F448855
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 462 | 245 | 462 | 170 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100860158|Ga0070683_1008601581 |
| Length | 171 |
| Sequence | MGRRTGLREFQLSVAERLRTAATSRTALSSKLGFQVGADNWFVSLHQVSEVIPVPASVPVPLTHSWFRGVANVRGNLYSIIDFSAFQGGDPISPGVERRVILVSDRLVGGSGLLVSRMLGLRNPEQFNAAPRPAGAGPWVGNAFTDAGGTRWLELDLTALVREQRFLEVGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 65 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 159 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 160 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 161 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 162 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 163 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 165 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 166 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 167 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 168 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 169 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 170 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 171 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 172 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 174 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 177 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 180 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 181 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 182 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 187 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 188 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 189 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 190 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 191 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 192 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 193 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 194 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 195 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 196 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 197 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 198 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 199 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 200 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 218 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 219 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 221 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 222 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 233 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 234 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 235 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 236 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 237 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 245 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.41 |
| Nodule | 0 |
| Rhizoplane | 1.3 |
| Rhizosphere | 91.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10080002 | 3300005290 | Bacteria | 3156 |
| 2 | Ga0070658_10044818 | 3300005327 | Bacteria | 3575 |
| 3 | Ga0070658_10276503 | 3300005327 | Bacteria | 1429 |
| 4 | Ga0070658_10291056 | 3300005327 | Bacteria | 1392 |
| 5 | Ga0070676_10569857 | 3300005328 | Bacteria | 813 |
| 6 | Ga0070683_100055071 | 3300005329 | Bacteria | 3689 |
| 7 | Ga0070683_100146743 | 3300005329 | Bacteria | 2236 |
| 8 | Ga0070683_100860158 | 3300005329 | Bacteria | 870 |
