 297 | 3300032139 | Ga0316580_10173072 | Ga0316580_101730722 | 89 |
| 298 | 3300032168 | Ga0316593_10019682 | Ga0316593_100196823 | 89 |
| 299 | 3300032168 | Ga0316593_10026378 | Ga0316593_100263782 | 89 |
| 300 | 3300032168 | Ga0316593_10061858 | Ga0316593_100618581 | 89 |
| 301 | 3300032168 | Ga0316593_10078007 | Ga0316593_100780072 | 89 |
| 302 | 3300033524 | Ga0316592_1004112 | Ga0316592_10041124 | 89 |
| 303 | 3300033524 | Ga0316592_1123290 | Ga0316592_11232902 | 89 |
| 304 | 3300033528 | Ga0316588_1017143 | Ga0316588_10171433 | 89 |
| 305 | 3300033528 | Ga0316588_1181053 | Ga0316588_11810532 | 89 |
| 306 | 3300033529 | Ga0316587_1015201 | Ga0316587_10152013 | 89 |
| 307 | 3300033541 | Ga0316596_1000810 | Ga0316596_10008104 | 89 |
| 308 | 3300033541 | Ga0316596_1006474 | Ga0316596_10064742 | 89 |
| 309 | 3300033541 | Ga0316596_1019803 | Ga0316596_10198033 | 89 |
| 310 | 3300033541 | Ga0316596_1145304 | Ga0316596_11453042 | 89 |
| 311 | 3300033541 | Ga0316596_1196606 | Ga0316596_11966061 | 89 |
| 312 | 3300034816 | Ga0373930_0052665 | Ga0373930_0052665_10_279 | 89 |
| 313 | 3300034817 | Ga0373948_0100055 | Ga0373948_0100055_346_615 | 89 |
| 314 | 3300034819 | Ga0373958_0028645 | Ga0373958_0028645_466_735 | 89 |
| 315 | 3300034820 | Ga0373959_0040166 | Ga0373959_0040166_484_753 | 89 |
| 316 | 3300035090 | Ga0373949_0005972 | Ga0373949_0005972_489_758 | 89 |
| 317 | 3300035091 | Ga0373951_0006144 | Ga0373951_0006144_1723_1992 | 89 |
| 318 | 3300035121 | Ga0373960_0015681 | Ga0373960_0015681_465_734 | 89 |
| 319 | 3300035398 | Ga0316574_0015612 | Ga0316574_0015612_2770_3039 | 89 |
| 320 | 3300035398 | Ga0316574_0070958 | Ga0316574_0070958_641_937 | 89 |
| 321 | 3300035398 | Ga0316574_0269787 | Ga0316574_0269787_349_618 | 89 |
| 322 | 3300035398 | Ga0316574_0279312 | Ga0316574_0279312_260_556 | 89 |
| 323 | 3300035398 | Ga0316574_0313237 | Ga0316574_0313237_53_349 | 89 |
| 324 | 3300035398 | Ga0316574_0324412 | Ga0316574_0324412_196_465 | 89 |
| 325 | 3300035398 | Ga0316574_0464367 | Ga0316574_0464367_453_722 | 89 |
| 326 | 3300035398 | Ga0316574_0508626 | Ga0316574_0508626_225_521 | 89 |
| 327 | 3300035398 | Ga0316574_0587098 | Ga0316574_0587098_167_463 | 89 |
| 328 | 3300035398 | Ga0316574_0870927 | Ga0316574_0870927_112_381 | 89 |
| 329 | 3300035691 | Ga0373931_0262611 | Ga0373931_0262611_684_953 | 89 |
| 330 | 3300035691 | Ga0373931_0352674 | Ga0373931_0352674_40_309 | 89 |
| 331 | 3300036401 | Ga0373937_0281135 | Ga0373937_0281135_432_701 | 89 |
| 332 | 3300036647 | Ga0316582_0020796 | Ga0316582_0020796_1887_2183 | 89 |
| 333 | 3300036647 | Ga0316582_0042852 | Ga0316582_0042852_2236_2532 | 89 |
| 334 | 3300036647 | Ga0316582_0112500 | Ga0316582_0112500_949_1218 | 89 |
| 335 | 3300036647 | Ga0316582_0141652 | Ga0316582_0141652_858_1154 | 89 |
