F448939

General Info

Members Datasets Scaffolds Average Seq Length
462 270 462 90

Family's Representative Sequence

Representative Sequence 3300031728|Ga0316578_10205360|Ga0316578_102053602
Length 111
Sequence MTDPSVALLTDATIAAEAVTGPILAGALGIGFLLVSAALLMSLARLVIGPDKPDRILALDTLYVNTVALLVLLGIHLSNDLFFEAALLIALIGFIGTVALAKFLTRGDIIE

Samples

Sample ID Description Type Environment
1 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003405 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM Metagenome Rhizosphere
4 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
177 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
178 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
179 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
182 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
183 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
184 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
190 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
191 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
192 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
193 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
194 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
200 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
201 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
202 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
203 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
204 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
205 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
206 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
207 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
208 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
209 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
210 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
211 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
212 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
213 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
214 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
215 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
216 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
217 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
218 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
219 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
220 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
221 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
222 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
223 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
224 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
225 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
226 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
229 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
254 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
255 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
256 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.97
Metatranscriptomes 3.03
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.25
Rhizosphere 96.54
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10068129 3300002239 Bacteria 634
2 JGI24742J22300_10118869 3300002244 Bacteria 521
3 JGI26132J50249_104774 3300003405 Bacteria 512
4 JGI26141J51220_1011613 3300003503 Bacteria 583
5 Ga0065704_10164877 3300005289 Bacteria 1329
6 Ga0070676_10000774 3300005328 Bacteria 15756
7 Ga0070676_10001175 3300005328 Bacteria 13119
8 Ga0070683_100054794 3300005329 Bacteria 3698
9 Ga0070690_100046925 3300005330 Bacteria 2747
10 Ga0070670_100026878 3300005331 Bacteria 4950
11 Ga0070670_100036317 3300005331 Bacteria 4240
12 Ga0070677_10444375 3300005333 Bacteria 692
13 Ga0068869_100003142 3300005334 Bacteria 10073
14 Ga0068869_100004518 3300005334 Bacteria 8655
15 Ga0070666_10000716 3300005335 Bacteria 20098
16 Ga0070680_100030043 3300005336 Bacteria 4364
17 Ga0070682_100006507 3300005337 Bacteria 6557
18 Ga0068868_100015154 3300005338 Bacteria 5695
19 Ga0068868_100076397 3300005338 Bacteria 2678
20 Ga0070660_100003613 3300005339 Bacteria 10688
21 Ga0070689_100107834 3300005340 Bacteria 2212
22 Ga0070689_100506128 3300005340 Bacteria 1035
23 Ga0070691_10083633 3300005341 Bacteria 1566
24 Ga0070661_100003491 3300005344 Bacteria 10822
25 Ga0070668_100001323 3300005347 Bacteria 17744
26 Ga0070669_100001499 3300005353 Bacteria 16886
27 Ga0070669_100009363 3300005353 Bacteria 6978
28 Ga0070675_100003394 3300005354 Bacteria 12063
29 Ga0070675_100125437 3300005354 Bacteria 2184
30 Ga0070671_100008745 3300005355 Bacteria 8123
31 Ga0070671_100171937 3300005355 Bacteria 1833
32 Ga0070674_100024859 3300005356 Bacteria 3891
33 Ga0070673_100001645 3300005364 Bacteria 13242
34 Ga0070688_100024809 3300005365 Bacteria 3543
35 Ga0070688_101017671 3300005365 Bacteria 659
36 Ga0070659_100011644 3300005366 Bacteria 6508
37 Ga0070667_100001885 3300005367 Bacteria 18604
38 Ga0070667_100047541 3300005367 Bacteria 3610
39 Ga0070703_10008355 3300005406 Bacteria 2910
40 Ga0070701_10019598 3300005438 Bacteria 3197
41 Ga0070705_100015847 3300005440 Bacteria 3903
42 Ga0070700_100120228 3300005441 Bacteria 1759
43 Ga0070694_100078319 3300005444 Bacteria 2292
44 Ga0070708_100000735 3300005445 Bacteria 24829
45 Ga0070708_100591724 3300005445 Bacteria 1046
46 Ga0070663_100018630 3300005455 Bacteria 4556
47 Ga0070678_100001250 3300005456 Bacteria 13457
48 Ga0070662_101372432 3300005457 Bacteria 609
49 Ga0070681_10025228 3300005458 Bacteria 5979
50 Ga0070681_10590122 3300005458 Bacteria 1025
51 Ga0068867_100013240 3300005459 Bacteria 5842
52 Ga0070685_10053447 3300005466 Bacteria 2340
53 Ga0070707_101865562 3300005468 Bacteria 568
54 Ga0070679_100001879 3300005530 Bacteria 18896
55 Ga0068853_100011113 3300005539 Bacteria 7303
56 Ga0068853_100315486 3300005539 Bacteria 1448
57 Ga0068853_100341055 3300005539 Bacteria 1392
58 Ga0070672_100001970 3300005543 Bacteria 12859
59 Ga0070672_100248023 3300005543 Bacteria 1499
60 Ga0070686_101562126 3300005544 Bacteria 557
61 Ga0070695_100012223 3300005545 Bacteria 5149
62 Ga0070696_100018398 3300005546 Bacteria 4721
63 Ga0070693_100202346 3300005547 Bacteria 1290
64 Ga0070665_100009908 3300005548 Bacteria 9637
65 Ga0070704_100001689 3300005549 Bacteria 12011
66 Ga0070704_101194675 3300005549 Bacteria 693
67 Ga0068855_100011388 3300005563 Bacteria 10740
68 Ga0070664_100036940 3300005564 Bacteria 4105
69 Ga0068857_100197024 3300005577 Bacteria 1835
70 Ga0068854_100002332 3300005578 Bacteria 11706
71 Ga0068856_100154544 3300005614 Bacteria 2304
72 Ga0070702_100236596 3300005615 Bacteria 1230
73 Ga0068852_100436931 3300005616 Bacteria 1293
74 Ga0068859_100006568 3300005617 Bacteria 11803
75 Ga0068859_100007175 3300005617 Bacteria 11313
76 Ga0068864_100006114 3300005618 Bacteria 9876
77 Ga0068864_100025840 3300005618 Bacteria 4948
78 Ga0068866_10566168 3300005718 Bacteria 762
79 Ga0068866_10710406 3300005718 Bacteria 690
80 Ga0068861_100006024 3300005719 Bacteria 8244
81 Ga0068861_100025326 3300005719 Bacteria 4302
82 Ga0068870_10003489 3300005840 Bacteria 6669
83 Ga0068870_10254225 3300005840 Bacteria 1090
84 Ga0068863_100002793 3300005841 Bacteria 17293
85 Ga0068863_100029243 3300005841 Bacteria 5260
86 Ga0068858_100005140 3300005842 Bacteria 12823
87 Ga0068858_100016786 3300005842 Bacteria 6874
88 Ga0068860_100005023 3300005843 Bacteria 13463
89 Ga0068860_100007534 3300005843 Bacteria 10888
90 Ga0068862_100009111 3300005844 Bacteria 8217
91 Ga0070716_100895512 3300006173 Bacteria 694
92 Ga0097621_100001779 3300006237 Bacteria 14785
93 Ga0068871_100003595 3300006358 Bacteria 10651
94 Ga0075428_100478377 3300006844 Bacteria 1333
95 Ga0075431_100463165 3300006847 Bacteria 1262
96 Ga0075431_100650680 3300006847 Unclassified 1034
97 Ga0075433_10007076 3300006852 Bacteria 8881
98 Ga0075434_100041765 3300006871 Bacteria 4544
99 Ga0075429_100425903 3300006880 Bacteria 1162
100 Ga0068865_100001873 3300006881 Bacteria 12369
101 Ga0097620_100006568 3300006931 Bacteria 11803
102 Ga0097620_100007175 3300006931 Bacteria 11313
103 Ga0105244_10008784 3300009036 Bacteria 6274
104 Ga0105250_10551260 3300009092 Bacteria 529
105 Ga0105240_10260136 3300009093 Bacteria 2002
106 Ga0105245_10041799 3300009098 Bacteria 4087
107 Ga0114129_11180619 3300009147 Bacteria 954
108 Ga0105243_10498303 3300009148 Bacteria 1153
109 Ga0105243_11213910 3300009148 Bacteria 768
110 Ga0105241_10009352 3300009174 Bacteria 7203
111 Ga0105248_10018359 3300009177 Bacteria 7726
112 Ga0105237_10052739 3300009545 Bacteria 4081
113 Ga0105249_10459918 3300009553 Bacteria 1312
114 Ga0105246_12099753 3300011119 Bacteria 547
115 Ga0157373_10020097 3300013100 Bacteria 4858
116 Ga0157373_10069426 3300013100 Bacteria 2491
117 Ga0157373_10372844 3300013100 Bacteria 1020
118 Ga0157371_10011030 3300013102 Bacteria 7001
119 Ga0157371_10040071 3300013102 Bacteria 3348
120 Ga0157371_10079814 3300013102 Bacteria 2317
121 Ga0157371_10338413 3300013102 Bacteria 1094
122 Ga0157370_10127411 3300013104 Bacteria 2376
123 Ga0157369_10001875 3300013105 Bacteria 25352
124 Ga0157369_10005244 3300013105 Bacteria 15117
125 Ga0157374_10003539 3300013296 Bacteria 13142
126 Ga0157378_10056099 3300013297 Bacteria 3509
127 Ga0157378_10244106 3300013297 Bacteria 1717
128 Ga0163162_10054335 3300013306 Bacteria 4029
129 Ga0157372_10003171 3300013307 Bacteria 17732
130 Ga0157372_10212337 3300013307 Bacteria 2243
131 Ga0157372_10389706 3300013307 Bacteria 1623
132 Ga0157375_10006411 3300013308 Bacteria 10256
133 Ga0163163_10096096 3300014325 Bacteria 2983
134 Ga0163163_10202503 3300014325 Bacteria 2033
135 Ga0157380_10243505 3300014326 Bacteria 1623
136 Ga0157380_10734070 3300014326 Bacteria 997
137 Ga0157377_10128870 3300014745 Bacteria 1543
138 Ga0157379_10004073 3300014968 Bacteria 12470
139 Ga0157376_10003562 3300014969 Bacteria 10737
140 Ga0182006_1142703 3300015261 Bacteria 817
141 Ga0182007_10008129 3300015262 Bacteria 4330
142 Ga0163161_10223478 3300017792 Unclassified 1459
143 Ga0207697_10028171 3300025315 Bacteria 2298
144 Ga0207697_10240665 3300025315 Bacteria 800
145 Ga0207713_1005333 3300025735 Bacteria 8074
146 Ga0207653_10002179 3300025885 Bacteria 6234
147 Ga0207642_10906431 3300025899 Bacteria 565
148 Ga0207688_10009535 3300025901 Bacteria 5285
149 Ga0207680_10044818 3300025903 Bacteria 2604
150 Ga0207680_10395679 3300025903 Bacteria 976
151 Ga0207647_10028049 3300025904 Bacteria 3663
152 Ga0207645_10000812 3300025907 Bacteria 26130
153 Ga0207645_10002937 3300025907 Bacteria 13175
154 Ga0207643_10000722 3300025908 Bacteria 20289
155 Ga0207654_10061354 3300025911 Bacteria 2200
156 Ga0207707_10002355 3300025912 Bacteria 17022
157 Ga0207695_10204409 3300025913 Bacteria 1888
158 Ga0207660_10014617 3300025917 Bacteria 5167
159 Ga0207662_10059424 3300025918 Bacteria 2291
160 Ga0207657_10000385 3300025919 Bacteria 46501
161 Ga0207649_10015334 3300025920 Bacteria 4307
162 Ga0207652_10016056 3300025921 Bacteria 6105
163 Ga0207646_11749377 3300025922 Bacteria 533
164 Ga0207681_10002868 3300025923 Bacteria 10891
165 Ga0207650_10034483 3300025925 Bacteria 3670
166 Ga0207650_10072929 3300025925 Bacteria 2585
167 Ga0207659_10002225 3300025926 Bacteria 11551
168 Ga0207659_10452460 3300025926 Bacteria 1082
169 Ga0207687_11282719 3300025927 Bacteria 630
170 Ga0207644_10006005 3300025931 Bacteria 7915
171 Ga0207644_10525031 3300025931 Bacteria 978
172 Ga0207706_10003911 3300025933 Bacteria 14137
173 Ga0207706_10506718 3300025933 Bacteria 1041
174 Ga0207709_10743267 3300025935 Bacteria 788
175 Ga0207709_11053032 3300025935 Bacteria 667
176 Ga0207670_10084284 3300025936 Bacteria 2231
177 Ga0207670_10622446 3300025936 Bacteria 888
178 Ga0207669_10014819 3300025937 Bacteria 3917
179 Ga0207704_10003782 3300025938 Bacteria 6892
180 Ga0207691_10000041 3300025940 Bacteria 106275
181 Ga0207691_10260034 3300025940 Bacteria 1496
182 Ga0207711_10054791 3300025941 Bacteria 3423
183 Ga0207689_10000204 3300025942 Bacteria 52389
184 Ga0207689_10030654 3300025942 Bacteria 4481
185 Ga0207661_10411109 3300025944 Bacteria 1228
186 Ga0207679_10035706 3300025945 Bacteria 3519
187 Ga0207667_10007006 3300025949 Bacteria 13616
188 Ga0207651_10029214 3300025960 Bacteria 3490
189 Ga0207712_10291253 3300025961 Bacteria 1336
190 Ga0207668_10010094 3300025972 Bacteria 5689
191 Ga0207668_10821323 3300025972 Bacteria 824
192 Ga0207640_10066771 3300025981 Bacteria 2404
193 Ga0207658_10004908 3300025986 Bacteria 9226
194 Ga0207658_10263507 3300025986 Bacteria 1470
195 Ga0207677_10006748 3300026023 Bacteria 6304
196 Ga0207677_10056106 3300026023 Bacteria 2697
197 Ga0207703_10004130 3300026035 Bacteria 11981
198 Ga0207639_10011721 3300026041 Bacteria 6096
199 Ga0207639_10372952 3300026041 Bacteria 1280
200 Ga0207678_10041350 3300026067 Bacteria 3997
201 Ga0207708_10236409 3300026075 Bacteria 1468
202 Ga0207702_10033285 3300026078 Bacteria 4305
203 Ga0207641_10001249 3300026088 Bacteria 25369
204 Ga0207648_10001461 3300026089 Bacteria 25990
205 Ga0207648_10004390 3300026089 Bacteria 14500
206 Ga0207676_10005257 3300026095 Bacteria 9163
207 Ga0207676_10017371 3300026095 Bacteria 5213
208 Ga0207674_10001950 3300026116 Bacteria 26184
209 Ga0207675_100005135 3300026118 Bacteria 12603
210 Ga0207675_100008371 3300026118 Bacteria 9748
211 Ga0207683_10000011 3300026121 Bacteria 140261
212 Ga0209371_1000135 3300027312 Bacteria 121718
213 Ga0209969_1009261 3300027360 Bacteria 1401
214 Ga0209981_1046028 3300027378 Bacteria 656
215 Ga0209996_1000510 3300027395 Bacteria 4668
216 Ga0209984_1001665 3300027424 Bacteria 2424
217 Ga0210000_1053272 3300027462 Bacteria 651
218 Ga0209995_1053270 3300027471 Bacteria 687
219 Ga0209968_1067782 3300027526 Bacteria 634
220 Ga0209999_1034324 3300027543 Bacteria 944
221 Ga0209982_1090629 3300027552 Bacteria 507
222 Ga0209970_1064884 3300027614 Bacteria 673
223 Ga0210002_1006419 3300027617 Bacteria 1774
224 Ga0209983_1002354 3300027665 Bacteria 4148
225 Ga0209971_1004302 3300027682 Bacteria 3380
226 Ga0209971_1192739 3300027682 Bacteria 502
227 Ga0209974_10016365 3300027876 Bacteria 2463
228 Ga0268266_10009550 3300028379 Bacteria 8536
229 Ga0268265_10133019 3300028380 Bacteria 2070
230 Ga0268264_10011762 3300028381 Bacteria 7216
231 Ga0268264_10037926 3300028381 Bacteria 3975
232 Ga0268256_1000148 3300030500 Bacteria 94347
233 Ga0307408_100000005 3300031548 Bacteria 529098
234 Ga0307408_100954931 3300031548 Bacteria 788
235 Ga0316579_10006926 3300031691 Bacteria 4653
236 Ga0316579_10182880 3300031691 Bacteria 1013
237 Ga0316579_10221246 3300031691 Bacteria 916
238 Ga0316579_10485042 3300031691 Bacteria 598
239 Ga0316576_10000526 3300031727 Bacteria 17908
240 Ga0316576_10025645 3300031727 Bacteria 4130
241 Ga0316576_10052640 3300031727 Bacteria 2964
242 Ga0316576_10054830 3300031727 Bacteria 2907
243 Ga0316576_10077273 3300031727 Bacteria 2465
244 Ga0316576_10130658 3300031727 Bacteria 1889
245 Ga0316576_10145946 3300031727 Bacteria 1782
246 Ga0316576_10164301 3300031727 Bacteria 1675
247 Ga0316576_10261132 3300031727 Bacteria 1299
248 Ga0316576_10496834 3300031727 Bacteria 897
249 Ga0316576_10804794 3300031727 Unclassified 676
250 Ga0316576_10869668 3300031727 Bacteria 646
251 Ga0316578_10007930 3300031728 Bacteria 5365
252 Ga0316578_10008122 3300031728 Bacteria 5316
253 Ga0316578_10012798 3300031728 Bacteria 4430
254 Ga0316578_10029330 3300031728 Bacteria 3122
255 Ga0316578_10043372 3300031728 Bacteria 2612
256 Ga0316578_10047387 3300031728 Bacteria 2507
257 Ga0316578_10054639 3300031728 Bacteria 2343
258 Ga0316578_10066182 3300031728 Bacteria 2134
259 Ga0316578_10130558 3300031728 Bacteria 1512
260 Ga0316578_10139890 3300031728 Bacteria 1457
261 Ga0316578_10156880 3300031728 Bacteria 1371
262 Ga0316578_10194416 3300031728 Bacteria 1222
263 Ga0316578_10205360 3300031728 Bacteria 1186
264 Ga0316578_10230852 3300031728 Bacteria 1111
265 Ga0316578_10276289 3300031728 Bacteria 1006
266 Ga0316577_10015253 3300031733 Bacteria 4226
267 Ga0316577_10015859 3300031733 Bacteria 4147
268 Ga0316577_10023832 3300031733 Bacteria 3398
269 Ga0316577_10123391 3300031733 Bacteria 1456
270 Ga0316577_10311833 3300031733 Bacteria 892
271 Ga0316577_10347275 3300031733 Bacteria 842
272 Ga0316577_10397618 3300031733 Bacteria 783
273 Ga0316577_10421352 3300031733 Bacteria 758
274 Ga0316577_10655854 3300031733 Bacteria 596
275 Ga0316577_10709813 3300031733 Bacteria 571
276 Ga0316577_10724964 3300031733 Bacteria 564
277 Ga0307406_10000700 3300031901 Bacteria 18926
278 Ga0307406_10601568 3300031901 Bacteria 907
279 Ga0316583_10004764 3300032133 Bacteria 4849
280 Ga0316583_10060104 3300032133 Bacteria 1332
281 Ga0316583_10119462 3300032133 Bacteria 919
282 Ga0316583_10296583 3300032133 Unclassified 559
283 Ga0316585_10005021 3300032137 Bacteria 3720
284 Ga0316585_10065243 3300032137 Bacteria 1179
285 Ga0316585_10083287 3300032137 Bacteria 1043
286 Ga0316585_10093495 3300032137 Bacteria 984
287 Ga0316585_10105099 3300032137 Bacteria 927
288 Ga0316580_10004071 3300032139 Bacteria 4213
289 Ga0316580_10010047 3300032139 Bacteria 2851
290 Ga0316580_10013867 3300032139 Bacteria 2456
291 Ga0316580_10018053 3300032139 Bacteria 2170
292 Ga0316580_10022901 3300032139 Bacteria 1928
293 Ga0316580_10054900 3300032139 Bacteria 1225
294 Ga0316580_10060526 3300032139 Bacteria 1163
295 Ga0316580_10067492 3300032139 Bacteria 1096
296 Ga0316580_10092838 3300032139 Bacteria 924
297 Ga0316580_10173072 3300032139 Bacteria 663
298 Ga0316593_10019682 3300032168 Bacteria 2089
299 Ga0316593_10026378 3300032168 Bacteria 1857
300 Ga0316593_10061858 3300032168 Bacteria 1281
301 Ga0316593_10078007 3300032168 Bacteria 1153
302 Ga0316592_1004112 3300033524 Bacteria 2681
303 Ga0316592_1123290 3300033524 Bacteria 602
304 Ga0316588_1017143 3300033528 Bacteria 1612
305 Ga0316588_1181053 3300033528 Bacteria 547
306 Ga0316587_1015201 3300033529 Bacteria 1276
307 Ga0316596_1000810 3300033541 Bacteria 5790
308 Ga0316596_1006474 3300033541 Bacteria 2725
309 Ga0316596_1019803 3300033541 Bacteria 1709
310 Ga0316596_1145304 3300033541 Bacteria 650
311 Ga0316596_1196606 3300033541 Unclassified 560
312 Ga0373930_0052665 3300034816 Bacteria 892
313 Ga0373948_0100055 3300034817 Bacteria 682
314 Ga0373958_0028645 3300034819 Bacteria 1079
315 Ga0373959_0040166 3300034820 Bacteria 979
316 Ga0373949_0005972 3300035090 Bacteria 2704
317 Ga0373951_0006144 3300035091 Bacteria 2757
318 Ga0373960_0015681 3300035121 Bacteria 1938
319 Ga0316574_0015612 3300035398 Bacteria 4408
320 Ga0316574_0070958 3300035398 Bacteria 2199
321 Ga0316574_0269787 3300035398 Bacteria 1085
322 Ga0316574_0279312 3300035398 Bacteria 1064
323 Ga0316574_0313237 3300035398 Bacteria 997
324 Ga0316574_0324412 3300035398 Bacteria 977
325 Ga0316574_0464367 3300035398 Bacteria 792
326 Ga0316574_0508626 3300035398 Bacteria 750
327 Ga0316574_0587098 3300035398 Bacteria 689
328 Ga0316574_0870927 3300035398 Unclassified 546
329 Ga0373931_0262611 3300035691 Unclassified 1054
330 Ga0373931_0352674 3300035691 Bacteria 921
331 Ga0373937_0281135 3300036401 Bacteria 1572
332 Ga0316582_0020796 3300036647 Bacteria 3866
333 Ga0316582_0042852 3300036647 Bacteria 2837
334 Ga0316582_0112500 3300036647 Bacteria 1814
335 Ga0316582_0141652 3300036647 Bacteria 1621
336 Ga0316582_0203050 3300036647 Bacteria 1352
337 Ga0316582_0266253 3300036647 Bacteria 1175
338 Ga0316582_0594890 3300036647 Bacteria 761
339 Ga0316582_0932133 3300036647 Bacteria 594
340 Ga0316584_0004497 3300036712 Bacteria 9230
341 Ga0316584_0009304 3300036712 Bacteria 6815
342 Ga0316584_0009994 3300036712 Bacteria 6612
343 Ga0316584_0014968 3300036712 Bacteria 5539
344 Ga0316584_0020077 3300036712 Bacteria 4839
345 Ga0316584_0030384 3300036712 Bacteria 3990
346 Ga0316584_0048007 3300036712 Bacteria 3189
347 Ga0316584_0061957 3300036712 Bacteria 2802
348 Ga0316584_0066820 3300036712 Bacteria 2694
349 Ga0316584_0075823 3300036712 Bacteria 2520
350 Ga0316584_0182628 3300036712 Bacteria 1553
351 Ga0316584_0329937 3300036712 Bacteria 1099
352 Ga0316581_0038722 3300037588 Bacteria 1450
353 Ga0316581_0068440 3300037588 Bacteria 1090
354 Ga0439436_0000830 3300041404 Bacteria 8413
355 Ga0439438_004091 3300041405 Bacteria 5704
356 Ga0439447_013306 3300041407 Bacteria 2338
357 Ga0439466_0002812 3300041411 Bacteria 6816
358 Ga0439466_0005862 3300041411 Bacteria 4680
359 Ga0451795_0567030 3300041456 Bacteria 698
360 Ga0451802_0735241 3300041460 Bacteria 672
361 Ga0451807_0147622 3300041486 Bacteria 510
362 Ga0439431_0013990 3300041997 Bacteria 1856
363 Ga0439431_0030818 3300041997 Bacteria 1330
364 Ga0439448_0006423 3300042005 Bacteria 3380
365 Ga0439432_000779 3300042006 Bacteria 11955
366 Ga0439456_032414 3300042013 Bacteria 1122
367 Ga0450911_000002 3300042115 Bacteria 277703
368 Ga0450913_002648 3300042117 Bacteria 1117
369 Ga0450914_051973 3300042118 Bacteria 541
370 Ga0450917_002513 3300042120 Bacteria 1312
371 Ga0450923_000487 3300042125 Bacteria 4372
372 Ga0450892_017721 3300042130 Bacteria 679
373 Ga0450904_000036 3300042139 Bacteria 30421
374 Ga0450889_006048 3300042144 Bacteria 1212
375 Ga0439446_0007073 3300042156 Bacteria 2940
376 Ga0439446_0014280 3300042156 Bacteria 2190
377 Ga0439446_0223398 3300042156 Bacteria 642
378 Ga0450909_083248 3300042185 Bacteria 519
379 Ga0439459_0027725 3300042438 Bacteria 1132
380 Ga0439464_0003612 3300042439 Bacteria 3920
381 Ga0450893_0001318 3300042532 Bacteria 3766
382 Ga0450893_0013164 3300042532 Bacteria 1377
383 Ga0451577_0017761 3300042876 Bacteria 6563
384 Ga0451577_0018905 3300042876 Bacteria 6343
385 Ga0451577_0020696 3300042876 Bacteria 6033
386 Ga0451577_0029460 3300042876 Bacteria 4962
387 Ga0451577_0220398 3300042876 Bacteria 1715
388 Ga0451577_0775379 3300042876 Bacteria 867
389 Ga0451577_1295757 3300042876 Bacteria 648
390 Ga0453684_0329672 3300044712 Bacteria 1726
391 Ga0453684_0375996 3300044712 Bacteria 1596
392 Ga0453684_0991192 3300044712 Bacteria 894
393 Ga0453684_1047869 3300044712 Bacteria 865
394 Ga0453684_1670318 3300044712 Bacteria 651
395 Ga0453684_1753045 3300044712 Bacteria 633
396 Ga0453684_1973335 3300044712 Bacteria 588
397 Ga0466971_0700988 3300044719 Bacteria 509
398 Ga0466957_1038814 3300044842 Bacteria 589
399 Ga0451576_0002027 3300045051 Bacteria 31971
400 Ga0451576_0009363 3300045051 Bacteria 11360
401 Ga0451576_0035370 3300045051 Bacteria 5300
402 Ga0451576_0487669 3300045051 Bacteria 1295
403 Ga0451576_0620389 3300045051 Bacteria 1136
404 Ga0451576_0792212 3300045051 Bacteria 995
405 Ga0451576_1921852 3300045051 Bacteria 610
406 Ga0466967_0021359 3300045976 Bacteria 5256
407 Ga0496101_0101511 3300048904 Bacteria 2154
408 Ga0496101_0951329 3300048904 Bacteria 676
409 Ga0496102_0123913 3300048905 Bacteria 2415
410 Ga0496104_0081017 3300048907 Bacteria 3095
411 Ga0496106_0379840 3300048909 Bacteria 1135
412 Ga0496107_0174147 3300048910 Bacteria 1597
413 Ga0496108_1431538 3300048911 Bacteria 577
414 Ga0496109_0273765 3300048912 Bacteria 1591
415 Ga0496109_1051622 3300048912 Bacteria 751
416 Ga0496110_0091463 3300048913 Bacteria 2722
417 Ga0496113_1079772 3300048916 Bacteria 630
418 Ga0496114_0124939 3300048917 Bacteria 2217
419 Ga0496117_0198713 3300048920 Bacteria 1135
420 Ga0501031_0128128 3300049568 Bacteria 1658
421 Ga0501031_0593471 3300049568 Bacteria 713
422 Ga0501032_0000863 3300049569 Bacteria 24630
423 Ga0501032_0007624 3300049569 Bacteria 7891
424 Ga0501034_0051254 3300049571 Bacteria 4161
425 Ga0501034_0244724 3300049571 Bacteria 1739
426 Ga0501034_0341520 3300049571 Bacteria 1427
427 Ga0501034_0438614 3300049571 Bacteria 1225
428 Ga0501034_0889253 3300049571 Bacteria 779
429 Ga0501038_0057638 3300049574 Bacteria 3334
430 Ga0501038_0860503 3300049574 Bacteria 671
431 Ga0501039_0030902 3300049575 Bacteria 4129
432 Ga0501039_0582805 3300049575 Bacteria 877
433 Ga0501039_0851211 3300049575 Bacteria 711
434 Ga0501040_0452684 3300049576 Bacteria 924
435 Ga0501041_1117660 3300049577 Bacteria 508
436 Ga0501043_0689809 3300049579 Bacteria 747
437 Ga0501047_0208371 3300049581 Bacteria 1814
438 Ga0501047_0275445 3300049581 Bacteria 1528
439 Ga0501048_0755510 3300049582 Bacteria 698
440 Ga0501067_0000127 3300049583 Bacteria 41508
441 Ga0501068_0009147 3300049584 Bacteria 5532
442 Ga0501073_0000006 3300049589 Bacteria 228761
443 Ga0501075_0395989 3300049591 Bacteria 1053
444 Ga0501076_1450874 3300049592 Bacteria 564
445 Ga0501225_0063452 3300049705 Bacteria 1042
446 Ga0501080_0002191 3300049742 Bacteria 16972
447 Ga0501080_0737550 3300049742 Bacteria 867
448 Ga0501080_1797873 3300049742 Bacteria 515
449 Ga0501083_0954645 3300049744 Bacteria 558
450 Ga0501035_0358368 3300049822 Bacteria 1219
451 Ga0501044_0015081 3300049823 Bacteria 8326
452 Ga0501045_0888142 3300049824 Bacteria 655
453 Ga0501045_0975159 3300049824 Bacteria 622
454 Ga0501226_000007 3300049853 Bacteria 227827
455 nmdc:mga0qj67_1574449_c1 3300050509 Bacteria 504
456 nmdc:mga06r32_345585_c1 3300050510 Bacteria 1472
457 nmdc:mga0a205_80220_c1 3300050515 Bacteria 3154
458 Ga0501084_0642191 3300054114 Bacteria 896
459 Ga0501084_1241533 3300054114 Bacteria 625
460 Ga0590074_012583 3300059423 Bacteria 1424
461 Ga0501082_0148347 3300060353 Bacteria 2037
462 Ga0501082_1625332 3300060353 Bacteria 564

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002239 JGI24034J26672_10068129 JGI24034J26672_100681292 89
2 3300002244 JGI24742J22300_10118869 JGI24742J22300_101188692 89
3 3300003405 JGI26132J50249_104774 JGI26132J50249_1047741 89
4 3300003503 JGI26141J51220_1011613 JGI26141J51220_10116132 89
5 3300005289 Ga0065704_10164877 Ga0065704_101648772 89
6 3300005328 Ga0070676_10000774 Ga0070676_100007746 89
7 3300005328 Ga0070676_10001175 Ga0070676_1000117512 89
8 3300005329 Ga0070683_100054794 Ga0070683_1000547942 89
9 3300005330 Ga0070690_100046925 Ga0070690_1000469254 89
10 3300005331 Ga0070670_100026878 Ga0070670_1000268783 89
11 3300005331 Ga0070670_100036317 Ga0070670_1000363175 89
12 3300005333 Ga0070677_10444375 Ga0070677_104443752 89
13 3300005334 Ga0068869_100003142 Ga0068869_1000031427 89
14 3300005334 Ga0068869_100004518 Ga0068869_1000045188 89
15 3300005335 Ga0070666_10000716 Ga0070666_100007161 89
16 3300005336 Ga0070680_100030043 Ga0070680_1000300433 89
17 3300005337 Ga0070682_100006507 Ga0070682_1000065075 89
18 3300005338 Ga0068868_100015154 Ga0068868_1000151545 89
19 3300005338 Ga0068868_100076397 Ga0068868_1000763974 89
20 3300005339 Ga0070660_100003613 Ga0070660_1000036137 89
21 3300005340 Ga0070689_100107834 Ga0070689_1001078343 89
22 3300005340 Ga0070689_100506128 Ga0070689_1005061283 89
23 3300005341 Ga0070691_10083633 Ga0070691_100836332 89
24 3300005344 Ga0070661_100003491 Ga0070661_1000034917 89
25 3300005347 Ga0070668_100001323 Ga0070668_10000132310 89
26 3300005353 Ga0070669_100001499 Ga0070669_1000014997 89
27 3300005353 Ga0070669_100009363 Ga0070669_1000093637 89
28 3300005354 Ga0070675_100003394 Ga0070675_1000033947 89
29 3300005354 Ga0070675_100125437 Ga0070675_1001254373 89
30 3300005355 Ga0070671_100008745 Ga0070671_1000087453 89
31 3300005355 Ga0070671_100171937 Ga0070671_1001719371 89
32 3300005356 Ga0070674_100024859 Ga0070674_1000248595 89
33 3300005364 Ga0070673_100001645 Ga0070673_1000016458 89
34 3300005365 Ga0070688_100024809 Ga0070688_1000248093 89
35 3300005365 Ga0070688_101017671 Ga0070688_1010176712 89
36 3300005366 Ga0070659_100011644 Ga0070659_1000116445 89
37 3300005367 Ga0070667_100001885 Ga0070667_1000018858 89
38 3300005367 Ga0070667_100047541 Ga0070667_1000475414 89
39 3300005406 Ga0070703_10008355 Ga0070703_100083552 89
40 3300005438 Ga0070701_10019598 Ga0070701_100195983 89
41 3300005440 Ga0070705_100015847 Ga0070705_1000158475 89
42 3300005441 Ga0070700_100120228 Ga0070700_1001202283 89
43 3300005444 Ga0070694_100078319 Ga0070694_1000783192 89
44 3300005445 Ga0070708_100000735 Ga0070708_10000073524 89
45 3300005445 Ga0070708_100591724 Ga0070708_1005917242 89
46 3300005455 Ga0070663_100018630 Ga0070663_1000186303 89
47 3300005456 Ga0070678_100001250 Ga0070678_1000012506 89
48 3300005457 Ga0070662_101372432 Ga0070662_1013724322 89
49 3300005458 Ga0070681_10025228 Ga0070681_100252284 89
50 3300005458 Ga0070681_10590122 Ga0070681_105901221 89
51 3300005459 Ga0068867_100013240 Ga0068867_1000132403 89
52 3300005466 Ga0070685_10053447 Ga0070685_100534473 89
53 3300005468 Ga0070707_101865562 Ga0070707_1018655621 89
54 3300005530 Ga0070679_100001879 Ga0070679_10000187917 89
55 3300005539 Ga0068853_100011113 Ga0068853_1000111132 89
56 3300005539 Ga0068853_100315486 Ga0068853_1003154862 89
57 3300005539 Ga0068853_100341055 Ga0068853_1003410553 89
58 3300005543 Ga0070672_100001970 Ga0070672_1000019703 89
59 3300005543 Ga0070672_100248023 Ga0070672_1002480232 89
60 3300005544 Ga0070686_101562126 Ga0070686_1015621261 89
61 3300005545 Ga0070695_100012223 Ga0070695_1000122232 89
62 3300005546 Ga0070696_100018398 Ga0070696_1000183982 89
63 3300005547 Ga0070693_100202346 Ga0070693_1002023462 89
64 3300005548 Ga0070665_100009908 Ga0070665_1000099083 89
65 3300005549 Ga0070704_100001689 Ga0070704_1000016895 89
66 3300005549 Ga0070704_101194675 Ga0070704_1011946752 89
67 3300005563 Ga0068855_100011388 Ga0068855_1000113887 89
68 3300005564 Ga0070664_100036940 Ga0070664_1000369405 89
69 3300005577 Ga0068857_100197024 Ga0068857_1001970243 89
70 3300005578 Ga0068854_100002332 Ga0068854_1000023323 89
71 3300005614 Ga0068856_100154544 Ga0068856_1001545442 89
72 3300005615 Ga0070702_100236596 Ga0070702_1002365963 89
73 3300005616 Ga0068852_100436931 Ga0068852_1004369313 89
74 3300005617 Ga0068859_100006568 Ga0068859_1000065685 89
75 3300005617 Ga0068859_100007175 Ga0068859_1000071757 89
76 3300005618 Ga0068864_100006114 Ga0068864_1000061147 89
77 3300005618 Ga0068864_100025840 Ga0068864_1000258405 89
78 3300005718 Ga0068866_10566168 Ga0068866_105661682 89
79 3300005718 Ga0068866_10710406 Ga0068866_107104062 89
80 3300005719 Ga0068861_100006024 Ga0068861_1000060245 89
81 3300005719 Ga0068861_100025326 Ga0068861_1000253262 89
82 3300005840 Ga0068870_10003489 Ga0068870_100034895 89
83 3300005840 Ga0068870_10254225 Ga0068870_102542252 89
84 3300005841 Ga0068863_100002793 Ga0068863_10000279312 89
85 3300005841 Ga0068863_100029243 Ga0068863_1000292434 89
86 3300005842 Ga0068858_100005140 Ga0068858_1000051405 89
87 3300005842 Ga0068858_100016786 Ga0068858_1000167865 89
88 3300005843 Ga0068860_100005023 Ga0068860_1000050236 89
89 3300005843 Ga0068860_100007534 Ga0068860_1000075345 89
90 3300005844 Ga0068862_100009111 Ga0068862_1000091117 89
91 3300006173 Ga0070716_100895512 Ga0070716_1008955122 89
92 3300006237 Ga0097621_100001779 Ga0097621_1000017799 89
93 3300006358 Ga0068871_100003595 Ga0068871_1000035955 89
94 3300006844 Ga0075428_100478377 Ga0075428_1004783772 89
95 3300006847 Ga0075431_100463165 Ga0075431_1004631653 89
96 3300006847 Ga0075431_100650680 Ga0075431_1006506802 89
97 3300006852 Ga0075433_10007076 Ga0075433_100070767 89
98 3300006871 Ga0075434_100041765 Ga0075434_1000417655 89
99 3300006880 Ga0075429_100425903 Ga0075429_1004259032 89
100 3300006881 Ga0068865_100001873 Ga0068865_1000018732 89
101 3300006931 Ga0097620_100006568 Ga0097620_1000065685 89
102 3300006931 Ga0097620_100007175 Ga0097620_1000071757 89
103 3300009036 Ga0105244_10008784 Ga0105244_100087845 89
104 3300009092 Ga0105250_10551260 Ga0105250_105512602 89
105 3300009093 Ga0105240_10260136 Ga0105240_102601363 89
106 3300009098 Ga0105245_10041799 Ga0105245_100417993 89
107 3300009147 Ga0114129_11180619 Ga0114129_111806191 89
108 3300009148 Ga0105243_10498303 Ga0105243_104983032 89
109 3300009148 Ga0105243_11213910 Ga0105243_112139102 89
110 3300009174 Ga0105241_10009352 Ga0105241_100093527 89
111 3300009177 Ga0105248_10018359 Ga0105248_100183596 89
112 3300009545 Ga0105237_10052739 Ga0105237_100527393 89
113 3300009553 Ga0105249_10459918 Ga0105249_104599182 89
114 3300011119 Ga0105246_12099753 Ga0105246_120997532 89
115 3300013100 Ga0157373_10020097 Ga0157373_100200972 89
116 3300013100 Ga0157373_10069426 Ga0157373_100694263 89
117 3300013100 Ga0157373_10372844 Ga0157373_103728443 89
118 3300013102 Ga0157371_10011030 Ga0157371_100110303 89
119 3300013102 Ga0157371_10040071 Ga0157371_100400712 89
120 3300013102 Ga0157371_10079814 Ga0157371_100798142 89
121 3300013102 Ga0157371_10338413 Ga0157371_103384132 89
122 3300013104 Ga0157370_10127411 Ga0157370_101274114 89
123 3300013105 Ga0157369_10001875 Ga0157369_1000187518 89
124 3300013105 Ga0157369_10005244 Ga0157369_1000524413 89
125 3300013296 Ga0157374_10003539 Ga0157374_100035394 89
126 3300013297 Ga0157378_10056099 Ga0157378_100560993 89
127 3300013297 Ga0157378_10244106 Ga0157378_102441063 89
128 3300013306 Ga0163162_10054335 Ga0163162_100543353 89
129 3300013307 Ga0157372_10003171 Ga0157372_100031715 89
130 3300013307 Ga0157372_10212337 Ga0157372_102123371 89
131 3300013307 Ga0157372_10389706 Ga0157372_103897061 89
132 3300013308 Ga0157375_10006411 Ga0157375_100064115 89
133 3300014325 Ga0163163_10096096 Ga0163163_100960963 89
134 3300014325 Ga0163163_10202503 Ga0163163_102025033 89
135 3300014326 Ga0157380_10243505 Ga0157380_102435052 89
136 3300014326 Ga0157380_10734070 Ga0157380_107340702 89
137 3300014745 Ga0157377_10128870 Ga0157377_101288702 89
138 3300014968 Ga0157379_10004073 Ga0157379_1000407311 89
139 3300014969 Ga0157376_10003562 Ga0157376_100035625 89
140 3300015261 Ga0182006_1142703 Ga0182006_11427032 89
141 3300015262 Ga0182007_10008129 Ga0182007_100081295 89
142 3300017792 Ga0163161_10223478 Ga0163161_102234783 89
143 3300025315 Ga0207697_10028171 Ga0207697_100281712 89
144 3300025315 Ga0207697_10240665 Ga0207697_102406652 89
145 3300025735 Ga0207713_1005333 Ga0207713_10053338 89
146 3300025885 Ga0207653_10002179 Ga0207653_100021794 89
147 3300025899 Ga0207642_10906431 Ga0207642_109064312 89
148 3300025901 Ga0207688_10009535 Ga0207688_100095354 89
149 3300025903 Ga0207680_10044818 Ga0207680_100448184 89
150 3300025903 Ga0207680_10395679 Ga0207680_103956793 89
151 3300025904 Ga0207647_10028049 Ga0207647_100280495 89
152 3300025907 Ga0207645_10000812 Ga0207645_1000081219 89
153 3300025907 Ga0207645_10002937 Ga0207645_1000293712 89
154 3300025908 Ga0207643_10000722 Ga0207643_100007226 89
155 3300025911 Ga0207654_10061354 Ga0207654_100613543 89
156 3300025912 Ga0207707_10002355 Ga0207707_100023556 89
157 3300025913 Ga0207695_10204409 Ga0207695_102044093 89
158 3300025917 Ga0207660_10014617 Ga0207660_100146171 89
159 3300025918 Ga0207662_10059424 Ga0207662_100594242 89
160 3300025919 Ga0207657_10000385 Ga0207657_1000038537 89
161 3300025920 Ga0207649_10015334 Ga0207649_100153341 89
162 3300025921 Ga0207652_10016056 Ga0207652_100160565 89
163 3300025922 Ga0207646_11749377 Ga0207646_117493772 89
164 3300025923 Ga0207681_10002868 Ga0207681_100028687 89
165 3300025925 Ga0207650_10034483 Ga0207650_100344832 89
166 3300025925 Ga0207650_10072929 Ga0207650_100729293 89
167 3300025926 Ga0207659_10002225 Ga0207659_100022256 89
168 3300025926 Ga0207659_10452460 Ga0207659_104524602 89
169 3300025927 Ga0207687_11282719 Ga0207687_112827192 89
170 3300025931 Ga0207644_10006005 Ga0207644_100060055 89
171 3300025931 Ga0207644_10525031 Ga0207644_105250313 89
172 3300025933 Ga0207706_10003911 Ga0207706_100039117 89
173 3300025933 Ga0207706_10506718 Ga0207706_105067182 89
174 3300025935 Ga0207709_10743267 Ga0207709_107432672 89
175 3300025935 Ga0207709_11053032 Ga0207709_110530322 89
176 3300025936 Ga0207670_10084284 Ga0207670_100842843 89
177 3300025936 Ga0207670_10622446 Ga0207670_106224462 89
178 3300025937 Ga0207669_10014819 Ga0207669_100148193 89
179 3300025938 Ga0207704_10003782 Ga0207704_100037822 89
180 3300025940 Ga0207691_10000041 Ga0207691_1000004118 89
181 3300025940 Ga0207691_10260034 Ga0207691_102600342 89
182 3300025941 Ga0207711_10054791 Ga0207711_100547913 89
183 3300025942 Ga0207689_10000204 Ga0207689_1000020447 89
184 3300025942 Ga0207689_10030654 Ga0207689_100306544 89
185 3300025944 Ga0207661_10411109 Ga0207661_104111092 89
186 3300025945 Ga0207679_10035706 Ga0207679_100357063 89
187 3300025949 Ga0207667_10007006 Ga0207667_100070066 89
188 3300025960 Ga0207651_10029214 Ga0207651_100292143 89
189 3300025961 Ga0207712_10291253 Ga0207712_102912533 89
190 3300025972 Ga0207668_10010094 Ga0207668_100100943 89
191 3300025972 Ga0207668_10821323 Ga0207668_108213232 89
192 3300025981 Ga0207640_10066771 Ga0207640_100667713 89
193 3300025986 Ga0207658_10004908 Ga0207658_100049086 89
194 3300025986 Ga0207658_10263507 Ga0207658_102635072 89
195 3300026023 Ga0207677_10006748 Ga0207677_100067483 89
196 3300026023 Ga0207677_10056106 Ga0207677_100561064 89
197 3300026035 Ga0207703_10004130 Ga0207703_100041305 89
198 3300026041 Ga0207639_10011721 Ga0207639_100117213 89
199 3300026041 Ga0207639_10372952 Ga0207639_103729521 89
200 3300026067 Ga0207678_10041350 Ga0207678_100413503 89
201 3300026075 Ga0207708_10236409 Ga0207708_102364092 89
202 3300026078 Ga0207702_10033285 Ga0207702_100332855 89
203 3300026088 Ga0207641_10001249 Ga0207641_100012499 89
204 3300026089 Ga0207648_10001461 Ga0207648_100014613 89
205 3300026089 Ga0207648_10004390 Ga0207648_100043909 89
206 3300026095 Ga0207676_10005257 Ga0207676_100052574 89
207 3300026095 Ga0207676_10017371 Ga0207676_100173713 89
208 3300026116 Ga0207674_10001950 Ga0207674_1000195021 89
209 3300026118 Ga0207675_100005135 Ga0207675_1000051358 89
210 3300026118 Ga0207675_100008371 Ga0207675_1000083717 89
211 3300026121 Ga0207683_10000011 Ga0207683_1000001199 89
212 3300027312 Ga0209371_1000135 Ga0209371_100013574 89
213 3300027360 Ga0209969_1009261 Ga0209969_10092613 89
214 3300027378 Ga0209981_1046028 Ga0209981_10460282 89
215 3300027395 Ga0209996_1000510 Ga0209996_10005105 89
216 3300027424 Ga0209984_1001665 Ga0209984_10016653 89
217 3300027462 Ga0210000_1053272 Ga0210000_10532722 89
218 3300027471 Ga0209995_1053270 Ga0209995_10532702 89
219 3300027526 Ga0209968_1067782 Ga0209968_10677822 89
220 3300027543 Ga0209999_1034324 Ga0209999_10343242 89
221 3300027552 Ga0209982_1090629 Ga0209982_10906292 89
222 3300027614 Ga0209970_1064884 Ga0209970_10648842 89
223 3300027617 Ga0210002_1006419 Ga0210002_10064192 89
224 3300027665 Ga0209983_1002354 Ga0209983_10023545 89
225 3300027682 Ga0209971_1004302 Ga0209971_10043023 89
226 3300027682 Ga0209971_1192739 Ga0209971_11927392 89
227 3300027876 Ga0209974_10016365 Ga0209974_100163653 89
228 3300028379 Ga0268266_10009550 Ga0268266_100095508 89
229 3300028380 Ga0268265_10133019 Ga0268265_101330192 89
230 3300028381 Ga0268264_10011762 Ga0268264_100117622 89
231 3300028381 Ga0268264_10037926 Ga0268264_100379265 89
232 3300030500 Ga0268256_1000148 Ga0268256_100014874 89
233 3300031548 Ga0307408_100000005 Ga0307408_10000000534 89
234 3300031548 Ga0307408_100954931 Ga0307408_1009549312 89
235 3300031691 Ga0316579_10006926 Ga0316579_100069265 89
236 3300031691 Ga0316579_10182880 Ga0316579_101828802 89
237 3300031691 Ga0316579_10221246 Ga0316579_102212462 89
238 3300031691 Ga0316579_10485042 Ga0316579_104850422 89
239 3300031727 Ga0316576_10000526 Ga0316576_100005263 89
240 3300031727 Ga0316576_10025645 Ga0316576_100256453 89
241 3300031727 Ga0316576_10052640 Ga0316576_100526403 89
242 3300031727 Ga0316576_10054830 Ga0316576_100548302 89
243 3300031727 Ga0316576_10077273 Ga0316576_100772734 89
244 3300031727 Ga0316576_10130658 Ga0316576_101306582 89
245 3300031727 Ga0316576_10145946 Ga0316576_101459463 89
246 3300031727 Ga0316576_10164301 Ga0316576_101643012 89
247 3300031727 Ga0316576_10261132 Ga0316576_102611322 89
248 3300031727 Ga0316576_10496834 Ga0316576_104968342 89
249 3300031727 Ga0316576_10804794 Ga0316576_108047942 89
250 3300031727 Ga0316576_10869668 Ga0316576_108696682 89
251 3300031728 Ga0316578_10007930 Ga0316578_100079303 89
252 3300031728 Ga0316578_10008122 Ga0316578_100081223 89
253 3300031728 Ga0316578_10012798 Ga0316578_100127984 89
254 3300031728 Ga0316578_10029330 Ga0316578_100293303 89
255 3300031728 Ga0316578_10043372 Ga0316578_100433723 89
256 3300031728 Ga0316578_10047387 Ga0316578_100473873 89
257 3300031728 Ga0316578_10054639 Ga0316578_100546392 89
258 3300031728 Ga0316578_10066182 Ga0316578_100661823 89
259 3300031728 Ga0316578_10130558 Ga0316578_101305583 89
260 3300031728 Ga0316578_10139890 Ga0316578_101398902 89
261 3300031728 Ga0316578_10156880 Ga0316578_101568801 89
262 3300031728 Ga0316578_10194416 Ga0316578_101944162 89
263 3300031728 Ga0316578_10205360 Ga0316578_102053602 89
264 3300031728 Ga0316578_10230852 Ga0316578_102308522 89
265 3300031728 Ga0316578_10276289 Ga0316578_102762892 89
266 3300031733 Ga0316577_10015253 Ga0316577_100152533 89
267 3300031733 Ga0316577_10015859 Ga0316577_100158595 89
268 3300031733 Ga0316577_10023832 Ga0316577_100238321 89
269 3300031733 Ga0316577_10123391 Ga0316577_101233912 89
270 3300031733 Ga0316577_10311833 Ga0316577_103118332 89
271 3300031733 Ga0316577_10347275 Ga0316577_103472752 89
272 3300031733 Ga0316577_10397618 Ga0316577_103976182 89
273 3300031733 Ga0316577_10421352 Ga0316577_104213522 89
274 3300031733 Ga0316577_10655854 Ga0316577_106558542 89
275 3300031733 Ga0316577_10709813 Ga0316577_107098132 89
276 3300031733 Ga0316577_10724964 Ga0316577_107249641 89
277 3300031901 Ga0307406_10000700 Ga0307406_100007006 89
278 3300031901 Ga0307406_10601568 Ga0307406_106015682 89
279 3300032133 Ga0316583_10004764 Ga0316583_100047643 89
280 3300032133 Ga0316583_10060104 Ga0316583_100601042 89
281 3300032133 Ga0316583_10119462 Ga0316583_101194622 89
282 3300032133 Ga0316583_10296583 Ga0316583_102965832 89
283 3300032137 Ga0316585_10005021 Ga0316585_100050213 89
284 3300032137 Ga0316585_10065243 Ga0316585_100652433 89
285 3300032137 Ga0316585_10083287 Ga0316585_100832872 89
286 3300032137 Ga0316585_10093495 Ga0316585_100934952 89
287 3300032137 Ga0316585_10105099 Ga0316585_101050992 89
288 3300032139 Ga0316580_10004071 Ga0316580_100040713 89
289 3300032139 Ga0316580_10010047 Ga0316580_100100473 89
290 3300032139 Ga0316580_10013867 Ga0316580_100138673 89
291 3300032139 Ga0316580_10018053 Ga0316580_100180533 89
292 3300032139 Ga0316580_10022901 Ga0316580_100229013 89
293 3300032139 Ga0316580_10054900 Ga0316580_100549002 89
294 3300032139 Ga0316580_10060526 Ga0316580_100605262 89
295 3300032139 Ga0316580_10067492 Ga0316580_100674921 89
296 3300032139 Ga0316580_10092838 Ga0316580_100928382 89
297 3300032139 Ga0316580_10173072 Ga0316580_101730722 89
298 3300032168 Ga0316593_10019682 Ga0316593_100196823 89
299 3300032168 Ga0316593_10026378 Ga0316593_100263782 89
300 3300032168 Ga0316593_10061858 Ga0316593_100618581 89
301 3300032168 Ga0316593_10078007 Ga0316593_100780072 89
302 3300033524 Ga0316592_1004112 Ga0316592_10041124 89
303 3300033524 Ga0316592_1123290 Ga0316592_11232902 89
304 3300033528 Ga0316588_1017143 Ga0316588_10171433 89
305 3300033528 Ga0316588_1181053 Ga0316588_11810532 89
306 3300033529 Ga0316587_1015201 Ga0316587_10152013 89
307 3300033541 Ga0316596_1000810 Ga0316596_10008104 89
308 3300033541 Ga0316596_1006474 Ga0316596_10064742 89
309 3300033541 Ga0316596_1019803 Ga0316596_10198033 89
310 3300033541 Ga0316596_1145304 Ga0316596_11453042 89
311 3300033541 Ga0316596_1196606 Ga0316596_11966061 89
312 3300034816 Ga0373930_0052665 Ga0373930_0052665_10_279 89
313 3300034817 Ga0373948_0100055 Ga0373948_0100055_346_615 89
314 3300034819 Ga0373958_0028645 Ga0373958_0028645_466_735 89
315 3300034820 Ga0373959_0040166 Ga0373959_0040166_484_753 89
316 3300035090 Ga0373949_0005972 Ga0373949_0005972_489_758 89
317 3300035091 Ga0373951_0006144 Ga0373951_0006144_1723_1992 89
318 3300035121 Ga0373960_0015681 Ga0373960_0015681_465_734 89
319 3300035398 Ga0316574_0015612 Ga0316574_0015612_2770_3039 89
320 3300035398 Ga0316574_0070958 Ga0316574_0070958_641_937 89
321 3300035398 Ga0316574_0269787 Ga0316574_0269787_349_618 89
322 3300035398 Ga0316574_0279312 Ga0316574_0279312_260_556 89
323 3300035398 Ga0316574_0313237 Ga0316574_0313237_53_349 89
324 3300035398 Ga0316574_0324412 Ga0316574_0324412_196_465 89
325 3300035398 Ga0316574_0464367 Ga0316574_0464367_453_722 89
326 3300035398 Ga0316574_0508626 Ga0316574_0508626_225_521 89
327 3300035398 Ga0316574_0587098 Ga0316574_0587098_167_463 89
328 3300035398 Ga0316574_0870927 Ga0316574_0870927_112_381 89
329 3300035691 Ga0373931_0262611 Ga0373931_0262611_684_953 89
330 3300035691 Ga0373931_0352674 Ga0373931_0352674_40_309 89
331 3300036401 Ga0373937_0281135 Ga0373937_0281135_432_701 89
332 3300036647 Ga0316582_0020796 Ga0316582_0020796_1887_2183 89
333 3300036647 Ga0316582_0042852 Ga0316582_0042852_2236_2532 89
334 3300036647 Ga0316582_0112500 Ga0316582_0112500_949_1218 89
335 3300036647 Ga0316582_0141652 Ga0316582_0141652_858_1154 89
336 3300036647 Ga0316582_0203050 Ga0316582_0203050_768_1037 89
337 3300036647 Ga0316582_0266253 Ga0316582_0266253_42_338 89
338 3300036647 Ga0316582_0594890 Ga0316582_0594890_438_716 89
339 3300036647 Ga0316582_0932133 Ga0316582_0932133_273_542 89
340 3300036712 Ga0316584_0004497 Ga0316584_0004497_302_571 89
341 3300036712 Ga0316584_0009304 Ga0316584_0009304_2132_2428 89
342 3300036712 Ga0316584_0009994 Ga0316584_0009994_71_367 89
343 3300036712 Ga0316584_0014968 Ga0316584_0014968_384_662 89
344 3300036712 Ga0316584_0020077 Ga0316584_0020077_1657_1953 89
345 3300036712 Ga0316584_0030384 Ga0316584_0030384_2219_2515 89
346 3300036712 Ga0316584_0048007 Ga0316584_0048007_1784_2053 89
347 3300036712 Ga0316584_0061957 Ga0316584_0061957_982_1251 89
348 3300036712 Ga0316584_0066820 Ga0316584_0066820_81_350 89
349 3300036712 Ga0316584_0075823 Ga0316584_0075823_595_864 89
350 3300036712 Ga0316584_0182628 Ga0316584_0182628_201_470 89
351 3300036712 Ga0316584_0329937 Ga0316584_0329937_169_438 89
352 3300037588 Ga0316581_0038722 Ga0316581_0038722_622_918 89
353 3300037588 Ga0316581_0068440 Ga0316581_0068440_315_584 89
354 3300041404 Ga0439436_0000830 Ga0439436_0000830_1202_1471 89
355 3300041405 Ga0439438_004091 Ga0439438_004091_4993_5262 89
356 3300041407 Ga0439447_013306 Ga0439447_013306_539_808 89
357 3300041411 Ga0439466_0002812 Ga0439466_0002812_4449_4718 89
358 3300041411 Ga0439466_0005862 Ga0439466_0005862_2393_2662 89
359 3300041456 Ga0451795_0567030 Ga0451795_0567030_187_468 89
360 3300041460 Ga0451802_0735241 Ga0451802_0735241_298_579 89
361 3300041486 Ga0451807_0147622 Ga0451807_0147622_42_323 89
362 3300041997 Ga0439431_0013990 Ga0439431_0013990_1523_1792 89
363 3300041997 Ga0439431_0030818 Ga0439431_0030818_390_659 89
364 3300042005 Ga0439448_0006423 Ga0439448_0006423_2653_2922 89
365 3300042006 Ga0439432_000779 Ga0439432_000779_10040_10309 89
366 3300042013 Ga0439456_032414 Ga0439456_032414_202_471 89
367 3300042115 Ga0450911_000002 Ga0450911_000002_63544_63813 89
368 3300042117 Ga0450913_002648 Ga0450913_002648_264_533 89
369 3300042118 Ga0450914_051973 Ga0450914_051973_177_446 89
370 3300042120 Ga0450917_002513 Ga0450917_002513_363_632 89
371 3300042125 Ga0450923_000487 Ga0450923_000487_2598_2867 89
372 3300042130 Ga0450892_017721 Ga0450892_017721_315_584 89
373 3300042139 Ga0450904_000036 Ga0450904_000036_11173_11442 89
374 3300042144 Ga0450889_006048 Ga0450889_006048_476_745 89
375 3300042156 Ga0439446_0007073 Ga0439446_0007073_2010_2279 89
376 3300042156 Ga0439446_0014280 Ga0439446_0014280_954_1223 89
377 3300042156 Ga0439446_0223398 Ga0439446_0223398_246_515 89
378 3300042185 Ga0450909_083248 Ga0450909_083248_58_327 89
379 3300042438 Ga0439459_0027725 Ga0439459_0027725_261_530 89
380 3300042439 Ga0439464_0003612 Ga0439464_0003612_284_553 89
381 3300042532 Ga0450893_0001318 Ga0450893_0001318_3406_3675 89
382 3300042532 Ga0450893_0013164 Ga0450893_0013164_46_315 89
383 3300042876 Ga0451577_0017761 Ga0451577_0017761_816_1091 89
384 3300042876 Ga0451577_0018905 Ga0451577_0018905_6006_6275 89
385 3300042876 Ga0451577_0020696 Ga0451577_0020696_3220_3492 89
386 3300042876 Ga0451577_0029460 Ga0451577_0029460_4653_4925 89
387 3300042876 Ga0451577_0220398 Ga0451577_0220398_1134_1406 89
388 3300042876 Ga0451577_0775379 Ga0451577_0775379_430_705 89
389 3300042876 Ga0451577_1295757 Ga0451577_1295757_73_342 89
390 3300044712 Ga0453684_0329672 Ga0453684_0329672_700_969 89
391 3300044712 Ga0453684_0375996 Ga0453684_0375996_800_1072 89
392 3300044712 Ga0453684_0991192 Ga0453684_0991192_544_816 89
393 3300044712 Ga0453684_1047869 Ga0453684_1047869_113_388 89
394 3300044712 Ga0453684_1670318 Ga0453684_1670318_367_636 89
395 3300044712 Ga0453684_1753045 Ga0453684_1753045_223_492 89
396 3300044712 Ga0453684_1973335 Ga0453684_1973335_257_532 89
397 3300044719 Ga0466971_0700988 Ga0466971_0700988_216_491 89
398 3300044842 Ga0466957_1038814 Ga0466957_1038814_243_518 89
399 3300045051 Ga0451576_0002027 Ga0451576_0002027_21531_21803 89
400 3300045051 Ga0451576_0009363 Ga0451576_0009363_10434_10703 89
401 3300045051 Ga0451576_0035370 Ga0451576_0035370_272_544 89
402 3300045051 Ga0451576_0487669 Ga0451576_0487669_992_1261 89
403 3300045051 Ga0451576_0620389 Ga0451576_0620389_406_681 89
404 3300045051 Ga0451576_0792212 Ga0451576_0792212_294_569 89
405 3300045051 Ga0451576_1921852 Ga0451576_1921852_175_447 89
406 3300045976 Ga0466967_0021359 Ga0466967_0021359_3681_3956 89
407 3300048904 Ga0496101_0101511 Ga0496101_0101511_1271_1540 89
408 3300048904 Ga0496101_0951329 Ga0496101_0951329_246_515 89
409 3300048905 Ga0496102_0123913 Ga0496102_0123913_1296_1565 89
410 3300048907 Ga0496104_0081017 Ga0496104_0081017_2328_2606 89
411 3300048909 Ga0496106_0379840 Ga0496106_0379840_683_952 89
412 3300048910 Ga0496107_0174147 Ga0496107_0174147_506_775 89
413 3300048911 Ga0496108_1431538 Ga0496108_1431538_275_544 89
414 3300048912 Ga0496109_0273765 Ga0496109_0273765_729_998 89
415 3300048912 Ga0496109_1051622 Ga0496109_1051622_382_651 89
416 3300048913 Ga0496110_0091463 Ga0496110_0091463_576_845 89
417 3300048916 Ga0496113_1079772 Ga0496113_1079772_17_286 89
418 3300048917 Ga0496114_0124939 Ga0496114_0124939_259_528 89
419 3300048920 Ga0496117_0198713 Ga0496117_0198713_650_919 89
420 3300049568 Ga0501031_0128128 Ga0501031_0128128_582_851 89
421 3300049568 Ga0501031_0593471 Ga0501031_0593471_179_454 89
422 3300049569 Ga0501032_0000863 Ga0501032_0000863_4372_4647 89
423 3300049569 Ga0501032_0007624 Ga0501032_0007624_7172_7441 89
424 3300049571 Ga0501034_0051254 Ga0501034_0051254_3234_3503 89
425 3300049571 Ga0501034_0244724 Ga0501034_0244724_276_545 89
426 3300049571 Ga0501034_0341520 Ga0501034_0341520_954_1223 89
427 3300049571 Ga0501034_0438614 Ga0501034_0438614_607_876 89
428 3300049571 Ga0501034_0889253 Ga0501034_0889253_489_758 89
429 3300049574 Ga0501038_0057638 Ga0501038_0057638_950_1219 89
430 3300049574 Ga0501038_0860503 Ga0501038_0860503_323_592 89
431 3300049575 Ga0501039_0030902 Ga0501039_0030902_3232_3501 89
432 3300049575 Ga0501039_0582805 Ga0501039_0582805_244_519 89
433 3300049575 Ga0501039_0851211 Ga0501039_0851211_66_335 89
434 3300049576 Ga0501040_0452684 Ga0501040_0452684_156_425 89
435 3300049577 Ga0501041_1117660 Ga0501041_1117660_64_333 89
436 3300049579 Ga0501043_0689809 Ga0501043_0689809_226_495 89
437 3300049581 Ga0501047_0208371 Ga0501047_0208371_755_1024 89
438 3300049581 Ga0501047_0275445 Ga0501047_0275445_125_406 89
439 3300049582 Ga0501048_0755510 Ga0501048_0755510_238_507 89
440 3300049583 Ga0501067_0000127 Ga0501067_0000127_31956_32231 89
441 3300049584 Ga0501068_0009147 Ga0501068_0009147_5041_5316 89
442 3300049589 Ga0501073_0000006 Ga0501073_0000006_208839_209114 89
443 3300049591 Ga0501075_0395989 Ga0501075_0395989_757_1026 89
444 3300049592 Ga0501076_1450874 Ga0501076_1450874_222_491 89
445 3300049705 Ga0501225_0063452 Ga0501225_0063452_41_310 89
446 3300049742 Ga0501080_0002191 Ga0501080_0002191_16128_16403 89
447 3300049742 Ga0501080_0737550 Ga0501080_0737550_193_462 89
448 3300049742 Ga0501080_1797873 Ga0501080_1797873_196_465 89
449 3300049744 Ga0501083_0954645 Ga0501083_0954645_158_433 89
450 3300049822 Ga0501035_0358368 Ga0501035_0358368_878_1147 89
451 3300049823 Ga0501044_0015081 Ga0501044_0015081_1638_1913 89
452 3300049824 Ga0501045_0888142 Ga0501045_0888142_68_337 89
453 3300049824 Ga0501045_0975159 Ga0501045_0975159_73_342 89
454 3300049853 Ga0501226_000007 Ga0501226_000007_201054_201323 89
455 3300050509 nmdc:mga0qj67_1574449_c1 nmdc:mga0qj67_1574449_c1_61_330 89
456 3300050510 nmdc:mga06r32_345585_c1 nmdc:mga06r32_345585_c1_506_775 89
457 3300050515 nmdc:mga0a205_80220_c1 nmdc:mga0a205_80220_c1_2258_2527 89
458 3300054114 Ga0501084_0642191 Ga0501084_0642191_202_477 89
459 3300054114 Ga0501084_1241533 Ga0501084_1241533_140_409 89
460 3300059423 Ga0590074_012583 Ga0590074_012583_766_1035 89
461 3300060353 Ga0501082_0148347 Ga0501082_0148347_41_316 89
462 3300060353 Ga0501082_1625332 Ga0501082_1625332_272_541 89