| 9 | Ga0070690_100032911 | 3300005330 | Bacteria | 3241 |
| 10 | Ga0070690_100203595 | 3300005330 | Bacteria | 1378 |
| 11 | Ga0070690_100227774 | 3300005330 | Bacteria | 1309 |
| 12 | Ga0070670_100236329 | 3300005331 | Bacteria | 1591 |
| 13 | Ga0068869_100017993 | 3300005334 | Bacteria | 4802 |
| 14 | Ga0070666_10835878 | 3300005335 | Bacteria | 679 |
| 15 | Ga0070680_100438584 | 3300005336 | Bacteria | 1115 |
| 16 | Ga0068868_100015562 | 3300005338 | Bacteria | 5630 |
| 17 | Ga0068868_100674280 | 3300005338 | Bacteria | 923 |
| 18 | Ga0070660_100184314 | 3300005339 | Bacteria | 1690 |
| 19 | Ga0070689_100003209 | 3300005340 | Bacteria | 10832 |
| 20 | Ga0070689_100401954 | 3300005340 | Bacteria | 1158 |
| 21 | Ga0070687_100029755 | 3300005343 | Bacteria | 2663 |
| 22 | Ga0070687_100042780 | 3300005343 | Bacteria | 2297 |
| 23 | Ga0070687_100092202 | 3300005343 | Bacteria | 1678 |
| 24 | Ga0070687_100277940 | 3300005343 | Bacteria | 1053 |
| 25 | Ga0070661_100690518 | 3300005344 | Bacteria | 831 |
| 26 | Ga0070692_10287626 | 3300005345 | Bacteria | 999 |
| 27 | Ga0070692_10326855 | 3300005345 | Bacteria | 945 |
| 28 | Ga0070669_100508788 | 3300005353 | Bacteria | 1000 |
| 29 | Ga0070675_100105382 | 3300005354 | Bacteria | 2379 |
| 30 | Ga0070675_101649886 | 3300005354 | Unclassified | 591 |
| 31 | Ga0070671_100224950 | 3300005355 | Bacteria | 1592 |
| 32 | Ga0070674_100064737 | 3300005356 | Bacteria | 2563 |
| 33 | Ga0070674_100326713 | 3300005356 | Bacteria | 1231 |
| 34 | Ga0070674_100415355 | 3300005356 | Bacteria | 1103 |
| 35 | Ga0070673_100024659 | 3300005364 | Bacteria | 4414 |
| 36 | Ga0070673_100061662 | 3300005364 | Bacteria | 2976 |
| 37 | Ga0070659_100213708 | 3300005366 | Bacteria | 1590 |
| 38 | Ga0070709_10054032 | 3300005434 | Bacteria | 2531 |
| 39 | Ga0070714_100089470 | 3300005435 | Bacteria | 2695 |
| 40 | Ga0070713_100001908 | 3300005436 | Bacteria | 13439 |
| 41 | Ga0070713_101007362 | 3300005436 | Bacteria | 804 |
| 42 | Ga0070713_101545344 | 3300005436 | Bacteria | 644 |
| 43 | Ga0070710_10223136 | 3300005437 | Bacteria | 1200 |
| 44 | Ga0070701_10090468 | 3300005438 | Bacteria | 1676 |
| 45 | Ga0070701_10473918 | 3300005438 | Bacteria | 808 |
| 46 | Ga0070711_100910245 | 3300005439 | Bacteria | 751 |
| 47 | Ga0070705_100131025 | 3300005440 | Bacteria | 1636 |
| 48 | Ga0070694_100229188 | 3300005444 | Bacteria | 1397 |
| 49 | Ga0070678_100084387 | 3300005456 | Bacteria | 2417 |
| 50 | Ga0070678_100453353 | 3300005456 | Bacteria | 1124 |
| 51 | Ga0070678_100997397 | 3300005456 | Bacteria | 770 |
| 52 | Ga0070678_101014561 | 3300005456 | Bacteria | 763 |
| 53 | Ga0070678_101131643 | 3300005456 | Unclassified | 724 |
| 54 | Ga0070681_10004695 | 3300005458 | Bacteria | 13072 |
| 55 | Ga0070681_10182842 | 3300005458 | Bacteria | 2017 |
| 56 | Ga0068867_100046141 | 3300005459 | Bacteria | 3199 |
| 57 | Ga0068867_100342166 | 3300005459 | Bacteria | 1246 |
| 58 | Ga0068867_101049986 | 3300005459 | Bacteria | 741 |
| 59 | Ga0070685_10014304 | 3300005466 | Bacteria | 4201 |
| 60 | Ga0070685_10107237 | 3300005466 | Bacteria | 1715 |
| 61 | Ga0070685_10136474 | 3300005466 | Bacteria | 1540 |
| 62 | Ga0070685_10178830 | 3300005466 | Bacteria | 1364 |
| 63 | Ga0070698_100365617 | 3300005471 | Bacteria | 1375 |
| 64 | Ga0070699_100232943 | 3300005518 | Bacteria | 1642 |
| 65 | Ga0070679_100143561 | 3300005530 | Bacteria | 2366 |
| 66 | Ga0070679_100167031 | 3300005530 | Bacteria | 2174 |
| 67 | Ga0068853_100036967 | 3300005539 | Bacteria | 4153 |