| 336 | 3300036647 | Ga0316582_0203050 | Ga0316582_0203050_768_1037 | 89 |
| 337 | 3300036647 | Ga0316582_0266253 | Ga0316582_0266253_42_338 | 89 |
| 338 | 3300036647 | Ga0316582_0594890 | Ga0316582_0594890_438_716 | 89 |
| 339 | 3300036647 | Ga0316582_0932133 | Ga0316582_0932133_273_542 | 89 |
| 340 | 3300036712 | Ga0316584_0004497 | Ga0316584_0004497_302_571 | 89 |
| 341 | 3300036712 | Ga0316584_0009304 | Ga0316584_0009304_2132_2428 | 89 |
| 342 | 3300036712 | Ga0316584_0009994 | Ga0316584_0009994_71_367 | 89 |
| 343 | 3300036712 | Ga0316584_0014968 | Ga0316584_0014968_384_662 | 89 |
| 344 | 3300036712 | Ga0316584_0020077 | Ga0316584_0020077_1657_1953 | 89 |
| 345 | 3300036712 | Ga0316584_0030384 | Ga0316584_0030384_2219_2515 | 89 |
| 346 | 3300036712 | Ga0316584_0048007 | Ga0316584_0048007_1784_2053 | 89 |
| 347 | 3300036712 | Ga0316584_0061957 | Ga0316584_0061957_982_1251 | 89 |
| 348 | 3300036712 | Ga0316584_0066820 | Ga0316584_0066820_81_350 | 89 |
| 349 | 3300036712 | Ga0316584_0075823 | Ga0316584_0075823_595_864 | 89 |
| 350 | 3300036712 | Ga0316584_0182628 | Ga0316584_0182628_201_470 | 89 |
| 351 | 3300036712 | Ga0316584_0329937 | Ga0316584_0329937_169_438 | 89 |
| 352 | 3300037588 | Ga0316581_0038722 | Ga0316581_0038722_622_918 | 89 |
| 353 | 3300037588 | Ga0316581_0068440 | Ga0316581_0068440_315_584 | 89 |
| 354 | 3300041404 | Ga0439436_0000830 | Ga0439436_0000830_1202_1471 | 89 |
| 355 | 3300041405 | Ga0439438_004091 | Ga0439438_004091_4993_5262 | 89 |
| 356 | 3300041407 | Ga0439447_013306 | Ga0439447_013306_539_808 | 89 |
| 357 | 3300041411 | Ga0439466_0002812 | Ga0439466_0002812_4449_4718 | 89 |
| 358 | 3300041411 | Ga0439466_0005862 | Ga0439466_0005862_2393_2662 | 89 |
| 359 | 3300041456 | Ga0451795_0567030 | Ga0451795_0567030_187_468 | 89 |
| 360 | 3300041460 | Ga0451802_0735241 | Ga0451802_0735241_298_579 | 89 |
| 361 | 3300041486 | Ga0451807_0147622 | Ga0451807_0147622_42_323 | 89 |
| 362 | 3300041997 | Ga0439431_0013990 | Ga0439431_0013990_1523_1792 | 89 |
| 363 | 3300041997 | Ga0439431_0030818 | Ga0439431_0030818_390_659 | 89 |
| 364 | 3300042005 | Ga0439448_0006423 | Ga0439448_0006423_2653_2922 | 89 |
| 365 | 3300042006 | Ga0439432_000779 | Ga0439432_000779_10040_10309 | 89 |
| 366 | 3300042013 | Ga0439456_032414 | Ga0439456_032414_202_471 | 89 |
| 367 | 3300042115 | Ga0450911_000002 | Ga0450911_000002_63544_63813 | 89 |
| 368 | 3300042117 | Ga0450913_002648 | Ga0450913_002648_264_533 | 89 |
| 369 | 3300042118 | Ga0450914_051973 | Ga0450914_051973_177_446 | 89 |
| 370 | 3300042120 | Ga0450917_002513 | Ga0450917_002513_363_632 | 89 |
| 371 | 3300042125 | Ga0450923_000487 | Ga0450923_000487_2598_2867 | 89 |
| 372 | 3300042130 | Ga0450892_017721 | Ga0450892_017721_315_584 | 89 |
| 373 | 3300042139 | Ga0450904_000036 | Ga0450904_000036_11173_11442 | 89 |
| 374 | 3300042144 | Ga0450889_006048 | Ga0450889_006048_476_745 | 89 |
