F448903

General Info

Members Datasets Scaffolds Average Seq Length
462 236 924 256

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10309808|Ga0114129_103098082
Length 314
Sequence LRGLRDRFIFQSKVLLSQFRSNFEELAMPVRPYLLAETTWKTVRDTGYEVAVLPWGATEAHNTHLPYGTDTVECDHIAAEAARLAWEAGARVIVLPTVPFGVQTGQLDIPFCLNLNPSTQAAMLGDLARSLEGQGGGIRKLVILNGHGGNDFRTMIRELQPRLRLFLCVTNWYQVVNAAEYFEDLGDHAGEMETSIMLHVAKPLVLPLSEAGEGKERRSRIAGFREGWAWAPRRWTQVSTDTGIGNPRAATPQKGERYLAAVATRLSRFLVDLAACDPDDLYEDQPTTHAGPFRHSLQGRVADDHPPADATEGK

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
142 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
143 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
154 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
155 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
192 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.6
Rhizosphere 97.4
Stem 0
Stem Tuber 0
Unclassified 12.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10309808 3300009147 Bacteria 2102
2 Ga0065704_10275046 3300005289 Bacteria 934
3 Ga0070658_10059370 3300005327 Bacteria 3114
4 Ga0070658_10082722 3300005327 Bacteria 2638
5 Ga0070683_100005474 3300005329 Bacteria 10606
6 Ga0070683_100009623 3300005329 Bacteria 8272
7 Ga0070683_100023543 3300005329 Bacteria 5509
8 Ga0070683_100028931 3300005329 Bacteria 5011
9 Ga0070683_100116971 3300005329 Unclassified 2517
10 Ga0070683_100143844 3300005329 Bacteria 2259
11 Ga0070670_100002832 3300005331 Bacteria 14346
12 Ga0070670_100322367 3300005331 Bacteria 1354
13 Ga0070677_10005682 3300005333 Unclassified 4120
14 Ga0068869_100052995 3300005334 Bacteria 2948
15 Ga0070680_100001063 3300005336 Bacteria 19682
16 Ga0070680_100001973 3300005336 Bacteria 15102
17 Ga0070680_100008584 3300005336 Bacteria 7829
18 Ga0070680_100010963 3300005336 Bacteria 7007
19 Ga0070680_100014705 3300005336 Bacteria 6120
20 Ga0070680_100111894 3300005336 Bacteria 2273
21 Ga0070680_100146242 3300005336 Unclassified 1983
22 Ga0070682_100016806 3300005337 Bacteria 4258
23 Ga0070660_100132409 3300005339 Unclassified 1996
24 Ga0070660_100195354 3300005339 Bacteria 1640
25 Ga0070689_100340637 3300005340 Bacteria 1256
26 Ga0070687_100001209 3300005343 Bacteria 8945
27 Ga0070661_100003971 3300005344 Bacteria 10173
28 Ga0070661_100029439 3300005344 Bacteria 3963
29 Ga0070661_100134611 3300005344 Bacteria 1858
30 Ga0070661_100469235 3300005344 Bacteria 1003
31 Ga0070692_10121801 3300005345 Bacteria 1455
32 Ga0070669_100071265 3300005353 Bacteria 2571
33 Ga0070675_100246063 3300005354 Bacteria 1563
34 Ga0070671_100121706 3300005355 Bacteria 2196
35 Ga0070674_100203212 3300005356 Unclassified 1531
36 Ga0070673_100174339 3300005364 Bacteria 1837
37 Ga0070709_10321506 3300005434 Bacteria 1136
38 Ga0070709_10342858 3300005434 Bacteria 1102
39 Ga0070714_100004025 3300005435 Bacteria 11048
40 Ga0070714_100005109 3300005435 Bacteria 9981
41 Ga0070714_100068362 3300005435 Bacteria 3065
42 Ga0070713_100000787 3300005436 Bacteria 20256
43 Ga0070713_100024875 3300005436 Bacteria 4673
44 Ga0070710_10192902 3300005437 Bacteria 1282
45 Ga0070701_10039654 3300005438 Unclassified 2390
46 Ga0070701_10091948 3300005438 Unclassified 1664
47 Ga0070705_100010405 3300005440 Bacteria 4655
48 Ga0070705_100078059 3300005440 Bacteria 2024
49 Ga0070705_100198061 3300005440 Bacteria 1375
50 Ga0070700_100115145 3300005441 Bacteria 1793
51 Ga0070694_100030181 3300005444 Unclassified 3544
52 Ga0070694_100248507 3300005444 Bacteria 1345
53 Ga0070694_100250506 3300005444 Bacteria 1339
54 Ga0070708_100000016 3300005445 Bacteria 124870
55 Ga0070708_100134227 3300005445 Bacteria 2292
56 Ga0070708_100377682 3300005445 Bacteria 1336
57 Ga0070663_100127862 3300005455 Unclassified 1926
58 Ga0070678_100053055 3300005456 Bacteria 2947
59 Ga0070678_100254048 3300005456 Unclassified 1475
60 Ga0070681_10001810 3300005458 Bacteria 19241
61 Ga0070681_10014679 3300005458 Bacteria 7791
62 Ga0070681_10015231 3300005458 Bacteria 7649
63 Ga0070681_10037910 3300005458 Bacteria 4834
64 Ga0070681_10139535 3300005458 Bacteria 2354
65 Ga0070681_10267251 3300005458 Bacteria 1622
66 Ga0070706_100004638 3300005467 Bacteria 13194
67 Ga0070706_100140893 3300005467 Bacteria 2251
68 Ga0070706_100245306 3300005467 Bacteria 1672
69 Ga0070706_100333747 3300005467 Unclassified 1414
70 Ga0070707_100000189 3300005468 Bacteria 61252
71 Ga0070707_100167223 3300005468 Bacteria 2143
72 Ga0070707_100308682 3300005468 Bacteria 1537
73 Ga0070707_100558803 3300005468 Bacteria 1106