| 68 | Ga0068853_100085845 | 3300005539 | Bacteria | 2760 |
| 69 | Ga0068853_100498800 | 3300005539 | Bacteria | 1149 |
| 70 | Ga0070672_100039923 | 3300005543 | Bacteria | 3598 |
| 71 | Ga0070672_101074896 | 3300005543 | Bacteria | 714 |
| 72 | Ga0070686_100236067 | 3300005544 | Bacteria | 1329 |
| 73 | Ga0070686_100867987 | 3300005544 | Bacteria | 732 |
| 74 | Ga0070695_100932160 | 3300005545 | Bacteria | 703 |
| 75 | Ga0070696_100008517 | 3300005546 | Bacteria | 6867 |
| 76 | Ga0070693_100026306 | 3300005547 | Bacteria | 3140 |
| 77 | Ga0070693_100271894 | 3300005547 | Bacteria | 1131 |
| 78 | Ga0070704_100142914 | 3300005549 | Bacteria | 1871 |
| 79 | Ga0070704_101286330 | 3300005549 | Bacteria | 669 |
| 80 | Ga0068855_100021633 | 3300005563 | Bacteria | 7714 |
| 81 | Ga0068855_100023905 | 3300005563 | Bacteria | 7317 |
| 82 | Ga0068855_100108838 | 3300005563 | Bacteria | 3183 |
| 83 | Ga0068855_100416724 | 3300005563 | Bacteria | 1470 |
| 84 | Ga0068855_100609419 | 3300005563 | Bacteria | 1176 |
| 85 | Ga0070664_101105276 | 3300005564 | Bacteria | 747 |
| 86 | Ga0068857_100021385 | 3300005577 | Bacteria | 5695 |
| 87 | Ga0068857_101090238 | 3300005577 | Bacteria | 771 |
| 88 | Ga0068854_100132195 | 3300005578 | Bacteria | 1907 |
| 89 | Ga0068854_100186829 | 3300005578 | Bacteria | 1622 |
| 90 | Ga0068854_100326657 | 3300005578 | Bacteria | 1249 |
| 91 | Ga0068854_100593603 | 3300005578 | Bacteria | 945 |
| 92 | Ga0068856_100033170 | 3300005614 | Bacteria | 5056 |
| 93 | Ga0068856_100470886 | 3300005614 | Unclassified | 1277 |
| 94 | Ga0070702_100666228 | 3300005615 | Bacteria | 789 |
| 95 | Ga0068852_100000366 | 3300005616 | Bacteria | 30499 |
| 96 | Ga0068852_100009416 | 3300005616 | Bacteria | 7255 |
| 97 | Ga0068852_100017259 | 3300005616 | Bacteria | 5659 |
| 98 | Ga0068852_100068664 | 3300005616 | Bacteria | 3103 |
| 99 | Ga0068859_100076300 | 3300005617 | Bacteria | 3392 |
| 100 | Ga0068859_100097344 | 3300005617 | Bacteria | 2995 |
| 101 | Ga0068859_101288936 | 3300005617 | Bacteria | 805 |
| 102 | Ga0068864_100114603 | 3300005618 | Bacteria | 2404 |
| 103 | Ga0068864_101509600 | 3300005618 | Unclassified | 675 |
| 104 | Ga0068861_100108694 | 3300005719 | Bacteria | 2219 |
| 105 | Ga0068861_100318317 | 3300005719 | Bacteria | 1354 |
| 106 | Ga0068851_10000446 | 3300005834 | Bacteria | 18427 |
| 107 | Ga0068870_10335113 | 3300005840 | Bacteria | 966 |
| 108 | Ga0068870_10582540 | 3300005840 | Bacteria | 758 |
| 109 | Ga0068863_100043189 | 3300005841 | Bacteria | 4280 |
| 110 | Ga0068863_100847534 | 3300005841 | Bacteria | 913 |
| 111 | Ga0068858_100005000 | 3300005842 | Bacteria | 12990 |
| 112 | Ga0068858_100115283 | 3300005842 | Bacteria | 2510 |
| 113 | Ga0068860_100238668 | 3300005843 | Bacteria | 1768 |
| 114 | Ga0068860_100828536 | 3300005843 | Bacteria | 939 |
| 115 | Ga0068860_101690768 | 3300005843 | Bacteria | 655 |
| 116 | Ga0068862_100101773 | 3300005844 | Bacteria | 2514 |
| 117 | Ga0070717_10201669 | 3300006028 | Bacteria | 1743 |
| 118 | Ga0075364_10023591 | 3300006051 | Bacteria | 3896 |
| 119 | Ga0075364_10109474 | 3300006051 | Bacteria | 1843 |
| 120 | Ga0075364_10169895 | 3300006051 | Bacteria | 1474 |
| 121 | Ga0075432_10086405 | 3300006058 | Bacteria | 1143 |
| 122 | Ga0070716_100689435 | 3300006173 | Bacteria | 779 |
| 123 | Ga0070716_100945856 | 3300006173 | Bacteria | 678 |
| 124 | Ga0075362_10030186 | 3300006177 | Bacteria | 2340 |
| 125 | Ga0075362_10136490 | 3300006177 | Bacteria | 1170 |