| 375 | 3300042156 | Ga0439446_0007073 | Ga0439446_0007073_2010_2279 | 89 |
| 376 | 3300042156 | Ga0439446_0014280 | Ga0439446_0014280_954_1223 | 89 |
| 377 | 3300042156 | Ga0439446_0223398 | Ga0439446_0223398_246_515 | 89 |
| 378 | 3300042185 | Ga0450909_083248 | Ga0450909_083248_58_327 | 89 |
| 379 | 3300042438 | Ga0439459_0027725 | Ga0439459_0027725_261_530 | 89 |
| 380 | 3300042439 | Ga0439464_0003612 | Ga0439464_0003612_284_553 | 89 |
| 381 | 3300042532 | Ga0450893_0001318 | Ga0450893_0001318_3406_3675 | 89 |
| 382 | 3300042532 | Ga0450893_0013164 | Ga0450893_0013164_46_315 | 89 |
| 383 | 3300042876 | Ga0451577_0017761 | Ga0451577_0017761_816_1091 | 89 |
| 384 | 3300042876 | Ga0451577_0018905 | Ga0451577_0018905_6006_6275 | 89 |
| 385 | 3300042876 | Ga0451577_0020696 | Ga0451577_0020696_3220_3492 | 89 |
| 386 | 3300042876 | Ga0451577_0029460 | Ga0451577_0029460_4653_4925 | 89 |
| 387 | 3300042876 | Ga0451577_0220398 | Ga0451577_0220398_1134_1406 | 89 |
| 388 | 3300042876 | Ga0451577_0775379 | Ga0451577_0775379_430_705 | 89 |
| 389 | 3300042876 | Ga0451577_1295757 | Ga0451577_1295757_73_342 | 89 |
| 390 | 3300044712 | Ga0453684_0329672 | Ga0453684_0329672_700_969 | 89 |
| 391 | 3300044712 | Ga0453684_0375996 | Ga0453684_0375996_800_1072 | 89 |
| 392 | 3300044712 | Ga0453684_0991192 | Ga0453684_0991192_544_816 | 89 |
| 393 | 3300044712 | Ga0453684_1047869 | Ga0453684_1047869_113_388 | 89 |
| 394 | 3300044712 | Ga0453684_1670318 | Ga0453684_1670318_367_636 | 89 |
| 395 | 3300044712 | Ga0453684_1753045 | Ga0453684_1753045_223_492 | 89 |
| 396 | 3300044712 | Ga0453684_1973335 | Ga0453684_1973335_257_532 | 89 |
| 397 | 3300044719 | Ga0466971_0700988 | Ga0466971_0700988_216_491 | 89 |
| 398 | 3300044842 | Ga0466957_1038814 | Ga0466957_1038814_243_518 | 89 |
| 399 | 3300045051 | Ga0451576_0002027 | Ga0451576_0002027_21531_21803 | 89 |
| 400 | 3300045051 | Ga0451576_0009363 | Ga0451576_0009363_10434_10703 | 89 |
| 401 | 3300045051 | Ga0451576_0035370 | Ga0451576_0035370_272_544 | 89 |
| 402 | 3300045051 | Ga0451576_0487669 | Ga0451576_0487669_992_1261 | 89 |
| 403 | 3300045051 | Ga0451576_0620389 | Ga0451576_0620389_406_681 | 89 |
| 404 | 3300045051 | Ga0451576_0792212 | Ga0451576_0792212_294_569 | 89 |
| 405 | 3300045051 | Ga0451576_1921852 | Ga0451576_1921852_175_447 | 89 |
| 406 | 3300045976 | Ga0466967_0021359 | Ga0466967_0021359_3681_3956 | 89 |
| 407 | 3300048904 | Ga0496101_0101511 | Ga0496101_0101511_1271_1540 | 89 |
| 408 | 3300048904 | Ga0496101_0951329 | Ga0496101_0951329_246_515 | 89 |
| 409 | 3300048905 | Ga0496102_0123913 | Ga0496102_0123913_1296_1565 | 89 |
| 410 | 3300048907 | Ga0496104_0081017 | Ga0496104_0081017_2328_2606 | 89 |
| 411 | 3300048909 | Ga0496106_0379840 | Ga0496106_0379840_683_952 | 89 |