74 Ga0070698_100000087 3300005471 Bacteria 72711
75 Ga0070698_100036682 3300005471 Bacteria 5062
76 Ga0070698_100112781 3300005471 Unclassified 2683
77 Ga0070698_100182006 3300005471 Bacteria 2040
78 Ga0070698_100284461 3300005471 Bacteria 1585
79 Ga0070699_100001019 3300005518 Bacteria 26041
80 Ga0070699_100001024 3300005518 Bacteria 25976
81 Ga0070699_100046488 3300005518 Bacteria 3755
82 Ga0070699_100064882 3300005518 Bacteria 3167
83 Ga0070699_100175736 3300005518 Bacteria 1899
84 Ga0070679_100002340 3300005530 Bacteria 17151
85 Ga0070679_100002988 3300005530 Bacteria 15436
86 Ga0070679_100003817 3300005530 Bacteria 13835
87 Ga0070679_100013619 3300005530 Bacteria 7791
88 Ga0070679_100018601 3300005530 Bacteria 6745
89 Ga0070679_100247089 3300005530 Bacteria 1741
90 Ga0070679_100404438 3300005530 Bacteria 1311
91 Ga0070684_100013034 3300005535 Bacteria 6688
92 Ga0070684_100049526 3300005535 Bacteria 3646
93 Ga0070684_100243911 3300005535 Bacteria 1642
94 Ga0068853_100090787 3300005539 Bacteria 2685
95 Ga0068853_100234675 3300005539 Bacteria 1679
96 Ga0070672_100177647 3300005543 Bacteria 1773
97 Ga0070686_100014882 3300005544 Bacteria 4492
98 Ga0070695_100005329 3300005545 Bacteria 7571
99 Ga0070695_100050178 3300005545 Bacteria 2673
100 Ga0070695_100147020 3300005545 Bacteria 1641
101 Ga0070695_100251110 3300005545 Bacteria 1287
102 Ga0070696_100001628 3300005546 Bacteria 14734
103 Ga0070696_100010392 3300005546 Bacteria 6237
104 Ga0070696_100277504 3300005546 Bacteria 1276
105 Ga0070693_100007731 3300005547 Bacteria 5267
106 Ga0070693_100043925 3300005547 Bacteria 2526
107 Ga0070693_100394690 3300005547 Unclassified 958
108 Ga0070704_100000683 3300005549 Bacteria 16454
109 Ga0070704_100071131 3300005549 Bacteria 2526
110 Ga0070704_100107558 3300005549 Bacteria 2116
111 Ga0070704_100129855 3300005549 Unclassified 1951
112 Ga0070704_100157710 3300005549 Bacteria 1791
113 Ga0070704_100281413 3300005549 Bacteria 1378
114 Ga0068855_100124998 3300005563 Bacteria 2941
115 Ga0068855_100520212 3300005563 Bacteria 1291
116 Ga0070664_100004967 3300005564 Bacteria 10654
117 Ga0070664_100007685 3300005564 Bacteria 8706
118 Ga0070664_100052580 3300005564 Bacteria 3451
119 Ga0070664_100230065 3300005564 Bacteria 1661
120 Ga0068857_100020225 3300005577 Bacteria 5853
121 Ga0068857_100909071 3300005577 Unclassified 844
122 Ga0068854_100006212 3300005578 Bacteria 7589
123 Ga0068854_100039694 3300005578 Bacteria 3317
124 Ga0068852_100544355 3300005616 Bacteria 1160
125 Ga0068859_100535824 3300005617 Bacteria 1265
126 Ga0068864_100011356 3300005618 Bacteria 7360
127 Ga0068866_10023882 3300005718 Bacteria 2849
128 Ga0068861_100220492 3300005719 Unclassified 1603
129 Ga0068851_10049011 3300005834 Unclassified 2142
130 Ga0081539_10017505 3300005985 Bacteria 5026
131 Ga0070717_10000546 3300006028 Bacteria 23836
132 Ga0070717_10110161 3300006028 Bacteria 2348
133 Ga0070717_10480914 3300006028 Bacteria 1121
134 Ga0070712_100017158 3300006175 Bacteria 4683
135 Ga0075428_100039746 3300006844 Bacteria 5178
136 Ga0075428_100113388 3300006844 Bacteria 2953
137 Ga0075428_100202513 3300006844 Unclassified 2145
138 Ga0075428_100510069 3300006844 Bacteria 1286
139 Ga0075428_100718614 3300006844 Bacteria 1064
140 Ga0075430_100011837 3300006846 Bacteria 7424
141 Ga0075430_100059460 3300006846 Bacteria 3213
142 Ga0075430_100144694 3300006846 Unclassified 1980
143 Ga0075430_100220458 3300006846 Bacteria 1574
144 Ga0075430_100413711 3300006846 Unclassified 1113
145 Ga0075431_100008936 3300006847 Bacteria 10040
146 Ga0075431_100015652 3300006847 Bacteria 7689
147 Ga0075431_100116201 3300006847 Bacteria 2762
148 Ga0075433_10001428 3300006852 Bacteria 17622
149 Ga0075433_10038502 3300006852 Bacteria 4130
150 Ga0075433_10075337 3300006852 Bacteria 2970
151 Ga0075434_100061362 3300006871 Unclassified 3740
152 Ga0075434_100073381 3300006871 Bacteria 3414
153 Ga0075434_100157747 3300006871 Bacteria 2288
154 Ga0075434_100555524 3300006871 Bacteria 1168
155 Ga0075429_100027689 3300006880 Bacteria 4920
156 Ga0075436_100007716 3300006914 Bacteria 7353
157 Ga0075436_100138752 3300006914 Bacteria 1708
158 Ga0097620_100535843 3300006931 Bacteria 1265
159 Ga0075435_100036890 3300007076 Bacteria 3888
160 Ga0075435_100054874 3300007076 Bacteria 3217
161 Ga0075435_100697412 3300007076 Bacteria 882
162 Ga0099794_10000167 3300007265 Bacteria 24007
163 Ga0105240_10003356 3300009093 Bacteria 24906
164 Ga0105240_10029823 3300009093 Bacteria 7100
165 Ga0105240_10116152 3300009093 Unclassified 3229