| 126 | Ga0075369_10000795 | 3300006186 | Bacteria | 10326 |
| 127 | Ga0075366_10002459 | 3300006195 | Bacteria | 9484 |
| 128 | Ga0075366_10007847 | 3300006195 | Bacteria | 5905 |
| 129 | Ga0075366_10008100 | 3300006195 | Bacteria | 5827 |
| 130 | Ga0075366_10035799 | 3300006195 | Bacteria | 2927 |
| 131 | Ga0075366_10037017 | 3300006195 | Bacteria | 2879 |
| 132 | Ga0075366_10401774 | 3300006195 | Bacteria | 843 |
| 133 | Ga0097621_100017590 | 3300006237 | Bacteria | 5432 |
| 134 | Ga0097621_100020123 | 3300006237 | Bacteria | 5139 |
| 135 | Ga0097621_100146595 | 3300006237 | Bacteria | 2021 |
| 136 | Ga0097621_100206404 | 3300006237 | Bacteria | 1707 |
| 137 | Ga0068871_100045534 | 3300006358 | Bacteria | 3531 |
| 138 | Ga0068871_100051801 | 3300006358 | Bacteria | 3324 |
| 139 | Ga0068871_100849454 | 3300006358 | Unclassified | 844 |
| 140 | Ga0068871_101381020 | 3300006358 | Bacteria | 664 |
| 141 | Ga0075428_100369171 | 3300006844 | Bacteria | 1539 |
| 142 | Ga0075430_100305874 | 3300006846 | Bacteria | 1315 |
| 143 | Ga0075434_100050939 | 3300006871 | Bacteria | 4113 |
| 144 | Ga0075434_100091551 | 3300006871 | Bacteria | 3043 |
| 145 | Ga0075434_100139184 | 3300006871 | Bacteria | 2447 |
| 146 | Ga0075429_100126485 | 3300006880 | Bacteria | 2235 |
| 147 | Ga0068865_100487167 | 3300006881 | Bacteria | 1026 |
| 148 | Ga0068865_100521961 | 3300006881 | Bacteria | 993 |
| 149 | Ga0075436_100003266 | 3300006914 | Bacteria | 11107 |
| 150 | Ga0075436_100059214 | 3300006914 | Bacteria | 2646 |
| 151 | Ga0075436_100320327 | 3300006914 | Bacteria | 1114 |
| 152 | Ga0097620_100076307 | 3300006931 | Bacteria | 3392 |
| 153 | Ga0097620_100097345 | 3300006931 | Bacteria | 2995 |
| 154 | Ga0097620_101289166 | 3300006931 | Bacteria | 805 |
| 155 | Ga0075435_100149405 | 3300007076 | Bacteria | 1963 |
| 156 | Ga0075435_100280295 | 3300007076 | Bacteria | 1423 |
| 157 | Ga0075435_100308449 | 3300007076 | Bacteria | 1354 |
| 158 | Ga0105240_10028255 | 3300009093 | Bacteria | 7327 |
| 159 | Ga0105240_10127476 | 3300009093 | Bacteria | 3056 |
| 160 | Ga0105240_10131593 | 3300009093 | Bacteria | 3000 |
| 161 | Ga0105240_10165926 | 3300009093 | Bacteria | 2619 |
| 162 | Ga0111539_10002062 | 3300009094 | Bacteria | 26871 |
| 163 | Ga0111539_11095578 | 3300009094 | Bacteria | 925 |
| 164 | Ga0105245_10330592 | 3300009098 | Bacteria | 1504 |
| 165 | Ga0105245_10509690 | 3300009098 | Bacteria | 1220 |
| 166 | Ga0105245_10634709 | 3300009098 | Bacteria | 1097 |
| 167 | Ga0105245_10675690 | 3300009098 | Bacteria | 1064 |
| 168 | Ga0105243_11024551 | 3300009148 | Bacteria | 829 |
| 169 | Ga0105241_10015972 | 3300009174 | Bacteria | 5502 |
| 170 | Ga0105241_10488787 | 3300009174 | Bacteria | 1095 |
| 171 | Ga0105241_11909053 | 3300009174 | Bacteria | 582 |
| 172 | Ga0105242_10003249 | 3300009176 | Bacteria | 12682 |
| 173 | Ga0105242_10039194 | 3300009176 | Bacteria | 3812 |
| 174 | Ga0105242_10085855 | 3300009176 | Bacteria | 2640 |
| 175 | Ga0105242_10349499 | 3300009176 | Bacteria | 1365 |
| 176 | Ga0105242_10479404 | 3300009176 | Bacteria | 1179 |
| 177 | Ga0105242_10676547 | 3300009176 | Bacteria | 1007 |
| 178 | Ga0105248_10045481 | 3300009177 | Bacteria | 4922 |
| 179 | Ga0105248_10047767 | 3300009177 | Bacteria | 4800 |
| 180 | Ga0105248_10081168 | 3300009177 | Bacteria | 3645 |
| 181 | Ga0105248_11006648 | 3300009177 | Bacteria | 941 |
| 182 | Ga0105238_10014448 | 3300009551 | Bacteria | 7984 |
| 183 | Ga0105238_10555001 | 3300009551 | Bacteria | 1153 |