| 412 | 3300048910 | Ga0496107_0174147 | Ga0496107_0174147_506_775 | 89 |
| 413 | 3300048911 | Ga0496108_1431538 | Ga0496108_1431538_275_544 | 89 |
| 414 | 3300048912 | Ga0496109_0273765 | Ga0496109_0273765_729_998 | 89 |
| 415 | 3300048912 | Ga0496109_1051622 | Ga0496109_1051622_382_651 | 89 |
| 416 | 3300048913 | Ga0496110_0091463 | Ga0496110_0091463_576_845 | 89 |
| 417 | 3300048916 | Ga0496113_1079772 | Ga0496113_1079772_17_286 | 89 |
| 418 | 3300048917 | Ga0496114_0124939 | Ga0496114_0124939_259_528 | 89 |
| 419 | 3300048920 | Ga0496117_0198713 | Ga0496117_0198713_650_919 | 89 |
| 420 | 3300049568 | Ga0501031_0128128 | Ga0501031_0128128_582_851 | 89 |
| 421 | 3300049568 | Ga0501031_0593471 | Ga0501031_0593471_179_454 | 89 |
| 422 | 3300049569 | Ga0501032_0000863 | Ga0501032_0000863_4372_4647 | 89 |
| 423 | 3300049569 | Ga0501032_0007624 | Ga0501032_0007624_7172_7441 | 89 |
| 424 | 3300049571 | Ga0501034_0051254 | Ga0501034_0051254_3234_3503 | 89 |
| 425 | 3300049571 | Ga0501034_0244724 | Ga0501034_0244724_276_545 | 89 |
| 426 | 3300049571 | Ga0501034_0341520 | Ga0501034_0341520_954_1223 | 89 |
| 427 | 3300049571 | Ga0501034_0438614 | Ga0501034_0438614_607_876 | 89 |
| 428 | 3300049571 | Ga0501034_0889253 | Ga0501034_0889253_489_758 | 89 |
| 429 | 3300049574 | Ga0501038_0057638 | Ga0501038_0057638_950_1219 | 89 |
| 430 | 3300049574 | Ga0501038_0860503 | Ga0501038_0860503_323_592 | 89 |
| 431 | 3300049575 | Ga0501039_0030902 | Ga0501039_0030902_3232_3501 | 89 |
| 432 | 3300049575 | Ga0501039_0582805 | Ga0501039_0582805_244_519 | 89 |
| 433 | 3300049575 | Ga0501039_0851211 | Ga0501039_0851211_66_335 | 89 |
| 434 | 3300049576 | Ga0501040_0452684 | Ga0501040_0452684_156_425 | 89 |
| 435 | 3300049577 | Ga0501041_1117660 | Ga0501041_1117660_64_333 | 89 |
| 436 | 3300049579 | Ga0501043_0689809 | Ga0501043_0689809_226_495 | 89 |
| 437 | 3300049581 | Ga0501047_0208371 | Ga0501047_0208371_755_1024 | 89 |
| 438 | 3300049581 | Ga0501047_0275445 | Ga0501047_0275445_125_406 | 89 |
| 439 | 3300049582 | Ga0501048_0755510 | Ga0501048_0755510_238_507 | 89 |
| 440 | 3300049583 | Ga0501067_0000127 | Ga0501067_0000127_31956_32231 | 89 |
| 441 | 3300049584 | Ga0501068_0009147 | Ga0501068_0009147_5041_5316 | 89 |
| 442 | 3300049589 | Ga0501073_0000006 | Ga0501073_0000006_208839_209114 | 89 |
| 443 | 3300049591 | Ga0501075_0395989 | Ga0501075_0395989_757_1026 | 89 |
| 444 | 3300049592 | Ga0501076_1450874 | Ga0501076_1450874_222_491 | 89 |
| 445 | 3300049705 | Ga0501225_0063452 | Ga0501225_0063452_41_310 | 89 |
| 446 | 3300049742 | Ga0501080_0002191 | Ga0501080_0002191_16128_16403 | 89 |
| 447 | 3300049742 | Ga0501080_0737550 | Ga0501080_0737550_193_462 | 89 |
| 448 | 3300049742 | Ga0501080_1797873 | Ga0501080_1797873_196_465 | 89 |
| 449 | 3300049744 | Ga0501083_0954645 | Ga0501083_0954645_158_433 | 89 |