166 Ga0111539_10043712 3300009094 Bacteria 5370
167 Ga0111539_10046360 3300009094 Bacteria 5199
168 Ga0111539_10409696 3300009094 Bacteria 1579
169 Ga0111539_10664832 3300009094 Bacteria 1213
170 Ga0105245_10205736 3300009098 Bacteria 1892
171 Ga0114129_10025705 3300009147 Bacteria 8341
172 Ga0114129_10049177 3300009147 Bacteria 5926
173 Ga0114129_10280363 3300009147 Unclassified 2227
174 Ga0157373_10006062 3300013100 Bacteria 9041
175 Ga0157373_10009458 3300013100 Bacteria 7200
176 Ga0157373_10054234 3300013100 Bacteria 2849
177 Ga0157373_10133983 3300013100 Bacteria 1742
178 Ga0157371_10098656 3300013102 Bacteria 2072
179 Ga0157371_10232760 3300013102 Bacteria 1324
180 Ga0157370_10006302 3300013104 Bacteria 13114
181 Ga0157370_10015575 3300013104 Bacteria 7729
182 Ga0157370_10053405 3300013104 Bacteria 3853
183 Ga0157370_10069731 3300013104 Unclassified 3319
184 Ga0157370_10267870 3300013104 Bacteria 1578
185 Ga0157369_10044368 3300013105 Bacteria 4840
186 Ga0157369_10540026 3300013105 Bacteria 1205
187 Ga0157369_10966234 3300013105 Unclassified 873
188 Ga0157374_10158039 3300013296 Bacteria 2207
189 Ga0157378_10008933 3300013297 Bacteria 8724
190 Ga0157372_10014913 3300013307 Bacteria 8320
191 Ga0157372_10019402 3300013307 Bacteria 7329
192 Ga0157372_10038804 3300013307 Bacteria 5256
193 Ga0157372_10042974 3300013307 Bacteria 5002
194 Ga0157372_10043807 3300013307 Bacteria 4958
195 Ga0157372_10094798 3300013307 Archaea 3399
196 Ga0163163_10017230 3300014325 Bacteria 6733
197 Ga0163163_10312777 3300014325 Unclassified 1624
198 Ga0157380_10240766 3300014326 Unclassified 1631
199 Ga0182008_10008190 3300014497 Bacteria 5722
200 Ga0157376_10489034 3300014969 Bacteria 1207
201 Ga0207656_10121920 3300025321 Unclassified 1214
202 Ga0207682_10021057 3300025893 Bacteria 2564
203 Ga0207642_10038848 3300025899 Bacteria 2063
204 Ga0207699_10012217 3300025906 Bacteria 4363
205 Ga0207699_10056359 3300025906 Unclassified 2342
206 Ga0207645_10052111 3300025907 Bacteria 2615
207 Ga0207645_10060813 3300025907 Bacteria 2412
208 Ga0207684_10004982 3300025910 Bacteria 12379
209 Ga0207684_10027732 3300025910 Bacteria 4823
210 Ga0207684_10153889 3300025910 Bacteria 1979
211 Ga0207684_10477731 3300025910 Bacteria 1069
212 Ga0207707_10001214 3300025912 Bacteria 24237
213 Ga0207707_10001480 3300025912 Bacteria 21737
214 Ga0207707_10002512 3300025912 Bacteria 16507
215 Ga0207707_10007565 3300025912 Bacteria 9463
216 Ga0207707_10007780 3300025912 Bacteria 9329
217 Ga0207707_10009612 3300025912 Bacteria 8390
218 Ga0207707_10063017 3300025912 Bacteria 3227
219 Ga0207695_10003082 3300025913 Bacteria 23866
220 Ga0207695_10004516 3300025913 Bacteria 18936
221 Ga0207695_10006429 3300025913 Bacteria 15257
222 Ga0207695_10010999 3300025913 Bacteria 10994
223 Ga0207693_10025488 3300025915 Bacteria 4688
224 Ga0207663_10142882 3300025916 Bacteria 1669
225 Ga0207660_10000932 3300025917 Bacteria 19330
226 Ga0207660_10005112 3300025917 Bacteria 8541
227 Ga0207660_10005688 3300025917 Bacteria 8089
228 Ga0207660_10014030 3300025917 Bacteria 5259
229 Ga0207660_10075100 3300025917 Bacteria 2468
230 Ga0207660_10165248 3300025917 Bacteria 1710
231 Ga0207660_10249510 3300025917 Bacteria 1400
232 Ga0207662_10008976 3300025918 Bacteria 5487
233 Ga0207657_10266624 3300025919 Unclassified 1362
234 Ga0207649_10058461 3300025920 Bacteria 2415
235 Ga0207649_10061820 3300025920 Bacteria 2359
236 Ga0207652_10000968 3300025921 Bacteria 26813
237 Ga0207652_10004265 3300025921 Bacteria 11668
238 Ga0207652_10009335 3300025921 Bacteria 7889
239 Ga0207652_10013551 3300025921 Bacteria 6595
240 Ga0207652_10036243 3300025921 Bacteria 4170
241 Ga0207652_10208397 3300025921 Bacteria 1760
242 Ga0207652_10306234 3300025921 Bacteria 1434
243 Ga0207646_10008872 3300025922 Bacteria 10015
244 Ga0207646_10010074 3300025922 Bacteria 9269
245 Ga0207646_10038780 3300025922 Bacteria 4288
246 Ga0207646_10340459 3300025922 Bacteria 1355
247 Ga0207646_10460719 3300025922 Bacteria 1147
248 Ga0207681_10161939 3300025923 Unclassified 1688
249 Ga0207650_10005841 3300025925 Bacteria 8399
250 Ga0207687_10384029 3300025927 Bacteria 1151
251 Ga0207700_10000387 3300025928 Bacteria 25666
252 Ga0207700_10022660 3300025928 Bacteria 4314
253 Ga0207664_10002703 3300025929 Bacteria 11769
254 Ga0207664_10102879 3300025929 Bacteria 2362
255 Ga0207706_10075014 3300025933 Bacteria 2974
256 Ga0207670_10302573 3300025936 Bacteria 1253
257 Ga0207669_10281648 3300025937 Unclassified 1254
258 Ga0207665_10200569 3300025939 Bacteria 1453
259 Ga0207691_10045112 3300025940 Bacteria 4054
260 Ga0207691_10139749 3300025940 Bacteria 2135
261 Ga0207711_10781419 3300025941 Bacteria 889
262 Ga0207689_10063882 3300025942 Unclassified 3029
263 Ga0207661_10000717 3300025944 Bacteria 21525
264 Ga0207661_10002092 3300025944 Bacteria 13739
265 Ga0207661_10009045 3300025944 Bacteria 7138
266 Ga0207661_10052496 3300025944 Bacteria 3257
267 Ga0207661_10062407 3300025944 Bacteria 3015
268 Ga0207661_10280210 3300025944 Bacteria 1490
269 Ga0207679_10009966 3300025945 Bacteria 6105
270 Ga0207679_10219986 3300025945 Bacteria 1597
271 Ga0207667_10180770 3300025949 Bacteria 2166
272 Ga0207667_10858183 3300025949 Unclassified 902
273 Ga0207640_10001079 3300025981 Bacteria 15115
274 Ga0207640_10067373 3300025981 Bacteria 2395
275 Ga0207640_10144219 3300025981 Bacteria 1740
276 Ga0207639_10089681 3300026041 Bacteria 2458
277 Ga0207702_10359098 3300026078 Bacteria 1396
278 Ga0207702_10777066 3300026078 Unclassified 946
279 Ga0207648_10088359 3300026089 Bacteria 2706
280 Ga0207674_10024832 3300026116 Bacteria 6397
281 Ga0207675_100061826 3300026118 Bacteria 3496
282 Ga0207683_10168168 3300026121 Bacteria 1985
283 Ga0207698_10095266 3300026142 Bacteria 2450
284 Ga0207698_10324141 3300026142 Unclassified 1444
285 Ga0209969_1000857 3300027360 Unclassified 4097
286 Ga0209588_1000165 3300027671 Bacteria 18478
287 Ga0209966_1001535 3300027695 Bacteria 4014
288 Ga0209998_10001036 3300027717 Bacteria 6983
289 Ga0268265_10049791 3300028380 Bacteria 3153
290 Ga0307408_100724372 3300031548 Bacteria 896
291 Ga0307405_10105342 3300031731 Bacteria 1899
292 Ga0307405_10261638 3300031731 Unclassified 1292
293 Ga0307413_10020620 3300031824 Bacteria 3510
294 Ga0307413_10051167 3300031824 Unclassified 2488
295 Ga0307413_10115261 3300031824 Bacteria 1808
296 Ga0307413_10210624 3300031824 Unclassified 1411
297 Ga0307410_10494298 3300031852 Bacteria 1006
298 Ga0307410_10566592 3300031852 Unclassified 943
299 Ga0307406_10421652 3300031901 Bacteria 1063
300 Ga0307412_10017864 3300031911 Bacteria 4253
301 Ga0307412_10103941 3300031911 Bacteria 2015
302 Ga0307409_100033727 3300031995 Bacteria 3729
303 Ga0307409_100075698 3300031995 Bacteria 2696
304 Ga0307409_100230621 3300031995 Unclassified 1678
305 Ga0307409_100286005 3300031995 Bacteria 1526
306 Ga0307409_100303573 3300031995 Bacteria 1486
307 Ga0307416_100119659 3300032002 Bacteria 2343
308 Ga0307416_100297017 3300032002 Bacteria 1603
309 Ga0307416_100553768 3300032002 Bacteria 1224
310 Ga0307414_10327799 3300032004 Bacteria 1306
311 Ga0307411_10016243 3300032005 Bacteria 4211
312 Ga0307411_10146537 3300032005 Bacteria 1748
313 Ga0307411_10258701 3300032005 Unclassified 1373
314 Ga0307415_100186342 3300032126 Bacteria 1633
315 Ga0373926_0014564 3300035083 Unclassified 2674
316 Ga0373934_0004726 3300035086 Bacteria 5034
317 Ga0373944_0095999 3300035089 Bacteria 996
318 Ga0373923_0000855 3300035111 Archaea 8057
319 Ga0373953_0009297 3300035117 Bacteria 3375
320 Ga0373956_0000577 3300035119 Bacteria 15039
321 Ga0373946_0045885 3300035171 Bacteria 1809
322 Ga0373955_0000627 3300035172 Bacteria 15107
323 Ga0373924_0004080 3300035410 Bacteria 5077
324 Ga0373935_0166531 3300035692 Bacteria 1505
325 Ga0373927_0050406 3300035695 Unclassified 2692
326 Ga0373933_0000676 3300035724 Bacteria 21103
327 Ga0373947_0000243 3300035725 Bacteria 30735
328 Ga0373937_0000220 3300036401 Bacteria 55056
329 Ga0316584_0130179 3300036712 Bacteria 1880
330 Ga0373925_0001158 3300037068 Bacteria 23375
331 Ga0373925_0063028 3300037068 Bacteria 2789
332 Ga0242420_001548 3300038996 Bacteria 3087
333 Ga0439439_0030792 3300041406 Bacteria 1365
334 Ga0439434_0001854 3300042435 Bacteria 6140
335 Ga0439434_0015743 3300042435 Unclassified 2256
336 Ga0451577_0002404 3300042876 Bacteria 22372
337 Ga0453683_0013787 3300044673 Bacteria 5260
338 Ga0453683_0027957 3300044673 Bacteria 3574
339 Ga0466966_0276807 3300044684 Bacteria 1010
340 Ga0453684_0000351 3300044712 Bacteria 191794
341 Ga0453684_0486967 3300044712 Bacteria 1368
342 Ga0451576_0032712 3300045051 Bacteria 5532
343 Ga0451576_0114691 3300045051 Bacteria 2805
344 Ga0451576_0340277 3300045051 Bacteria 1571
345 Ga0451576_0551022 3300045051 Bacteria 1211
346 Ga0466958_0055410 3300045836 Bacteria 2406
347 Ga0466967_0160592 3300045976 Bacteria 2109
348 Ga0466967_0242869 3300045976 Bacteria 1718
349 Ga0466967_0459898 3300045976 Bacteria 1245
350 Ga0466967_1152073 3300045976 Unclassified 773
351 Ga0495592_0000868 3300046454 Bacteria 20939
352 Ga0495629_0018485 3300046459 Bacteria 4989
353 Ga0495629_0075632 3300046459 Bacteria 2352
354 Ga0495651_0000125 3300046462 Bacteria 56567
355 Ga0495653_0000793 3300046463 Bacteria 24266
356 Ga0495582_0057537 3300046473 Unclassified 2143
357 Ga0495639_0038883 3300046475 Unclassified 2137
358 Ga0495664_0197289 3300046477 Bacteria 1220
359 Ga0495608_0000332 3300046511 Bacteria 33280
360 Ga0495608_0040709 3300046511 Bacteria 3112
361 Ga0495628_0000148 3300046516 Bacteria 60692
362 Ga0495630_0000605 3300046517 Bacteria 25983
363 Ga0495630_0287969 3300046517 Bacteria 1255
364 Ga0495642_0088194 3300046528 Bacteria 1311
365 Ga0495652_0000364 3300046529 Bacteria 53798
366 Ga0495665_0000148 3300046531 Bacteria 34387
367 Ga0495586_0077846 3300046535 Bacteria 1819
368 Ga0495587_0000860 3300046536 Bacteria 20065
369 Ga0495621_0018565 3300046539 Bacteria 2260
370 Ga0495645_0000491 3300046543 Bacteria 27436
371 Ga0495645_0116190 3300046543 Bacteria 1889
372 Ga0495645_0173371 3300046543 Bacteria 1483
373 Ga0495667_0001127 3300046559 Bacteria 17389
374 Ga0495635_0000207 3300046663 Bacteria 37284
375 Ga0495588_0017871 3300046674 Bacteria 3451
376 Ga0495657_0000734 3300046675 Bacteria 29388
377 Ga0495599_0001202 3300046678 Bacteria 14680
378 Ga0495623_0000027 3300046679 Bacteria 90239
379 Ga0495646_0000912 3300046680 Bacteria 16774
380 Ga0495658_0000069 3300046683 Bacteria 52593
381 Ga0495669_0105036 3300046684 Bacteria 1315
382 Ga0495613_0216891 3300046689 Bacteria 1344
383 Ga0495600_0000266 3300046809 Bacteria 28364
384 Ga0495600_0180862 3300046809 Bacteria 1359
385 Ga0495581_0019239 3300047315 Bacteria 3963
386 Ga0495581_0110224 3300047315 Bacteria 1601
387 Ga0495604_0000366 3300047317 Bacteria 40677
388 Ga0495604_0378770 3300047317 Bacteria 935
389 Ga0495674_0000632 3300047319 Bacteria 32891
390 Ga0495674_0412635 3300047319 Bacteria 1089
391 Ga0495680_0014814 3300047322 Bacteria 6741
392 Ga0495675_0000552 3300047444 Bacteria 24185
393 Ga0495675_0267388 3300047444 Unclassified 1023
394 Ga0495677_0024344 3300047445 Bacteria 2196
395 Ga0495684_0000889 3300047471 Bacteria 24220
396 Ga0495686_0008107 3300047472 Bacteria 7768
397 Ga0495593_0077203 3300047673 Bacteria 1725
398 Ga0495602_0002538 3300048088 Bacteria 18591
399 Ga0495614_0162823 3300048089 Bacteria 998
400 Ga0496100_0094154 3300048903 Bacteria 2051
401 Ga0496107_0136094 3300048910 Bacteria 1815
402 Ga0496109_0054413 3300048912 Bacteria 3651
403 Ga0496109_0061629 3300048912 Bacteria 3430
404 Ga0496111_0226452 3300048914 Bacteria 1389
405 Ga0496112_0017642 3300048915 Bacteria 6713
406 Ga0496113_0114085 3300048916 Unclassified 2106
407 Ga0496114_0038315 3300048917 Bacteria 3966
408 Ga0496114_0336433 3300048917 Bacteria 1335
409 Ga0496115_0002128 3300048918 Bacteria 14151
410 Ga0496115_0188297 3300048918 Unclassified 1705
411 Ga0496115_0275706 3300048918 Unclassified 1381
412 Ga0501034_0064003 3300049571 Bacteria 3691
413 Ga0501068_0038867 3300049584 Bacteria 2852
414 Ga0501070_0034858 3300049586 Bacteria 4206
415 Ga0501070_0077691 3300049586 Bacteria 2747
416 Ga0501070_0191481 3300049586 Unclassified 1681
417 Ga0501070_0296273 3300049586 Bacteria 1318
418 Ga0501071_0141830 3300049587 Bacteria 1789
419 Ga0501071_0178928 3300049587 Bacteria 1589
420 Ga0501072_0019249 3300049588 Bacteria 5274
421 Ga0501073_0095248 3300049589 Bacteria 2067
422 Ga0501074_0001288 3300049590 Bacteria 16628
423 Ga0501074_0381520 3300049590 Bacteria 1000
424 Ga0501076_0265739 3300049592 Bacteria 1405
425 Ga0501079_0118698 3300049741 Bacteria 2056
426 Ga0501080_0040668 3300049742 Bacteria 4336
427 Ga0501080_0094246 3300049742 Bacteria 2780
428 Ga0501080_0106232 3300049742 Bacteria 2602
429 Ga0501080_0417541 3300049742 Bacteria 1206
430 Ga0501081_0047396 3300049743 Bacteria 2957
431 Ga0501083_0024816 3300049744 Bacteria 4152
432 Ga0501035_0194268 3300049822 Bacteria 1744
433 Ga0501044_0790171 3300049823 Unclassified 829
434 nmdc:mga05p37_147569_c1 3300050507 Unclassified 2879
435 nmdc:mga05p37_578314_c1 3300050507 Bacteria 1273
436 nmdc:mga05p37_80273_c1 3300050507 Bacteria 4018
437 nmdc:mga09592_15713_c1 3300050508 Bacteria 6185
438 nmdc:mga09592_180543_c1 3300050508 Bacteria 1826
439 nmdc:mga09592_508904_c1 3300050508 Bacteria 1036
440 nmdc:mga0qj67_16936_c1 3300050509 Bacteria 5536
441 nmdc:mga0qj67_277641_c1 3300050509 Unclassified 1358
442 nmdc:mga0qj67_55737_c1 3300050509 Bacteria 3132
443 nmdc:mga06r32_12506_c1 3300050510 Bacteria 1276
444 nmdc:mga06r32_240082_c1 3300050510 Bacteria 1800
445 nmdc:mga08y16_326391_c1 3300050511 Bacteria 1579
446 nmdc:mga08y16_52495_c1 3300050511 Bacteria 4265
447 nmdc:mga08y16_932569_c1 3300050511 Bacteria 852
448 nmdc:mga0n895_16122_c1 3300050512 Bacteria 6846
449 nmdc:mga0n895_16568_c1 3300050512 Bacteria 6768
450 nmdc:mga0n895_174253_c1 3300050512 Bacteria 2182
451 nmdc:mga0rr50_88022_c1 3300050513 Bacteria 2411
452 nmdc:mga08x19_3908_c1 3300050514 Bacteria 8867
453 nmdc:mga08x19_43304_c1 3300050514 Bacteria 2872
454 nmdc:mga08x19_90572_c1 3300050514 Bacteria 2018
455 nmdc:mga0a205_3682_c1 3300050515 Bacteria 13720
456 nmdc:mga0a205_86825_c1 3300050515 Bacteria 3022
457 Ga0495601_0003078 3300053077 Bacteria 9514
458 Ga0495601_0025482 3300053077 Bacteria 3648
459 Ga0495612_0000498 3300053078 Bacteria 15664
460 Ga0495619_0000789 3300053085 Bacteria 20750
461 Ga0495619_0002257 3300053085 Bacteria 12738
462 Ga0501082_0111414 3300060353 Bacteria 2369
463 Ga0114129_10309808
464 Ga0065704_10275046
465 Ga0070658_10059370
466 Ga0070658_10082722
467 Ga0070683_100005474
468 Ga0070683_100009623
469 Ga0070683_100023543
470 Ga0070683_100028931
471 Ga0070683_100116971
472 Ga0070683_100143844
473 Ga0070670_100002832
474 Ga0070670_100322367
475 Ga0070677_10005682
476 Ga0068869_100052995
477 Ga0070680_100001063
478 Ga0070680_100001973
479 Ga0070680_100008584
480 Ga0070680_100010963
481 Ga0070680_100014705
482 Ga0070680_100111894
483 Ga0070680_100146242
484 Ga0070682_100016806
485 Ga0070660_100132409
486 Ga0070660_100195354
487 Ga0070689_100340637
488 Ga0070687_100001209
489 Ga0070661_100003971
490 Ga0070661_100029439
491 Ga0070661_100134611
492 Ga0070661_100469235
493 Ga0070692_10121801
494 Ga0070669_100071265
495 Ga0070675_100246063
496 Ga0070671_100121706
497 Ga0070674_100203212
498 Ga0070673_100174339
499 Ga0070709_10321506
500 Ga0070709_10342858
501 Ga0070714_100004025
502 Ga0070714_100005109
503 Ga0070714_100068362
504 Ga0070713_100000787
505 Ga0070713_100024875
506 Ga0070710_10192902
507 Ga0070701_10039654
508 Ga0070701_10091948
509 Ga0070705_100010405
510 Ga0070705_100078059
511 Ga0070705_100198061
512 Ga0070700_100115145
513 Ga0070694_100030181
514 Ga0070694_100248507
515 Ga0070694_100250506
516 Ga0070708_100000016
517 Ga0070708_100134227
518 Ga0070708_100377682
519 Ga0070663_100127862
520 Ga0070678_100053055
521 Ga0070678_100254048
522 Ga0070681_10001810
523 Ga0070681_10014679
524 Ga0070681_10015231
525 Ga0070681_10037910
526 Ga0070681_10139535
527 Ga0070681_10267251
528 Ga0070706_100004638
529 Ga0070706_100140893
530 Ga0070706_100245306
531 Ga0070706_100333747
532 Ga0070707_100000189
533 Ga0070707_100167223
534 Ga0070707_100308682
535 Ga0070707_100558803
536 Ga0070698_100000087
537 Ga0070698_100036682
538 Ga0070698_100112781
539 Ga0070698_100182006
540 Ga0070698_100284461
541 Ga0070699_100001019
542 Ga0070699_100001024
543 Ga0070699_100046488
544 Ga0070699_100064882
545 Ga0070699_100175736
546 Ga0070679_100002340
547 Ga0070679_100002988
548 Ga0070679_100003817
549 Ga0070679_100013619
550 Ga0070679_100018601
551 Ga0070679_100247089
552 Ga0070679_100404438
553 Ga0070684_100013034
554 Ga0070684_100049526
555 Ga0070684_100243911
556 Ga0068853_100090787
557 Ga0068853_100234675
558 Ga0070672_100177647
559 Ga0070686_100014882
560 Ga0070695_100005329
561 Ga0070695_100050178
562 Ga0070695_100147020
563 Ga0070695_100251110
564 Ga0070696_100001628
565 Ga0070696_100010392
566 Ga0070696_100277504
567 Ga0070693_100007731
568 Ga0070693_100043925
569 Ga0070693_100394690
570 Ga0070704_100000683
571 Ga0070704_100071131
572 Ga0070704_100107558
573 Ga0070704_100129855
574 Ga0070704_100157710
575 Ga0070704_100281413
576 Ga0068855_100124998
577 Ga0068855_100520212
578 Ga0070664_100004967
579 Ga0070664_100007685
580 Ga0070664_100052580
581 Ga0070664_100230065
582 Ga0068857_100020225
583 Ga0068857_100909071
584 Ga0068854_100006212
585 Ga0068854_100039694
586 Ga0068852_100544355
587 Ga0068859_100535824
588 Ga0068864_100011356
589 Ga0068866_10023882
590 Ga0068861_100220492
591 Ga0068851_10049011
592 Ga0081539_10017505
593 Ga0070717_10000546
594 Ga0070717_10110161
595 Ga0070717_10480914
596 Ga0070712_100017158
597 Ga0075428_100039746
598 Ga0075428_100113388
599 Ga0075428_100202513
600 Ga0075428_100510069
601 Ga0075428_100718614
602 Ga0075430_100011837
603 Ga0075430_100059460
604 Ga0075430_100144694
605 Ga0075430_100220458
606 Ga0075430_100413711
607 Ga0075431_100008936
608 Ga0075431_100015652
609 Ga0075431_100116201
610 Ga0075433_10001428
611 Ga0075433_10038502
612 Ga0075433_10075337
613 Ga0075434_100061362
614 Ga0075434_100073381
615 Ga0075434_100157747
616 Ga0075434_100555524
617 Ga0075429_100027689
618 Ga0075436_100007716
619 Ga0075436_100138752
620 Ga0097620_100535843
621 Ga0075435_100036890
622 Ga0075435_100054874
623 Ga0075435_100697412
624 Ga0099794_10000167
625 Ga0105240_10003356
626 Ga0105240_10029823
627 Ga0105240_10116152
628 Ga0111539_10043712
629 Ga0111539_10046360
630 Ga0111539_10409696
631 Ga0111539_10664832
632 Ga0105245_10205736
633 Ga0114129_10025705
634 Ga0114129_10049177
635 Ga0114129_10280363
636 Ga0157373_10006062
637 Ga0157373_10009458
638 Ga0157373_10054234
639 Ga0157373_10133983
640 Ga0157371_10098656
641 Ga0157371_10232760
642 Ga0157370_10006302
643 Ga0157370_10015575
644 Ga0157370_10053405
645 Ga0157370_10069731
646 Ga0157370_10267870
647 Ga0157369_10044368
648 Ga0157369_10540026
649 Ga0157369_10966234
650 Ga0157374_10158039
651 Ga0157378_10008933
652 Ga0157372_10014913
653 Ga0157372_10019402
654 Ga0157372_10038804
655 Ga0157372_10042974
656 Ga0157372_10043807
657 Ga0157372_10094798
658 Ga0163163_10017230
659 Ga0163163_10312777
660 Ga0157380_10240766
661 Ga0182008_10008190
662 Ga0157376_10489034
663 Ga0207656_10121920
664 Ga0207682_10021057
665 Ga0207642_10038848
666 Ga0207699_10012217
667 Ga0207699_10056359
668 Ga0207645_10052111
669 Ga0207645_10060813
670 Ga0207684_10004982
671 Ga0207684_10027732
672 Ga0207684_10153889
673 Ga0207684_10477731
674 Ga0207707_10001214
675 Ga0207707_10001480
676 Ga0207707_10002512
677 Ga0207707_10007565
678 Ga0207707_10007780
679 Ga0207707_10009612
680 Ga0207707_10063017
681 Ga0207695_10003082
682 Ga0207695_10004516
683 Ga0207695_10006429
684 Ga0207695_10010999
685 Ga0207693_10025488
686 Ga0207663_10142882
687 Ga0207660_10000932
688 Ga0207660_10005112
689 Ga0207660_10005688
690 Ga0207660_10014030
691 Ga0207660_10075100
692 Ga0207660_10165248
693 Ga0207660_10249510
694 Ga0207662_10008976
695 Ga0207657_10266624
696 Ga0207649_10058461
697 Ga0207649_10061820
698 Ga0207652_10000968
699 Ga0207652_10004265
700 Ga0207652_10009335
701 Ga0207652_10013551
702 Ga0207652_10036243
703 Ga0207652_10208397
704 Ga0207652_10306234
705 Ga0207646_10008872
706 Ga0207646_10010074
707 Ga0207646_10038780
708 Ga0207646_10340459
709 Ga0207646_10460719
710 Ga0207681_10161939
711 Ga0207650_10005841
712 Ga0207687_10384029
713 Ga0207700_10000387
714 Ga0207700_10022660
715 Ga0207664_10002703
716 Ga0207664_10102879
717 Ga0207706_10075014
718 Ga0207670_10302573
719 Ga0207669_10281648
720 Ga0207665_10200569
721 Ga0207691_10045112
722 Ga0207691_10139749
723 Ga0207711_10781419
724 Ga0207689_10063882
725 Ga0207661_10000717
726 Ga0207661_10002092
727 Ga0207661_10009045
728 Ga0207661_10052496
729 Ga0207661_10062407
730 Ga0207661_10280210
731 Ga0207679_10009966
732 Ga0207679_10219986
733 Ga0207667_10180770
734 Ga0207667_10858183
735 Ga0207640_10001079
736 Ga0207640_10067373
737 Ga0207640_10144219
738 Ga0207639_10089681
739 Ga0207702_10359098
740 Ga0207702_10777066
741 Ga0207648_10088359
742 Ga0207674_10024832
743 Ga0207675_100061826
744 Ga0207683_10168168
745 Ga0207698_10095266
746 Ga0207698_10324141
747 Ga0209969_1000857
748 Ga0209588_1000165
749 Ga0209966_1001535
750 Ga0209998_10001036
751 Ga0268265_10049791
752 Ga0307408_100724372
753 Ga0307405_10105342
754 Ga0307405_10261638
755 Ga0307413_10020620
756 Ga0307413_10051167
757 Ga0307413_10115261
758 Ga0307413_10210624
759 Ga0307410_10494298
760 Ga0307410_10566592
761 Ga0307406_10421652
762 Ga0307412_10017864
763 Ga0307412_10103941
764 Ga0307409_100033727
765 Ga0307409_100075698
766 Ga0307409_100230621
767 Ga0307409_100286005
768 Ga0307409_100303573
769 Ga0307416_100119659
770 Ga0307416_100297017
771 Ga0307416_100553768
772 Ga0307414_10327799
773 Ga0307411_10016243
774 Ga0307411_10146537
775 Ga0307411_10258701
776 Ga0307415_100186342
777 Ga0373926_0014564
778 Ga0373934_0004726
779 Ga0373944_0095999
780 Ga0373923_0000855
781 Ga0373953_0009297
782 Ga0373956_0000577
783 Ga0373946_0045885
784 Ga0373955_0000627
785 Ga0373924_0004080
786 Ga0373935_0166531
787 Ga0373927_0050406
788 Ga0373933_0000676
789 Ga0373947_0000243
790 Ga0373937_0000220
791 Ga0316584_0130179
792 Ga0373925_0001158
793 Ga0373925_0063028
794 Ga0242420_001548
795 Ga0439439_0030792
796 Ga0439434_0001854
797 Ga0439434_0015743
798 Ga0451577_0002404
799 Ga0453683_0013787
800 Ga0453683_0027957
801 Ga0466966_0276807
802 Ga0453684_0000351
803 Ga0453684_0486967
804 Ga0451576_0032712
805 Ga0451576_0114691
806 Ga0451576_0340277
807 Ga0451576_0551022
808 Ga0466958_0055410
809 Ga0466967_0160592
810 Ga0466967_0242869
811 Ga0466967_0459898
812 Ga0466967_1152073
813 Ga0495592_0000868
814 Ga0495629_0018485
815 Ga0495629_0075632
816 Ga0495651_0000125
817 Ga0495653_0000793
818 Ga0495582_0057537
819 Ga0495639_0038883
820 Ga0495664_0197289
821 Ga0495608_0000332
822 Ga0495608_0040709
823 Ga0495628_0000148
824 Ga0495630_0000605
825 Ga0495630_0287969
826 Ga0495642_0088194
827 Ga0495652_0000364
828 Ga0495665_0000148
829 Ga0495586_0077846
830 Ga0495587_0000860
831 Ga0495621_0018565
832 Ga0495645_0000491
833 Ga0495645_0116190
834 Ga0495645_0173371
835 Ga0495667_0001127
836 Ga0495635_0000207
837 Ga0495588_0017871
838 Ga0495657_0000734
839 Ga0495599_0001202
840 Ga0495623_0000027
841 Ga0495646_0000912
842 Ga0495658_0000069
843 Ga0495669_0105036
844 Ga0495613_0216891
845 Ga0495600_0000266
846 Ga0495600_0180862
847 Ga0495581_0019239
848 Ga0495581_0110224
849 Ga0495604_0000366
850 Ga0495604_0378770
851 Ga0495674_0000632
852 Ga0495674_0412635
853 Ga0495680_0014814
854 Ga0495675_0000552
855 Ga0495675_0267388
856 Ga0495677_0024344
857 Ga0495684_0000889
858 Ga0495686_0008107
859 Ga0495593_0077203
860 Ga0495602_0002538
861 Ga0495614_0162823
862 Ga0496100_0094154
863 Ga0496107_0136094
864 Ga0496109_0054413
865 Ga0496109_0061629
866 Ga0496111_0226452
867 Ga0496112_0017642
868 Ga0496113_0114085
869 Ga0496114_0038315
870 Ga0496114_0336433
871 Ga0496115_0002128
872 Ga0496115_0188297
873 Ga0496115_0275706
874 Ga0501034_0064003
875 Ga0501068_0038867
876 Ga0501070_0034858
877 Ga0501070_0077691
878 Ga0501070_0191481
879 Ga0501070_0296273
880 Ga0501071_0141830
881 Ga0501071_0178928
882 Ga0501072_0019249
883 Ga0501073_0095248
884 Ga0501074_0001288
885 Ga0501074_0381520
886 Ga0501076_0265739
887 Ga0501079_0118698
888 Ga0501080_0040668
889 Ga0501080_0094246
890 Ga0501080_0106232
891 Ga0501080_0417541
892 Ga0501081_0047396
893 Ga0501083_0024816
894 Ga0501035_0194268
895 Ga0501044_0790171
896 nmdc:mga05p37_147569_c1
897 nmdc:mga05p37_578314_c1
898 nmdc:mga05p37_80273_c1
899 nmdc:mga09592_15713_c1
900 nmdc:mga09592_180543_c1
901 nmdc:mga09592_508904_c1
902 nmdc:mga0qj67_16936_c1
903 nmdc:mga0qj67_277641_c1
904 nmdc:mga0qj67_55737_c1
905 nmdc:mga06r32_12506_c1
906 nmdc:mga06r32_240082_c1
907 nmdc:mga08y16_326391_c1
908 nmdc:mga08y16_52495_c1
909 nmdc:mga08y16_932569_c1
910 nmdc:mga0n895_16122_c1
911 nmdc:mga0n895_16568_c1
912 nmdc:mga0n895_174253_c1
913 nmdc:mga0rr50_88022_c1
914 nmdc:mga08x19_3908_c1
915 nmdc:mga08x19_43304_c1
916 nmdc:mga08x19_90572_c1
917 nmdc:mga0a205_3682_c1
918 nmdc:mga0a205_86825_c1
919 Ga0495601_0003078
920 Ga0495601_0025482
921 Ga0495612_0000498
922 Ga0495619_0000789
923 Ga0495619_0002257
924 Ga0501082_0111414

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02633

Creatininase

Creatinine amidohydrolase

36

270

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lub-assembly2.cif.gz_L crystal structure of putative creatinine amidohydrolase (yp_211512.1) from bacteroides fragilis nctc 9343 at 2.11 a resolution 0.9633 1 250
3no4-assembly1.cif.gz_B crystal structure of a creatinine amidohydrolase (npun_f1913) from nostoc punctiforme pcc 73102 at 2.00 a resolution 0.8372 5 247
3a6h-assembly1.cif.gz_F w154a mutant creatininase 0.8349 4 246
1j2t-assembly1.cif.gz_B creatininase mn 0.8316 4 246
3a6j-assembly1.cif.gz_F e122q mutant creatininase complexed with creatine 0.8284 4 246
ID Description Score Start End Superfamily
3lubB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Creatininase 0.9535 10 242 3.40.50.10310
3lubB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Creatininase 0.9376 10 242 3.40.50.10310
af_P9WP59_13_243_3.40.50.10310 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Creatininase 0.836 6 242 3.40.50.10310
3no4C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Creatininase 0.8319 5 247 3.40.50.10310
af_P9WP59_13_243_3.40.50.10310 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Creatininase 0.8194 6 242 3.40.50.10310
ID Description Score Start End GO Terms
AF-A0A7Y5K8H2-F1-model_v4 Creatininase family protein 0.9935 2 161 GO:0009231
GO:0016811
GO:0046872
AF-A0A2V7S0U0-F1-model_v4 Amidase 0.9933 2 153 GO:0009231
GO:0016811
GO:0046872
AF-A0A7Y5IC21-F1-model_v4 Creatininase family protein 0.9913 1 253 GO:0009231
GO:0016811
GO:0046872
AF-A0A7K0E8W9-F1-model_v4 Creatininase family protein 0.9898 1 253 GO:0009231
GO:0016811
GO:0046872
AF-A0A350K9I6-F1-model_v4 deleted 0.9894 2 120

Map