| 184 | Ga0105238_11467381 | 3300009551 | Bacteria | 710 |
| 185 | Ga0105249_10191356 | 3300009553 | Bacteria | 1997 |
| 186 | Ga0105249_10839242 | 3300009553 | Bacteria | 984 |
| 187 | Ga0157371_10147734 | 3300013102 | Bacteria | 1676 |
| 188 | Ga0157371_10376088 | 3300013102 | Bacteria | 1037 |
| 189 | Ga0157370_10011580 | 3300013104 | Bacteria | 9205 |
| 190 | Ga0157370_10891957 | 3300013104 | Bacteria | 807 |
| 191 | Ga0157369_10060943 | 3300013105 | Bacteria | 4068 |
| 192 | Ga0157369_10135858 | 3300013105 | Bacteria | 2604 |
| 193 | Ga0157374_10041952 | 3300013296 | Bacteria | 4219 |
| 194 | Ga0157374_10154778 | 3300013296 | Bacteria | 2230 |
| 195 | Ga0157378_10014205 | 3300013297 | Bacteria | 6969 |
| 196 | Ga0157378_10199294 | 3300013297 | Bacteria | 1893 |
| 197 | Ga0157378_10792742 | 3300013297 | Bacteria | 973 |
| 198 | Ga0163162_10068743 | 3300013306 | Bacteria | 3594 |
| 199 | Ga0163162_10403036 | 3300013306 | Bacteria | 1500 |
| 200 | Ga0163162_11630773 | 3300013306 | Bacteria | 736 |
| 201 | Ga0157372_10000909 | 3300013307 | Bacteria | 32178 |
| 202 | Ga0157372_10050929 | 3300013307 | Bacteria | 4606 |
| 203 | Ga0157372_10555043 | 3300013307 | Bacteria | 1339 |
| 204 | Ga0157375_10011811 | 3300013308 | Bacteria | 7722 |
| 205 | Ga0157375_10920972 | 3300013308 | Bacteria | 1017 |
| 206 | Ga0157375_10972770 | 3300013308 | Bacteria | 990 |
| 207 | Ga0163163_11019424 | 3300014325 | Bacteria | 891 |
| 208 | Ga0157380_10028919 | 3300014326 | Bacteria | 4232 |
| 209 | Ga0157380_10358192 | 3300014326 | Bacteria | 1368 |
| 210 | Ga0157380_10598992 | 3300014326 | Bacteria | 1090 |
| 211 | Ga0157380_10910037 | 3300014326 | Bacteria | 906 |
| 212 | Ga0157377_10298907 | 3300014745 | Bacteria | 1062 |
| 213 | Ga0157379_10033222 | 3300014968 | Bacteria | 4601 |
| 214 | Ga0157379_10106641 | 3300014968 | Bacteria | 2515 |
| 215 | Ga0157376_10037328 | 3300014969 | Bacteria | 3943 |
| 216 | Ga0157376_11290530 | 3300014969 | Bacteria | 760 |
| 217 | Ga0163161_10547228 | 3300017792 | Bacteria | 948 |
| 218 | Ga0207656_10005870 | 3300025321 | Bacteria | 4376 |
| 219 | Ga0207682_10072180 | 3300025893 | Bacteria | 1464 |
| 220 | Ga0207682_10104966 | 3300025893 | Bacteria | 1239 |
| 221 | Ga0207692_10110247 | 3300025898 | Bacteria | 1525 |
| 222 | Ga0207688_10022551 | 3300025901 | Bacteria | 3446 |
| 223 | Ga0207685_10052236 | 3300025905 | Bacteria | 1583 |
| 224 | Ga0207645_10367190 | 3300025907 | Bacteria | 964 |
| 225 | Ga0207643_10223404 | 3300025908 | Bacteria | 1153 |
| 226 | Ga0207643_10452259 | 3300025908 | Bacteria | 817 |
| 227 | Ga0207705_10020878 | 3300025909 | Bacteria | 4674 |
| 228 | Ga0207705_10164506 | 3300025909 | Bacteria | 1668 |
| 229 | Ga0207705_10210687 | 3300025909 | Bacteria | 1474 |
| 230 | Ga0207654_10019029 | 3300025911 | Bacteria | 3614 |
| 231 | Ga0207654_10093195 | 3300025911 | Bacteria | 1841 |
| 232 | Ga0207695_10038032 | 3300025913 | Bacteria | 5187 |
| 233 | Ga0207695_10081577 | 3300025913 | Bacteria | 3273 |
| 234 | Ga0207695_10212860 | 3300025913 | Bacteria | 1842 |
| 235 | Ga0207663_10261629 | 3300025916 | Bacteria | 1278 |
| 236 | Ga0207660_10256127 | 3300025917 | Bacteria | 1382 |
| 237 | Ga0207660_10670972 | 3300025917 | Bacteria | 845 |
| 238 | Ga0207662_10030115 | 3300025918 | Bacteria | 3148 |
| 239 | Ga0207662_10056285 | 3300025918 | Bacteria | 2348 |
| 240 | Ga0207662_10062899 | 3300025918 | Bacteria | 2231 |
| 241 | Ga0207662_10075703 | 3300025918 | Bacteria | 2045 |
| 242 | Ga0207662_10205489 | 3300025918 | Bacteria | 1276 |
| 243 | Ga0207662_10222130 | 3300025918 | Bacteria | 1231 |
| 244 | Ga0207662_10688746 | 3300025918 | Bacteria | 716 |
| 245 | Ga0207657_10226620 | 3300025919 | Bacteria | 1496 |
| 246 | Ga0207649_10628861 | 3300025920 | Bacteria | 828 |
| 247 | Ga0207649_10935943 | 3300025920 | Bacteria | 680 |
| 248 | Ga0207652_10113446 | 3300025921 | Bacteria | 2406 |
| 249 | Ga0207652_10138715 | 3300025921 | Bacteria | 2173 |
| 250 | Ga0207646_10731683 | 3300025922 | Bacteria | 883 |
| 251 | Ga0207681_10134117 | 3300025923 | Bacteria | 1835 |
| 252 | Ga0207694_10004983 | 3300025924 | Bacteria | 10276 |
| 253 | Ga0207694_10040105 | 3300025924 | Bacteria | 3604 |
| 254 | Ga0207694_10743948 | 3300025924 | Bacteria | 827 |
| 255 | Ga0207694_10771752 | 3300025924 | Bacteria | 812 |
| 256 | Ga0207694_11313679 | 3300025924 | Unclassified | 612 |
| 257 | Ga0207650_10207056 | 3300025925 | Bacteria | 1574 |
| 258 | Ga0207650_11000726 | 3300025925 | Bacteria | 711 |
| 259 | Ga0207659_10034365 | 3300025926 | Bacteria | 3495 |
| 260 | Ga0207687_10065936 | 3300025927 | Bacteria | 2572 |
| 261 | Ga0207687_10730526 | 3300025927 | Bacteria | 842 |
| 262 | Ga0207687_10819497 | 3300025927 | Bacteria | 794 |
| 263 | Ga0207700_10658939 | 3300025928 | Bacteria | 933 |
| 264 | Ga0207664_10123357 | 3300025929 | Bacteria | 2171 |
| 265 | Ga0207664_10682803 | 3300025929 | Bacteria | 923 |
| 266 | Ga0207644_10204699 | 3300025931 | Bacteria | 1558 |
| 267 | Ga0207690_10195511 | 3300025932 | Bacteria | 1532 |
| 268 | Ga0207686_10002739 | 3300025934 | Bacteria | 9551 |
| 269 | Ga0207686_10012336 | 3300025934 | Bacteria | 4698 |
| 270 | Ga0207686_10020528 | 3300025934 | Bacteria | 3775 |
| 271 | Ga0207686_10203501 | 3300025934 | Bacteria | 1419 |
| 272 | Ga0207686_10524440 | 3300025934 | Bacteria | 922 |
| 273 | Ga0207709_10246130 | 3300025935 | Bacteria | 1303 |
| 274 | Ga0207670_10161583 | 3300025936 | Bacteria | 1672 |
| 275 | Ga0207670_10190367 | 3300025936 | Bacteria | 1552 |
| 276 | Ga0207669_10074937 | 3300025937 | Bacteria | 2142 |
| 277 | Ga0207669_10171802 | 3300025937 | Bacteria | 1544 |
| 278 | Ga0207704_10328500 | 3300025938 | Bacteria | 1182 |
| 279 | Ga0207704_10803787 | 3300025938 | Bacteria | 785 |
| 280 | Ga0207665_10395478 | 3300025939 | Bacteria | 1051 |
| 281 | Ga0207691_10059323 | 3300025940 | Bacteria | 3480 |
| 282 | Ga0207691_10705382 | 3300025940 | Bacteria | 851 |
| 283 | Ga0207711_10020985 | 3300025941 | Bacteria | 5454 |
| 284 | Ga0207711_10026751 | 3300025941 | Bacteria | 4842 |
| 285 | Ga0207689_10025409 | 3300025942 | Bacteria | 4964 |
| 286 | Ga0207689_10535906 | 3300025942 | Bacteria | 983 |
| 287 | Ga0207661_10083258 | 3300025944 | Bacteria | 2647 |
| 288 | Ga0207661_10798402 | 3300025944 | Bacteria | 869 |
| 289 | Ga0207679_11098948 | 3300025945 | Unclassified | 729 |
| 290 | Ga0207667_10019072 | 3300025949 | Bacteria | 7667 |
| 291 | Ga0207667_10029787 | 3300025949 | Bacteria | 5913 |
| 292 | Ga0207667_10090885 | 3300025949 | Bacteria | 3155 |
| 293 | Ga0207667_10091933 | 3300025949 | Bacteria | 3134 |
| 294 | Ga0207667_10104227 | 3300025949 | Bacteria | 2925 |
| 295 | Ga0207667_10265385 | 3300025949 | Bacteria | 1756 |
| 296 | Ga0207667_11159839 | 3300025949 | Bacteria | 754 |
| 297 | Ga0207651_10226175 | 3300025960 | Bacteria | 1516 |
| 298 | Ga0207651_11030802 | 3300025960 | Bacteria | 736 |
| 299 | Ga0207712_10926995 | 3300025961 | Bacteria | 771 |
| 300 | Ga0207640_10162558 | 3300025981 | Bacteria | 1654 |
| 301 | Ga0207640_10237130 | 3300025981 | Bacteria | 1407 |
| 302 | Ga0207640_10530666 | 3300025981 | Bacteria | 985 |
| 303 | Ga0207677_10009354 | 3300026023 | Bacteria | 5514 |
| 304 | Ga0207677_11306142 | 3300026023 | Bacteria | 666 |
| 305 | Ga0207703_10055278 | 3300026035 | Bacteria | 3229 |
| 306 | Ga0207639_10077288 | 3300026041 | Bacteria | 2623 |
| 307 | Ga0207639_10132529 | 3300026041 | Bacteria | 2065 |
| 308 | Ga0207708_10362772 | 3300026075 | Bacteria | 1191 |
| 309 | Ga0207702_10014800 | 3300026078 | Bacteria | 6471 |
| 310 | Ga0207702_10146697 | 3300026078 | Bacteria | 2142 |
| 311 | Ga0207641_10067647 | 3300026088 | Bacteria | 3061 |
| 312 | Ga0207648_10029370 | 3300026089 | Bacteria | 4876 |
| 313 | Ga0207648_10762428 | 3300026089 | Bacteria | 899 |
| 314 | Ga0207648_11045533 | 3300026089 | Bacteria | 765 |
| 315 | Ga0207676_10842158 | 3300026095 | Bacteria | 897 |
| 316 | Ga0207674_10010500 | 3300026116 | Bacteria | 10481 |
| 317 | Ga0207675_100388638 | 3300026118 | Bacteria | 1373 |
| 318 | Ga0207675_101196125 | 3300026118 | Bacteria | 780 |
| 319 | Ga0207683_10198241 | 3300026121 | Bacteria | 1824 |
| 320 | Ga0207683_10345216 | 3300026121 | Bacteria | 1366 |
| 321 | Ga0207683_10550537 | 3300026121 | Bacteria | 1067 |
| 322 | Ga0207683_10863333 | 3300026121 | Bacteria | 840 |
| 323 | Ga0207698_10004231 | 3300026142 | Bacteria | 8731 |
| 324 | Ga0207698_10012782 | 3300026142 | Bacteria | 5512 |
| 325 | Ga0207698_10094025 | 3300026142 | Bacteria | 2463 |
| 326 | Ga0207698_10120165 | 3300026142 | Bacteria | 2222 |
| 327 | Ga0207698_10176002 | 3300026142 | Bacteria | 1889 |
| 328 | Ga0207698_11163018 | 3300026142 | Bacteria | 785 |
| 329 | Ga0207428_10002330 | 3300027907 | Bacteria | 19019 |
| 330 | Ga0268266_10041941 | 3300028379 | Bacteria | 3907 |
| 331 | Ga0268265_10509495 | 3300028380 | Bacteria | 1135 |
| 332 | Ga0268265_11080262 | 3300028380 | Bacteria | 796 |
| 333 | Ga0268264_10268065 | 3300028381 | Bacteria | 1594 |
| 334 | Ga0268264_10691145 | 3300028381 | Bacteria | 1013 |
| 335 | Ga0265330_10157369 | 3300031235 | Bacteria | 965 |
| 336 | Ga0265316_10085942 | 3300031344 | Bacteria | 2406 |
| 337 | Ga0265342_10187302 | 3300031712 | Bacteria | 1131 |
| 338 | Ga0307413_10068378 | 3300031824 | Bacteria | 2225 |
| 339 | Ga0307410_10244846 | 3300031852 | Bacteria | 1391 |
| 340 | Ga0307407_10620947 | 3300031903 | Bacteria | 807 |
| 341 | Ga0307412_10113384 | 3300031911 | Bacteria | 1939 |
| 342 | Ga0307412_10313376 | 3300031911 | Bacteria | 1245 |
| 343 | Ga0307409_100731298 | 3300031995 | Bacteria | 992 |
| 344 | Ga0307409_101004219 | 3300031995 | Bacteria | 853 |
| 345 | Ga0307416_100192126 | 3300032002 | Bacteria | 1927 |
| 346 | Ga0307416_100258468 | 3300032002 | Bacteria | 1700 |
| 347 | Ga0307416_100320458 | 3300032002 | Bacteria | 1552 |
| 348 | Ga0307416_100637088 | 3300032002 | Bacteria | 1149 |
| 349 | Ga0307416_100638706 | 3300032002 | Bacteria | 1148 |
| 350 | Ga0307414_10710957 | 3300032004 | Bacteria | 910 |
| 351 | Ga0307411_10677894 | 3300032005 | Bacteria | 895 |
| 352 | Ga0307415_100446804 | 3300032126 | Bacteria | 1117 |
| 353 | Ga0307415_100527249 | 3300032126 | Bacteria | 1038 |
| 354 | Ga0307415_101102313 | 3300032126 | Bacteria | 743 |
| 355 | Ga0307415_101278939 | 3300032126 | Bacteria | 694 |
| 356 | Ga0373958_0160734 | 3300034819 | Unclassified | 568 |
| 357 | Ga0373938_0166512 | 3300034957 | Bacteria | 595 |
| 358 | Ga0373944_0078514 | 3300035089 | Bacteria | 1087 |
| 359 | Ga0373932_0173442 | 3300035112 | Unclassified | 753 |