| 450 | 3300049822 | Ga0501035_0358368 | Ga0501035_0358368_878_1147 | 89 |
| 451 | 3300049823 | Ga0501044_0015081 | Ga0501044_0015081_1638_1913 | 89 |
| 452 | 3300049824 | Ga0501045_0888142 | Ga0501045_0888142_68_337 | 89 |
| 453 | 3300049824 | Ga0501045_0975159 | Ga0501045_0975159_73_342 | 89 |
| 454 | 3300049853 | Ga0501226_000007 | Ga0501226_000007_201054_201323 | 89 |
| 455 | 3300050509 | nmdc:mga0qj67_1574449_c1 | nmdc:mga0qj67_1574449_c1_61_330 | 89 |
| 456 | 3300050510 | nmdc:mga06r32_345585_c1 | nmdc:mga06r32_345585_c1_506_775 | 89 |
| 457 | 3300050515 | nmdc:mga0a205_80220_c1 | nmdc:mga0a205_80220_c1_2258_2527 | 89 |
| 458 | 3300054114 | Ga0501084_0642191 | Ga0501084_0642191_202_477 | 89 |
| 459 | 3300054114 | Ga0501084_1241533 | Ga0501084_1241533_140_409 | 89 |
| 460 | 3300059423 | Ga0590074_012583 | Ga0590074_012583_766_1035 | 89 |
| 461 | 3300060353 | Ga0501082_0148347 | Ga0501082_0148347_41_316 | 89 |
| 462 | 3300060353 | Ga0501082_1625332 | Ga0501082_1625332_272_541 | 89 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cj3-assembly1.cif.gz_A | crystal structure of the transmembrane domain of salpingoeca rosetta rhodopsin phosphodiesterase | 0.921 | 3 | 54 |
| 7qru-assembly1.cif.gz_F | structure of bacillus pseudofirmus mrp antiporter complex, monomer | 0.9123 | 1 | 88 |
| 7n0e-assembly1.cif.gz_B | co-complex of the histidine kinase region of rets and the dimerization and histidine phosphotransfer domain of gacs | 0.9093 | 3 | 54 |
| 6z16-assembly1.cif.gz_f | structure of the mrp antiporter complex | 0.9024 | 6 | 89 |
| 7qru-assembly1.cif.gz_F | structure of bacillus pseudofirmus mrp antiporter complex, monomer | 0.8936 | 1 | 88 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6g72K00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9172 | 7 | 84 | 1.10.287.3510 |
| af_A0A0R0I378_34_190_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8965 | 6 | 55 | 1.20.1260.10 |
| af_P81309_1_82_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8716 | 9 | 85 | 1.10.287.3510 |
| 5xtdk00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8335 | 7 | 81 | 1.10.287.3510 |
| af_P03926_3_170_1.20.120.1200 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);NADH-ubiquinone/plastoquinone oxidoreductase chain 6, subunit NuoJ | 0.825 | 10 | 86 | 1.20.120.1200 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B1G8P7-F1-model_v4 | Cation transporter | 0.9897 | 6 | 80 |
GO:0005886
GO:0015385 |
| AF-A0A2A6RLA1-F1-model_v4 | Cation transporter | 0.9821 | 4 | 85 |
GO:0005886
GO:0015385 |
| AF-A0A6N8WCM8-F1-model_v4 | pH regulation protein F | 0.9821 | 6 | 84 |
GO:0005886
GO:0015385 |
| AF-A0A3B8UC84-F1-model_v4 | Sodium:proton antiporter | 0.981 | 4 | 80 |
GO:0005886
GO:0015385 |
| AF-A0A178P621-F1-model_v4 | deleted | 0.9781 | 5 | 89 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar