F448916

General Info

Members Datasets Scaffolds Average Seq Length
462 243 924 107

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_11882200|Ga0157372_118822002
Length 119
Sequence LQDLLIDHGVVIALVCAACAVLYGVVTSRHLVHLVLCVGVAQASTYVLLLAIGYRVGGRAPIFFDIPPGTPVVDPVVQALTLTDVVVGTTVTAMLLAIAVQAHKRYGSLDPDELREMRG

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
141 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
144 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
145 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
146 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
147 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
148 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
149 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
176 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
177 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
178 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
181 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
182 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
224 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
225 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
226 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
227 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
228 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
229 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
230 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
231 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
232 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
233 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
234 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
235 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
236 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
237 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
238 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
239 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
241 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
242 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
243 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.05
Metatranscriptomes 1.3
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.25
Nodule 0
Rhizoplane 11.04
Rhizosphere 83.55
Stem 0
Stem Tuber 0.22
Unclassified 6.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_11882200 3300013307 Bacteria 688
2 Ga0070658_10881557 3300005327 Unclassified 778
3 Ga0070683_100041408 3300005329 Bacteria 4237
4 Ga0070683_100116292 3300005329 Bacteria 2525
5 Ga0070683_100192207 3300005329 Bacteria 1938
6 Ga0070683_100497336 3300005329 Bacteria 1165
7 Ga0070683_100647487 3300005329 Bacteria 1012
8 Ga0070680_100055397 3300005336 Bacteria 3240
9 Ga0070680_100224410 3300005336 Unclassified 1586
10 Ga0070682_100027532 3300005337 Bacteria 3412
11 Ga0070682_100316355 3300005337 Bacteria 1151
12 Ga0068868_100659065 3300005338 Bacteria 933
13 Ga0070661_100843896 3300005344 Bacteria 754
14 Ga0070692_10055223 3300005345 Bacteria 2076
15 Ga0070668_100601285 3300005347 Bacteria 962
16 Ga0070674_100212858 3300005356 Bacteria 1499
17 Ga0070688_101182047 3300005365 Bacteria 614
18 Ga0070659_100217356 3300005366 Bacteria 1577
19 Ga0070659_100935275 3300005366 Bacteria 759
20 Ga0070659_101497475 3300005366 Bacteria 601
21 Ga0070709_11791683 3300005434 Bacteria 502
22 Ga0070714_100026506 3300005435 Unclassified 4791
23 Ga0070713_100000005 3300005436 Bacteria 201526
24 Ga0070713_100695907 3300005436 Bacteria 970
25 Ga0070713_101049167 3300005436 Bacteria 787
26 Ga0070710_10674269 3300005437 Bacteria 727
27 Ga0070705_101393867 3300005440 Bacteria 584
28 Ga0070663_100595959 3300005455 Bacteria 929
29 Ga0070663_100848248 3300005455 Bacteria 786
30 Ga0070685_10862689 3300005466 Bacteria 671
31 Ga0070679_101496574 3300005530 Bacteria 622
32 Ga0070684_100029917 3300005535 Bacteria 4622
33 Ga0070684_100054695 3300005535 Bacteria 3477
34 Ga0070684_100501139 3300005535 Bacteria 1125
35 Ga0070684_101135516 3300005535 Unclassified 734
36 Ga0070684_102217544 3300005535 Bacteria 518
37 Ga0068853_100195909 3300005539 Bacteria 1837
38 Ga0070672_101816292 3300005543 Bacteria 548
39 Ga0070686_100480805 3300005544 Bacteria 960
40 Ga0070696_101246295 3300005546 Bacteria 630
41 Ga0070693_100058313 3300005547 Bacteria 2234
42 Ga0070665_101564588 3300005548 Bacteria 667
43 Ga0068855_100089601 3300005563 Bacteria 3551
44 Ga0070664_100123776 3300005564 Bacteria 2266
45 Ga0070664_100482739 3300005564 Bacteria 1140
46 Ga0068854_100075323 3300005578 Bacteria 2478
47 Ga0068856_100037705 3300005614 Bacteria 4743
48 Ga0068856_100270304 3300005614 Bacteria 1716
49 Ga0068856_100300575 3300005614 Bacteria 1622
50 Ga0068856_100306511 3300005614 Bacteria 1606
51 Ga0070702_100275270 3300005615 Bacteria 1153
52 Ga0068852_100249606 3300005616 Bacteria 1700
53 Ga0068852_101290134 3300005616 Bacteria 752
54 Ga0068859_101019966 3300005617 Bacteria 909
55 Ga0068861_100674336 3300005719 Bacteria 958
56 Ga0068861_100982548 3300005719 Bacteria 805
57 Ga0068858_100167305 3300005842 Bacteria 2072
58 Ga0081538_10006927 3300005981 Bacteria 9860
59 Ga0081539_10000369 3300005985 Bacteria 98527
60 Ga0081539_10000896 3300005985 Bacteria 56801
61 Ga0081539_10172783 3300005985 Bacteria 1020
62 Ga0070717_11214214 3300006028 Unclassified 686
63 Ga0070716_100179944 3300006173 Bacteria 1387
64 Ga0070712_100000012 3300006175 Bacteria 118838
65 Ga0068871_100440187 3300006358 Bacteria 1167
66 Ga0068871_101784041 3300006358 Bacteria 584
67 Ga0075430_100000908 3300006846 Bacteria 23212
68 Ga0075431_100020988 3300006847 Bacteria 6674
69 Ga0075431_101281359 3300006847 Bacteria 694
70 Ga0075434_100004444 3300006871 Bacteria 12640
71 Ga0075434_100048058 3300006871 Bacteria 4234
72 Ga0075434_100086980 3300006871 Bacteria 3126
73 Ga0075436_100007110 3300006914 Bacteria 7661
74 Ga0075436_100134098 3300006914 Bacteria 1738
75 Ga0097620_101020089 3300006931 Bacteria 909
76 Ga0075435_100069776 3300007076 Bacteria 2867
77 Ga0075435_100104902 3300007076 Bacteria 2345
78 Ga0075435_101062757 3300007076 Bacteria 707
79 Ga0105240_10027208 3300009093 Bacteria 7491
80 Ga0111539_10032304 3300009094 Bacteria 6357
81 Ga0114129_10147241 3300009147 Bacteria 3225
82 Ga0114129_10230282 3300009147 Bacteria 2496
83 Ga0114129_10640812 3300009147 Unclassified 1372
84 Ga0105243_11677381 3300009148 Bacteria 664
85 Ga0105241_11152261 3300009174 Bacteria 732
86 Ga0105241_11708370 3300009174 Bacteria 612
87 Ga0105242_11945300 3300009176 Bacteria 629
88 Ga0105248_10806337 3300009177 Bacteria 1060
89 Ga0105248_12875676 3300009177 Bacteria 549
90 Ga0105237_10301583 3300009545 Bacteria 1605
91 Ga0105238_10177729 3300009551 Bacteria 2105
92 Ga0105238_11972365 3300009551 Bacteria 617
93 Ga0105249_10105576 3300009553 Bacteria 2656
94 Ga0105239_10481392 3300010375 Bacteria 1410
95 Ga0157370_10787724 3300013104 Unclassified 865
96 Ga0157369_10535671 3300013105 Bacteria 1211
97 Ga0157369_10562453 3300013105 Bacteria 1178
98 Ga0157378_12739415 3300013297 Unclassified 545
99 Ga0163162_11738302 3300013306 Bacteria 713
100 Ga0157372_10537577 3300013307 Bacteria 1362
101 Ga0157372_10669938 3300013307 Bacteria 1208
102 Ga0157372_12545437 3300013307 Bacteria 587
103 Ga0163163_12606106 3300014325 Bacteria 563
104 Ga0182008_10155869 3300014497 Bacteria 1147
105 Ga0182008_10202711 3300014497 Bacteria 1010
106 Ga0182008_10243794 3300014497 Bacteria 925
107 Ga0157379_12374232 3300014968 Bacteria 529
108 Ga0182005_1068864 3300015265 Unclassified 970
109 Ga0163161_10417345 3300017792 Unclassified 1079
110 Ga0197907_10099342 3300020069 Bacteria 874
111 Ga0206356_10229590 3300020070 Bacteria 999
112 Ga0206350_10105312 3300020080 Bacteria 1410
113 Ga0206354_11692153 3300020081 Bacteria 1358
114 Ga0206353_10086541 3300020082 Bacteria 948
115 Ga0213874_10209376 3300021377 Unclassified 704
116 Ga0224712_10616754 3300022467 Bacteria 530
117 Ga0207656_10234126 3300025321 Bacteria 896
118 Ga0207688_10048802 3300025901 Bacteria 2365
119 Ga0207699_10612119 3300025906 Bacteria 794
120 Ga0207654_11041224 3300025911 Bacteria 596
121 Ga0207707_10068035 3300025912 Bacteria 3103
122 Ga0207695_10688698 3300025913 Bacteria 903
123 Ga0207671_10121774 3300025914 Bacteria 1995
124 Ga0207693_10000030 3300025915 Bacteria 118049
125 Ga0207663_11464147 3300025916 Bacteria 550
126 Ga0207660_10050871 3300025917 Bacteria 2944
127 Ga0207657_10152889 3300025919 Bacteria 1879
128 Ga0207657_10313651 3300025919 Bacteria 1241
129 Ga0207649_10158149 3300025920 Bacteria 1568
130 Ga0207649_10216530 3300025920 Bacteria 1362
131 Ga0207652_10046128 3300025921 Bacteria 3717
132 Ga0207652_11098544 3300025921 Bacteria 696
133 Ga0207694_10101881 3300025924 Bacteria 2276