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04066

MrpF_PhaF

Multiple resistance and pH regulation protein F (MrpF / PhaF)

53

105

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cj3-assembly1.cif.gz_A crystal structure of the transmembrane domain of salpingoeca rosetta rhodopsin phosphodiesterase 0.921 3 54
7qru-assembly1.cif.gz_F structure of bacillus pseudofirmus mrp antiporter complex, monomer 0.9123 1 88
7n0e-assembly1.cif.gz_B co-complex of the histidine kinase region of rets and the dimerization and histidine phosphotransfer domain of gacs 0.9093 3 54
6z16-assembly1.cif.gz_f structure of the mrp antiporter complex 0.9024 6 89
7qru-assembly1.cif.gz_F structure of bacillus pseudofirmus mrp antiporter complex, monomer 0.8936 1 88
ID Description Score Start End Superfamily
6g72K00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9172 7 84 1.10.287.3510
af_A0A0R0I378_34_190_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8965 6 55 1.20.1260.10
af_P81309_1_82_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8716 9 85 1.10.287.3510
5xtdk00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8335 7 81 1.10.287.3510
af_P03926_3_170_1.20.120.1200 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);NADH-ubiquinone/plastoquinone oxidoreductase chain 6, subunit NuoJ 0.825 10 86 1.20.120.1200
ID Description Score Start End GO Terms
AF-A0A6B1G8P7-F1-model_v4 Cation transporter 0.9897 6 80 GO:0005886
GO:0015385
AF-A0A2A6RLA1-F1-model_v4 Cation transporter 0.9821 4 85 GO:0005886
GO:0015385
AF-A0A6N8WCM8-F1-model_v4 pH regulation protein F 0.9821 6 84 GO:0005886
GO:0015385
AF-A0A3B8UC84-F1-model_v4 Sodium:proton antiporter 0.981 4 80 GO:0005886
GO:0015385
AF-A0A178P621-F1-model_v4 deleted 0.9781 5 89

Feature Viewer

pLDDT pTM Quality
85.9 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map