134 Ga0207694_10419453 3300025924 Bacteria 1115
135 Ga0207700_10513872 3300025928 Bacteria 1061
136 Ga0207664_10064847 3300025929 Bacteria 2923
137 Ga0207664_10791873 3300025929 Bacteria 853
138 Ga0207690_10271969 3300025932 Bacteria 1316
139 Ga0207690_10563576 3300025932 Bacteria 927
140 Ga0207706_10075938 3300025933 Bacteria 2956
141 Ga0207706_10269672 3300025933 Bacteria 1485
142 Ga0207669_10875399 3300025937 Bacteria 749
143 Ga0207665_10951249 3300025939 Bacteria 682
144 Ga0207691_11419217 3300025940 Bacteria 570
145 Ga0207711_11346189 3300025941 Unclassified 656
146 Ga0207689_10225883 3300025942 Bacteria 1547
147 Ga0207661_10260549 3300025944 Bacteria 1544
148 Ga0207661_10374726 3300025944 Bacteria 1287
149 Ga0207679_10069082 3300025945 Bacteria 2657
150 Ga0207679_12185080 3300025945 Bacteria 502
151 Ga0207667_10114165 3300025949 Bacteria 2784
152 Ga0207651_11452136 3300025960 Bacteria 618
153 Ga0207712_10284267 3300025961 Bacteria 1351
154 Ga0207668_10221050 3300025972 Bacteria 1521
155 Ga0207668_10444781 3300025972 Bacteria 1105
156 Ga0207640_10036975 3300025981 Bacteria 3069
157 Ga0207703_10123161 3300026035 Bacteria 2229
158 Ga0207639_10168665 3300026041 Bacteria 1852
159 Ga0207678_10495035 3300026067 Bacteria 1065
160 Ga0207678_10885276 3300026067 Bacteria 789
161 Ga0207702_10292614 3300026078 Bacteria 1543
162 Ga0207702_10319259 3300026078 Bacteria 1479
163 Ga0207702_10489869 3300026078 Bacteria 1197
164 Ga0207702_11504570 3300026078 Bacteria 667
165 Ga0207648_11680804 3300026089 Bacteria 596
166 Ga0207674_10426454 3300026116 Bacteria 1281
167 Ga0207675_100079623 3300026118 Bacteria 3071
168 Ga0207675_100386755 3300026118 Bacteria 1376
169 Ga0207675_100405138 3300026118 Bacteria 1345
170 Ga0207683_11015011 3300026121 Bacteria 770
171 Ga0207698_11777859 3300026142 Bacteria 632
172 Ga0207428_10074949 3300027907 Bacteria 2653
173 Ga0307509_10295621 3300031507 Bacteria 1371
174 Ga0307408_100540771 3300031548 Bacteria 1026
175 Ga0307508_10085857 3300031616 Bacteria 2730
176 Ga0307405_10097747 3300031731 Bacteria 1961
177 Ga0307413_10005747 3300031824 Bacteria 5576
178 Ga0307410_10013213 3300031852 Bacteria 4807
179 Ga0307410_10403133 3300031852 Bacteria 1105
180 Ga0307406_10052144 3300031901 Bacteria 2600
181 Ga0307406_10105167 3300031901 Bacteria 1931
182 Ga0307406_10631178 3300031901 Archaea 887
183 Ga0307406_11373627 3300031901 Bacteria 618
184 Ga0307407_10028365 3300031903 Bacteria 2992
185 Ga0307407_10228613 3300031903 Bacteria 1262
186 Ga0307409_100016386 3300031995 Bacteria 4902
187 Ga0307409_100147230 3300031995 Bacteria 2038
188 Ga0307409_100751282 3300031995 Archaea 979
189 Ga0307409_102001174 3300031995 Bacteria 609
190 Ga0307416_100029500 3300032002 Bacteria 4099
191 Ga0307416_100032112 3300032002 Bacteria 3962
192 Ga0307416_100073268 3300032002 Bacteria 2855
193 Ga0307416_102637912 3300032002 Bacteria 600
194 Ga0307414_10022363 3300032004 Bacteria 3986
195 Ga0307414_10961481 3300032004 Bacteria 785
196 Ga0307411_10270767 3300032005 Bacteria 1346
197 Ga0307415_100040962 3300032126 Bacteria 3072
198 Ga0307415_100162049 3300032126 Bacteria 1734
199 Ga0307415_100227680 3300032126 Bacteria 1499
200 Ga0307415_101034332 3300032126 Bacteria 765
201 Ga0373946_0383141 3300035171 Bacteria 708
202 Ga0373931_1177472 3300035691 Bacteria 524
203 Ga0373947_0444875 3300035725 Bacteria 877
204 Ga0395899_0065552 3300037312 Bacteria 2669
205 Ga0395899_0186189 3300037312 Bacteria 1455
206 Ga0395899_0342932 3300037312 Bacteria 1001
207 Ga0395899_0942938 3300037312 Unclassified 524
208 Ga0395900_0003397 3300037418 Bacteria 17195
209 Ga0395900_0019506 3300037418 Bacteria 6913
210 Ga0395900_0019673 3300037418 Bacteria 6883
211 Ga0395900_0045786 3300037418 Bacteria 4506
212 Ga0395900_0166087 3300037418 Bacteria 2249
213 Ga0395900_0539729 3300037418 Bacteria 1112
214 Ga0395900_0744314 3300037418 Bacteria 911
215 Ga0395900_1446198 3300037418 Bacteria 600
216 Ga0395900_1741853 3300037418 Unclassified 534
217 Ga0395898_0004728 3300037466 Bacteria 14820
218 Ga0395898_0031445 3300037466 Bacteria 5303
219 Ga0395898_0037420 3300037466 Bacteria 4814
220 Ga0395898_0046480 3300037466 Bacteria 4264
221 Ga0395898_0074687 3300037466 Bacteria 3275
222 Ga0395898_0174337 3300037466 Bacteria 2056
223 Ga0395898_0189713 3300037466 Bacteria 1964
224 Ga0395898_0262408 3300037466 Unclassified 1648
225 Ga0395898_0310571 3300037466 Bacteria 1504
226 Ga0395898_0472934 3300037466 Bacteria 1193
227 Ga0395898_0972329 3300037466 Unclassified 785
228 Ga0395905_0002708 3300037471 Bacteria 19412
229 Ga0395905_0016972 3300037471 Bacteria 6912
230 Ga0395905_0132624 3300037471 Bacteria 2343
231 Ga0395905_1147786 3300037471 Bacteria 680
232 Ga0395905_1472400 3300037471 Bacteria 585
233 Ga0395901_0000956 3300038443 Bacteria 31448
234 Ga0395901_0002275 3300038443 Bacteria 19595
235 Ga0395901_0014812 3300038443 Bacteria 7923
236 Ga0395901_0051058 3300038443 Bacteria 4298
237 Ga0395901_0064652 3300038443 Bacteria 3808
238 Ga0395901_0111529 3300038443 Bacteria 2873
239 Ga0395901_0296795 3300038443 Bacteria 1676
240 Ga0395901_0297891 3300038443 Bacteria 1672
241 Ga0395901_0352612 3300038443 Bacteria 1518
242 Ga0395901_0438583 3300038443 Bacteria 1337
243 Ga0395901_0677383 3300038443 Unclassified 1031
244 Ga0395901_0812812 3300038443 Bacteria 923
245 Ga0395901_0894370 3300038443 Bacteria 870
246 Ga0395901_1359948 3300038443 Bacteria 670
247 Ga0436365_1190211 3300039437 Bacteria 746
248 Ga0436360_0890250 3300039438 Bacteria 1932
249 Ga0436363_0040837 3300039450 Bacteria 1115
250 Ga0451791_1926178 3300041451 Bacteria 1122
251 Ga0451804_0540536 3300041463 Bacteria 961
252 Ga0451853_0208061 3300041512 Bacteria 664
253 Ga0451853_0226674 3300041512 Unclassified 546
254 Ga0451853_0324834 3300041512 Bacteria 2133
255 Ga0451853_3264232 3300041512 Bacteria 1955
256 Ga0439448_0035355 3300042005 Bacteria 1599
257 Ga0439450_009153 3300042008 Bacteria 1872
258 Ga0439455_0119901 3300042012 Bacteria 736
259 Ga0450898_034959 3300042134 Bacteria 935
260 Ga0439458_0112297 3300042157 Unclassified 713
261 Ga0439460_0021354 3300042461 Bacteria 1768
262 Ga0439440_0185309 3300042993 Unclassified 611
263 Ga0466972_0169268 3300044658 Bacteria 1026
264 Ga0466965_0018489 3300044683 Bacteria 3341
265 Ga0466966_0248889 3300044684 Bacteria 1071
266 Ga0466961_0057017 3300044693 Bacteria 2488
267 Ga0466961_0269626 3300044693 Bacteria 1043
268 Ga0466963_0003509 3300044694 Bacteria 9000
269 Ga0466963_0003517 3300044694 Bacteria 8993
270 Ga0466963_0003922 3300044694 Bacteria 8602
271 Ga0466963_0005142 3300044694 Bacteria 7638
272 Ga0466963_0016851 3300044694 Bacteria 4549
273 Ga0466963_0018245 3300044694 Bacteria 4383
274 Ga0466963_0030217 3300044694 Bacteria 3494
275 Ga0466963_0047021 3300044694 Bacteria 2847
276 Ga0466963_0056563 3300044694 Bacteria 2610
277 Ga0466963_0245331 3300044694 Bacteria 1256
278 Ga0466963_0251304 3300044694 Bacteria 1241
279 Ga0466963_0260802 3300044694 Bacteria 1217
280 Ga0466963_0281262 3300044694 Bacteria 1169
281 Ga0466963_0324343 3300044694 Bacteria 1084
282 Ga0466964_0000253 3300044706 Bacteria 15446
283 Ga0466964_0010873 3300044706 Bacteria 3438
284 Ga0466964_0081257 3300044706 Bacteria 1392
285 Ga0466964_0098048 3300044706 Bacteria 1287
286 Ga0466971_0026955 3300044719 Bacteria 2572
287 Ga0466971_0041523 3300044719 Bacteria 2066
288 Ga0466971_0543562 3300044719 Unclassified 576
289 Ga0466971_0640075 3300044719 Bacteria 532
290 Ga0466968_0280769 3300044735 Unclassified 797
291 Ga0466968_0389614 3300044735 Unclassified 682
292 Ga0466970_0005735 3300044765 Bacteria 6172
293 Ga0466970_0062948 3300044765 Bacteria 1989
294 Ga0466957_0038993 3300044842 Unclassified 2865
295 Ga0466957_1425761 3300044842 Bacteria 504
296 Ga0466960_0010144 3300044901 Bacteria 3907
297 Ga0466960_0019075 3300044901 Bacteria 3016
298 Ga0466960_0243304 3300044901 Bacteria 997
299 Ga0451576_1112544 3300045051 Unclassified 826
300 Ga0466958_0003447 3300045836 Bacteria 8206
301 Ga0466958_0068439 3300045836 Bacteria 2170
302 Ga0466958_0098924 3300045836 Bacteria 1812
303 Ga0466958_0148735 3300045836 Unclassified 1477
304 Ga0466967_0001892 3300045976 Bacteria 12648
305 Ga0466967_0006413 3300045976 Bacteria 8318
306 Ga0466967_0016667 3300045976 Bacteria 5802
307 Ga0466967_0026141 3300045976 Bacteria 4829
308 Ga0466967_0027923 3300045976 Bacteria 4703
309 Ga0466967_0038360 3300045976 Bacteria 4108
310 Ga0466967_0055044 3300045976 Bacteria 3503
311 Ga0466967_0088682 3300045976 Bacteria 2807
312 Ga0466967_0168202 3300045976 Bacteria 2061
313 Ga0466967_0173367 3300045976 Bacteria 2031
314 Ga0466967_0318495 3300045976 Bacteria 1499
315 Ga0466967_0367771 3300045976 Bacteria 1394
316 Ga0466967_0449464 3300045976 Bacteria 1259
317 Ga0466967_0672139 3300045976 Bacteria 1025
318 Ga0466967_1063104 3300045976 Unclassified 806
319 Ga0466967_1156022 3300045976 Bacteria 771
320 Ga0466967_1232419 3300045976 Bacteria 745
321 Ga0466967_1324862 3300045976 Bacteria 717
322 Ga0466967_1974194 3300045976 Archaea 580
323 Ga0466967_2028942 3300045976 Bacteria 572
324 Ga0495603_0084784 3300046455 Bacteria 1855
325 Ga0495638_0114868 3300046460 Bacteria 1596
326 Ga0495641_0331091 3300046461 Bacteria 687
327 Ga0495580_0201053 3300046472 Bacteria 1373
328 Ga0495582_0066557 3300046473 Bacteria 1991
329 Ga0495585_0379355 3300046492 Bacteria 683
330 Ga0495594_0757904 3300046499 Bacteria 548
331 Ga0495607_0226481 3300046501 Bacteria 911
332 Ga0495643_0031226 3300046522 Bacteria 2966
333 Ga0495661_0253493 3300046665 Bacteria 897
334 Ga0495658_0135931 3300046683 Bacteria 1500
335 Ga0495670_0020443 3300046691 Bacteria 3265
336 Ga0495589_0055823 3300046794 Bacteria 1945
337 Ga0495660_0090117 3300046810 Bacteria 1595
338 Ga0495581_0804277 3300047315 Bacteria 539
339 Ga0495676_0091603 3300047321 Bacteria 2272
340 Ga0495687_034275 3300047443 Bacteria 2295
341 Ga0495685_001045 3300047447 Bacteria 8443
342 Ga0495681_0097505 3300047470 Bacteria 1289
343 Ga0496100_0001926 3300048903 Bacteria 10381
344 Ga0496100_0058413 3300048903 Bacteria 2531
345 Ga0496100_0421711 3300048903 Archaea 1019
346 Ga0496101_0010668 3300048904 Bacteria 6071
347 Ga0496101_0013006 3300048904 Bacteria 5568
348 Ga0496101_0917333 3300048904 Bacteria 690
349 Ga0496102_0017698 3300048905 Bacteria 6247
350 Ga0496102_0168863 3300048905 Bacteria 2059
351 Ga0496102_0648628 3300048905 Bacteria 979
352 Ga0496103_0121049 3300048906 Bacteria 1667
353 Ga0496103_0237882 3300048906 Bacteria 1171
354 Ga0496104_0052097 3300048907 Bacteria 3865
355 Ga0496104_0440401 3300048907 Bacteria 1215
356 Ga0496105_0049879 3300048908 Bacteria 3457
357 Ga0496105_0483981 3300048908 Bacteria 973
358 Ga0496105_0931175 3300048908 Bacteria 653
359 Ga0496106_0001258 3300048909 Bacteria 18997
360 Ga0496106_0004612 3300048909 Bacteria 10222
361 Ga0496107_0002931 3300048910 Bacteria 11282
362 Ga0496107_0025584 3300048910 Bacteria 4179
363 Ga0496107_0252248 3300048910 Unclassified 1313
364 Ga0496107_0343461 3300048910 Unclassified 1111
365 Ga0496107_0977420 3300048910 Bacteria 615
366 Ga0496108_0041244 3300048911 Bacteria 3852
367 Ga0496108_1328538 3300048911 Bacteria 604
368 Ga0496108_1336664 3300048911 Bacteria 602
369 Ga0496109_0038052 3300048912 Bacteria 4348
370 Ga0496109_0248299 3300048912 Bacteria 1676
371 Ga0496109_0560091 3300048912 Bacteria 1078
372 Ga0496110_0005716 3300048913 Bacteria 9768
373 Ga0496110_0912158 3300048913 Bacteria 785
374 Ga0496110_1277452 3300048913 Bacteria 643
375 Ga0496110_1871621 3300048913 Bacteria 510
376 Ga0496111_0006969 3300048914 Bacteria 7378
377 Ga0496111_0029483 3300048914 Bacteria 3897
378 Ga0496111_0335146 3300048914 Bacteria 1120
379 Ga0496112_0000091 3300048915 Bacteria 59685
380 Ga0496112_0033342 3300048915 Bacteria 5006
381 Ga0496112_0054813 3300048915 Bacteria 3918
382 Ga0496112_0192177 3300048915 Bacteria 2003
383 Ga0496113_0078666 3300048916 Bacteria 2523
384 Ga0496113_0150096 3300048916 Bacteria 1838
385 Ga0496113_0210914 3300048916 Unclassified 1546
386 Ga0496114_0126399 3300048917 Bacteria 2204
387 Ga0496114_0149214 3300048917 Bacteria 2028
388 Ga0496114_0218092 3300048917 Bacteria 1674
389 Ga0496115_0004198 3300048918 Bacteria 10418
390 Ga0496115_0023129 3300048918 Bacteria 4822
391 Ga0496115_0268873 3300048918 Bacteria 1401
392 Ga0501032_0238880 3300049569 Bacteria 1181
393 Ga0501034_0356176 3300049571 Bacteria 1391
394 Ga0501034_0384413 3300049571 Bacteria 1328
395 Ga0501036_0698191 3300049572 Bacteria 838
396 Ga0501038_0072299 3300049574 Bacteria 2923
397 Ga0501039_1003763 3300049575 Bacteria 648
398 Ga0501042_0331348 3300049578 Bacteria 1100
399 Ga0501043_0231906 3300049579 Bacteria 1426
400 Ga0501043_0344841 3300049579 Bacteria 1132
401 Ga0501047_0013539 3300049581 Bacteria 7735
402 Ga0501047_0037377 3300049581 Bacteria 4695
403 Ga0501047_0101152 3300049581 Bacteria 2762
404 Ga0501067_0000003 3300049583 Bacteria 144905
405 Ga0501067_0003835 3300049583 Bacteria 8299
406 Ga0501067_0046827 3300049583 Bacteria 2400
407 Ga0501068_0000162 3300049584 Bacteria 30939
408 Ga0501068_0282987 3300049584 Bacteria 1060
409 Ga0501070_0000104 3300049586 Bacteria 74572
410 Ga0501070_0003994 3300049586 Bacteria 12682
411 Ga0501070_0032867 3300049586 Bacteria 4340
412 Ga0501070_0046945 3300049586 Bacteria 3592
413 Ga0501070_0145131 3300049586 Bacteria 1959
414 Ga0501071_0085097 3300049587 Bacteria 2318
415 Ga0501080_0103948 3300049742 Bacteria 2634
416 Ga0501080_0130920 3300049742 Bacteria 2322
417 Ga0501080_0541002 3300049742 Bacteria 1038
418 Ga0501035_0037916 3300049822 Bacteria 4363
419 Ga0501035_0041566 3300049822 Bacteria 4151
420 Ga0501044_0032382 3300049823 Bacteria 5496
421 Ga0501044_0807543 3300049823 Bacteria 817
422 nmdc:mga05p37_238466_c1 3300050507 Bacteria 2188
423 nmdc:mga05p37_33039_c1 3300050507 Bacteria 6336
424 nmdc:mga05p37_521629_c1 3300050507 Bacteria 1359
425 nmdc:mga09592_12546_c1 3300050508 Bacteria 6904
426 nmdc:mga0qj67_7340_c1 3300050509 Bacteria 8147
427 nmdc:mga06r32_1238332_c1 3300050510 Bacteria 692
428 nmdc:mga06r32_594755_c1 3300050510 Bacteria 1078
429 nmdc:mga08y16_24035_c1 3300050511 Bacteria 6436
430 nmdc:mga0n895_126145_c1 3300050512 Bacteria 2583
431 nmdc:mga0n895_16916_c1 3300050512 Bacteria 6708
432 nmdc:mga0n895_286953_c1 3300050512 Bacteria 1669
433 nmdc:mga0n895_63902_c1 3300050512 Bacteria 3640
434 nmdc:mga0rr50_28547_c1 3300050513 Bacteria 3923
435 nmdc:mga0rr50_43112_c1 3300050513 Bacteria 3299
436 nmdc:mga08x19_49355_c1 3300050514 Bacteria 2699
437 nmdc:mga0a205_209253_c1 3300050515 Bacteria 1839
438 nmdc:mga0a205_32917_c1 3300050515 Bacteria 4971
439 nmdc:mga0a205_70867_c1 3300050515 Bacteria 3366
440 Ga0495655_0117462 3300053083 Bacteria 806
441 Ga0495655_0122118 3300053083 Bacteria 794
442 Ga0500578_0016826 3300053086 Bacteria 4696
443 Ga0500583_0490800 3300053092 Bacteria 578
444 Ga0500641_0116475 3300053096 Bacteria 1151
445 Ga0500654_158267 3300053099 Bacteria 776
446 Ga0500569_008961 3300053109 Bacteria 2309
447 Ga0500628_235153 3300053129 Bacteria 536
448 Ga0500652_005626 3300053131 Bacteria 3966
449 Ga0500658_0005585 3300053134 Bacteria 4682
450 Ga0500561_0001763 3300053137 Bacteria 3564
451 Ga0500579_110443 3300053143 Bacteria 1386
452 Ga0500588_0145182 3300053146 Bacteria 855
453 Ga0500600_0022179 3300053149 Bacteria 3803
454 Ga0500616_0006855 3300053153 Bacteria 7360
455 Ga0500633_0093332 3300053160 Bacteria 1101
456 Ga0500634_0102429 3300053161 Bacteria 1430
457 Ga0466962_0050453 3300061719 Bacteria 1989
458 Ga0530510_0002162 3300061734 Bacteria 13479
459 Ga0530510_0243864 3300061734 Bacteria 1338
460 2899371951 2899370129 Bacteria 6781179
461 8025484377 8025478263 Bacteria 8209203
462 8056669700 8056667051 Bacteria 6953971
463 Ga0157372_11882200
464 Ga0070658_10881557
465 Ga0070683_100041408
466 Ga0070683_100116292
467 Ga0070683_100192207
468 Ga0070683_100497336
469 Ga0070683_100647487
470 Ga0070680_100055397
471 Ga0070680_100224410
472 Ga0070682_100027532
473 Ga0070682_100316355
474 Ga0068868_100659065
475 Ga0070661_100843896
476 Ga0070692_10055223
477 Ga0070668_100601285
478 Ga0070674_100212858
479 Ga0070688_101182047
480 Ga0070659_100217356
481 Ga0070659_100935275
482 Ga0070659_101497475
483 Ga0070709_11791683
484 Ga0070714_100026506
485 Ga0070713_100000005
486 Ga0070713_100695907
487 Ga0070713_101049167
488 Ga0070710_10674269
489 Ga0070705_101393867
490 Ga0070663_100595959
491 Ga0070663_100848248
492 Ga0070685_10862689
493 Ga0070679_101496574
494 Ga0070684_100029917
495 Ga0070684_100054695
496 Ga0070684_100501139
497 Ga0070684_101135516
498 Ga0070684_102217544
499 Ga0068853_100195909
500 Ga0070672_101816292
501 Ga0070686_100480805
502 Ga0070696_101246295
503 Ga0070693_100058313
504 Ga0070665_101564588
505 Ga0068855_100089601
506 Ga0070664_100123776
507 Ga0070664_100482739
508 Ga0068854_100075323
509 Ga0068856_100037705
510 Ga0068856_100270304
511 Ga0068856_100300575
512 Ga0068856_100306511
513 Ga0070702_100275270
514 Ga0068852_100249606
515 Ga0068852_101290134
516 Ga0068859_101019966
517 Ga0068861_100674336
518 Ga0068861_100982548
519 Ga0068858_100167305
520 Ga0081538_10006927
521 Ga0081539_10000369
522 Ga0081539_10000896
523 Ga0081539_10172783
524 Ga0070717_11214214
525 Ga0070716_100179944
526 Ga0070712_100000012
527 Ga0068871_100440187
528 Ga0068871_101784041
529 Ga0075430_100000908
530 Ga0075431_100020988
531 Ga0075431_101281359
532 Ga0075434_100004444
533 Ga0075434_100048058
534 Ga0075434_100086980
535 Ga0075436_100007110
536 Ga0075436_100134098
537 Ga0097620_101020089
538 Ga0075435_100069776
539 Ga0075435_100104902
540 Ga0075435_101062757
541 Ga0105240_10027208
542 Ga0111539_10032304
543 Ga0114129_10147241
544 Ga0114129_10230282
545 Ga0114129_10640812
546 Ga0105243_11677381
547 Ga0105241_11152261
548 Ga0105241_11708370
549 Ga0105242_11945300
550 Ga0105248_10806337
551 Ga0105248_12875676
552 Ga0105237_10301583
553 Ga0105238_10177729
554 Ga0105238_11972365
555 Ga0105249_10105576
556 Ga0105239_10481392
557 Ga0157370_10787724
558 Ga0157369_10535671
559 Ga0157369_10562453
560 Ga0157378_12739415
561 Ga0163162_11738302
562 Ga0157372_10537577
563 Ga0157372_10669938
564 Ga0157372_12545437
565 Ga0163163_12606106
566 Ga0182008_10155869
567 Ga0182008_10202711
568 Ga0182008_10243794
569 Ga0157379_12374232
570 Ga0182005_1068864
571 Ga0163161_10417345
572 Ga0197907_10099342
573 Ga0206356_10229590
574 Ga0206350_10105312
575 Ga0206354_11692153
576 Ga0206353_10086541
577 Ga0213874_10209376
578 Ga0224712_10616754
579 Ga0207656_10234126
580 Ga0207688_10048802
581 Ga0207699_10612119
582 Ga0207654_11041224
583 Ga0207707_10068035
584 Ga0207695_10688698
585 Ga0207671_10121774
586 Ga0207693_10000030
587 Ga0207663_11464147
588 Ga0207660_10050871
589 Ga0207657_10152889
590 Ga0207657_10313651
591 Ga0207649_10158149
592 Ga0207649_10216530
593 Ga0207652_10046128
594 Ga0207652_11098544
595 Ga0207694_10101881
596 Ga0207694_10419453
597 Ga0207700_10513872
598 Ga0207664_10064847
599 Ga0207664_10791873
600 Ga0207690_10271969
601 Ga0207690_10563576
602 Ga0207706_10075938
603 Ga0207706_10269672
604 Ga0207669_10875399
605 Ga0207665_10951249
606 Ga0207691_11419217
607 Ga0207711_11346189
608 Ga0207689_10225883
609 Ga0207661_10260549
610 Ga0207661_10374726
611 Ga0207679_10069082
612 Ga0207679_12185080
613 Ga0207667_10114165
614 Ga0207651_11452136
615 Ga0207712_10284267
616 Ga0207668_10221050
617 Ga0207668_10444781
618 Ga0207640_10036975
619 Ga0207703_10123161
620 Ga0207639_10168665
621 Ga0207678_10495035
622 Ga0207678_10885276
623 Ga0207702_10292614
624 Ga0207702_10319259
625 Ga0207702_10489869
626 Ga0207702_11504570
627 Ga0207648_11680804
628 Ga0207674_10426454
629 Ga0207675_100079623
630 Ga0207675_100386755
631 Ga0207675_100405138
632 Ga0207683_11015011
633 Ga0207698_11777859
634 Ga0207428_10074949
635 Ga0307509_10295621
636 Ga0307408_100540771
637 Ga0307508_10085857
638 Ga0307405_10097747
639 Ga0307413_10005747
640 Ga0307410_10013213
641 Ga0307410_10403133
642 Ga0307406_10052144
643 Ga0307406_10105167
644 Ga0307406_10631178
645 Ga0307406_11373627
646 Ga0307407_10028365
647 Ga0307407_10228613
648 Ga0307409_100016386
649 Ga0307409_100147230
650 Ga0307409_100751282
651 Ga0307409_102001174
652 Ga0307416_100029500
653 Ga0307416_100032112
654 Ga0307416_100073268
655 Ga0307416_102637912
656 Ga0307414_10022363
657 Ga0307414_10961481
658 Ga0307411_10270767
659 Ga0307415_100040962
660 Ga0307415_100162049
661 Ga0307415_100227680
662 Ga0307415_101034332
663 Ga0373946_0383141
664 Ga0373931_1177472
665 Ga0373947_0444875
666 Ga0395899_0065552
667 Ga0395899_0186189
668 Ga0395899_0342932
669 Ga0395899_0942938
670 Ga0395900_0003397
671 Ga0395900_0019506
672 Ga0395900_0019673
673 Ga0395900_0045786
674 Ga0395900_0166087
675 Ga0395900_0539729
676 Ga0395900_0744314
677 Ga0395900_1446198
678 Ga0395900_1741853
679 Ga0395898_0004728
680 Ga0395898_0031445
681 Ga0395898_0037420
682 Ga0395898_0046480
683 Ga0395898_0074687
684 Ga0395898_0174337
685 Ga0395898_0189713
686 Ga0395898_0262408
687 Ga0395898_0310571
688 Ga0395898_0472934
689 Ga0395898_0972329
690 Ga0395905_0002708
691 Ga0395905_0016972
692 Ga0395905_0132624
693 Ga0395905_1147786
694 Ga0395905_1472400
695 Ga0395901_0000956
696 Ga0395901_0002275
697 Ga0395901_0014812
698 Ga0395901_0051058
699 Ga0395901_0064652
700 Ga0395901_0111529
701 Ga0395901_0296795
702 Ga0395901_0297891
703 Ga0395901_0352612
704 Ga0395901_0438583
705 Ga0395901_0677383
706 Ga0395901_0812812
707 Ga0395901_0894370
708 Ga0395901_1359948
709 Ga0436365_1190211
710 Ga0436360_0890250
711 Ga0436363_0040837
712 Ga0451791_1926178
713 Ga0451804_0540536
714 Ga0451853_0208061
715 Ga0451853_0226674
716 Ga0451853_0324834
717 Ga0451853_3264232
718 Ga0439448_0035355
719 Ga0439450_009153
720 Ga0439455_0119901
721 Ga0450898_034959
722 Ga0439458_0112297
723 Ga0439460_0021354
724 Ga0439440_0185309
725 Ga0466972_0169268
726 Ga0466965_0018489
727 Ga0466966_0248889
728 Ga0466961_0057017
729 Ga0466961_0269626
730 Ga0466963_0003509
731 Ga0466963_0003517
732 Ga0466963_0003922
733 Ga0466963_0005142
734 Ga0466963_0016851
735 Ga0466963_0018245
736 Ga0466963_0030217
737 Ga0466963_0047021
738 Ga0466963_0056563
739 Ga0466963_0245331
740 Ga0466963_0251304
741 Ga0466963_0260802
742 Ga0466963_0281262
743 Ga0466963_0324343
744 Ga0466964_0000253
745 Ga0466964_0010873
746 Ga0466964_0081257
747 Ga0466964_0098048
748 Ga0466971_0026955
749 Ga0466971_0041523
750 Ga0466971_0543562
751 Ga0466971_0640075
752 Ga0466968_0280769
753 Ga0466968_0389614
754 Ga0466970_0005735
755 Ga0466970_0062948
756 Ga0466957_0038993
757 Ga0466957_1425761
758 Ga0466960_0010144
759 Ga0466960_0019075
760 Ga0466960_0243304
761 Ga0451576_1112544
762 Ga0466958_0003447
763 Ga0466958_0068439
764 Ga0466958_0098924
765 Ga0466958_0148735
766 Ga0466967_0001892
767 Ga0466967_0006413
768 Ga0466967_0016667
769 Ga0466967_0026141
770 Ga0466967_0027923
771 Ga0466967_0038360
772 Ga0466967_0055044
773 Ga0466967_0088682
774 Ga0466967_0168202
775 Ga0466967_0173367
776 Ga0466967_0318495
777 Ga0466967_0367771
778 Ga0466967_0449464
779 Ga0466967_0672139
780 Ga0466967_1063104
781 Ga0466967_1156022
782 Ga0466967_1232419
783 Ga0466967_1324862
784 Ga0466967_1974194
785 Ga0466967_2028942
786 Ga0495603_0084784
787 Ga0495638_0114868
788 Ga0495641_0331091
789 Ga0495580_0201053
790 Ga0495582_0066557
791 Ga0495585_0379355
792 Ga0495594_0757904
793 Ga0495607_0226481
794 Ga0495643_0031226
795 Ga0495661_0253493
796 Ga0495658_0135931
797 Ga0495670_0020443
798 Ga0495589_0055823
799 Ga0495660_0090117
800 Ga0495581_0804277
801 Ga0495676_0091603
802 Ga0495687_034275
803 Ga0495685_001045
804 Ga0495681_0097505
805 Ga0496100_0001926
806 Ga0496100_0058413
807 Ga0496100_0421711
808 Ga0496101_0010668
809 Ga0496101_0013006
810 Ga0496101_0917333
811 Ga0496102_0017698
812 Ga0496102_0168863
813 Ga0496102_0648628
814 Ga0496103_0121049
815 Ga0496103_0237882
816 Ga0496104_0052097
817 Ga0496104_0440401
818 Ga0496105_0049879
819 Ga0496105_0483981
820 Ga0496105_0931175
821 Ga0496106_0001258
822 Ga0496106_0004612
823 Ga0496107_0002931
824 Ga0496107_0025584
825 Ga0496107_0252248
826 Ga0496107_0343461
827 Ga0496107_0977420
828 Ga0496108_0041244
829 Ga0496108_1328538
830 Ga0496108_1336664
831 Ga0496109_0038052
832 Ga0496109_0248299
833 Ga0496109_0560091
834 Ga0496110_0005716
835 Ga0496110_0912158
836 Ga0496110_1277452
837 Ga0496110_1871621
838 Ga0496111_0006969
839 Ga0496111_0029483
840 Ga0496111_0335146
841 Ga0496112_0000091
842 Ga0496112_0033342
843 Ga0496112_0054813
844 Ga0496112_0192177
845 Ga0496113_0078666
846 Ga0496113_0150096
847 Ga0496113_0210914
848 Ga0496114_0126399
849 Ga0496114_0149214
850 Ga0496114_0218092
851 Ga0496115_0004198
852 Ga0496115_0023129
853 Ga0496115_0268873
854 Ga0501032_0238880
855 Ga0501034_0356176
856 Ga0501034_0384413
857 Ga0501036_0698191
858 Ga0501038_0072299
859 Ga0501039_1003763
860 Ga0501042_0331348
861 Ga0501043_0231906
862 Ga0501043_0344841
863 Ga0501047_0013539
864 Ga0501047_0037377
865 Ga0501047_0101152
866 Ga0501067_0000003
867 Ga0501067_0003835
868 Ga0501067_0046827
869 Ga0501068_0000162
870 Ga0501068_0282987
871 Ga0501070_0000104
872 Ga0501070_0003994
873 Ga0501070_0032867
874 Ga0501070_0046945
875 Ga0501070_0145131
876 Ga0501071_0085097
877 Ga0501080_0103948
878 Ga0501080_0130920
879 Ga0501080_0541002
880 Ga0501035_0037916
881 Ga0501035_0041566
882 Ga0501044_0032382
883 Ga0501044_0807543
884 nmdc:mga05p37_238466_c1
885 nmdc:mga05p37_33039_c1
886 nmdc:mga05p37_521629_c1
887 nmdc:mga09592_12546_c1
888 nmdc:mga0qj67_7340_c1
889 nmdc:mga06r32_1238332_c1
890 nmdc:mga06r32_594755_c1
891 nmdc:mga08y16_24035_c1
892 nmdc:mga0n895_126145_c1
893 nmdc:mga0n895_16916_c1
894 nmdc:mga0n895_286953_c1
895 nmdc:mga0n895_63902_c1
896 nmdc:mga0rr50_28547_c1
897 nmdc:mga0rr50_43112_c1
898 nmdc:mga08x19_49355_c1
899 nmdc:mga0a205_209253_c1
900 nmdc:mga0a205_32917_c1
901 nmdc:mga0a205_70867_c1
902 Ga0495655_0117462
903 Ga0495655_0122118
904 Ga0500578_0016826
905 Ga0500583_0490800
906 Ga0500641_0116475
907 Ga0500654_158267
908 Ga0500569_008961
909 Ga0500628_235153
910 Ga0500652_005626
911 Ga0500658_0005585
912 Ga0500561_0001763
913 Ga0500579_110443
914 Ga0500588_0145182
915 Ga0500600_0022179
916 Ga0500616_0006855
917 Ga0500633_0093332
918 Ga0500634_0102429
919 Ga0466962_0050453
920 Ga0530510_0002162
921 Ga0530510_0243864
922 2899371951
923 8025484377
924 8056669700

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

6

119

0.94

Map