| 360 | Ga0373936_0254705 | 3300035113 | Bacteria | 785 |
| 361 | Ga0373960_0122613 | 3300035121 | Bacteria | 864 |
| 362 | Ga0373943_0111243 | 3300035170 | Bacteria | 1445 |
| 363 | Ga0373924_0051052 | 3300035410 | Bacteria | 1714 |
| 364 | Ga0373931_0355224 | 3300035691 | Bacteria | 918 |
| 365 | Ga0373935_0156858 | 3300035692 | Bacteria | 1549 |
| 366 | Ga0373927_0023854 | 3300035695 | Bacteria | 4002 |
| 367 | Ga0373927_0391058 | 3300035695 | Bacteria | 917 |
| 368 | Ga0373933_0041325 | 3300035724 | Bacteria | 2722 |
| 369 | Ga0373947_0255515 | 3300035725 | Bacteria | 1160 |
| 370 | Ga0373937_0001850 | 3300036401 | Bacteria | 17770 |
| 371 | Ga0373937_0060235 | 3300036401 | Bacteria | 3489 |
| 372 | Ga0373925_0034927 | 3300037068 | Bacteria | 3707 |
| 373 | Ga0373925_0436102 | 3300037068 | Bacteria | 1072 |
| 374 | Ga0395900_0084328 | 3300037418 | Bacteria | 3265 |
| 375 | Ga0395905_0004647 | 3300037471 | Bacteria | 14196 |
| 376 | Ga0395901_0212566 | 3300038443 | Bacteria | 2024 |
| 377 | Ga0436365_0986860 | 3300039437 | Bacteria | 2560 |
| 378 | Ga0436365_1524731 | 3300039437 | Bacteria | 643 |
| 379 | Ga0436365_1604790 | 3300039437 | Bacteria | 5268 |
| 380 | Ga0451807_1278057 | 3300041486 | Bacteria | 970 |
| 381 | Ga0451839_0477412 | 3300041496 | Bacteria | 608 |
| 382 | Ga0451853_0117916 | 3300041512 | Bacteria | 816 |
| 383 | Ga0451853_0593964 | 3300041512 | Bacteria | 1388 |
| 384 | Ga0450898_085587 | 3300042134 | Bacteria | 645 |
| 385 | Ga0439446_0028503 | 3300042156 | Bacteria | 1608 |
| 386 | Ga0451577_0406269 | 3300042876 | Bacteria | 1236 |
| 387 | Ga0466966_0018413 | 3300044684 | Bacteria | 4607 |
| 388 | Ga0466971_0151191 | 3300044719 | Bacteria | 1084 |
| 389 | Ga0466957_0012177 | 3300044842 | Bacteria | 4977 |
| 390 | Ga0466959_0171422 | 3300045049 | Bacteria | 1522 |
| 391 | Ga0466958_0008233 | 3300045836 | Bacteria | 5774 |
| 392 | Ga0466967_0986070 | 3300045976 | Bacteria | 839 |
| 393 | Ga0495592_0013889 | 3300046454 | Bacteria | 6120 |
| 394 | Ga0495653_0089398 | 3300046463 | Bacteria | 2257 |
| 395 | Ga0495608_0015577 | 3300046511 | Bacteria | 5268 |
| 396 | Ga0495628_0144327 | 3300046516 | Bacteria | 1815 |
| 397 | Ga0495587_0033850 | 3300046536 | Bacteria | 3083 |
| 398 | Ga0495598_0132725 | 3300046537 | Bacteria | 855 |
| 399 | Ga0495621_0001542 | 3300046539 | Bacteria | 5997 |
| 400 | Ga0495621_0003013 | 3300046539 | Bacteria | 4596 |
| 401 | Ga0495621_0042092 | 3300046539 | Bacteria | 1607 |
| 402 | Ga0495645_0002710 | 3300046543 | Bacteria | 12020 |
| 403 | Ga0495635_0042213 | 3300046663 | Bacteria | 3150 |
| 404 | Ga0495599_0112911 | 3300046678 | Bacteria | 1691 |
| 405 | Ga0495623_0063157 | 3300046679 | Bacteria | 2319 |
| 406 | Ga0495658_0094905 | 3300046683 | Bacteria | 1772 |
| 407 | Ga0495658_0136128 | 3300046683 | Bacteria | 1499 |
| 408 | Ga0495670_0187916 | 3300046691 | Unclassified | 1092 |
| 409 | Ga0495604_0188667 | 3300047317 | Bacteria | 1438 |
| 410 | Ga0495675_0170067 | 3300047444 | Bacteria | 1339 |
| 411 | Ga0495602_0072581 | 3300048088 | Bacteria | 2934 |
| 412 | Ga0496100_1068049 | 3300048903 | Unclassified | 636 |
| 413 | Ga0496104_0001840 | 3300048907 | Bacteria | 18346 |
| 414 | Ga0496105_0122145 | 3300048908 | Bacteria | 2147 |
| 415 | Ga0496109_0068047 | 3300048912 | Bacteria | 3264 |
| 416 | Ga0496110_0005881 | 3300048913 | Bacteria | 9654 |
| 417 | Ga0501291_036414 | 3300049514 | Bacteria | 850 |
| 418 | Ga0501047_0006773 | 3300049581 | Bacteria | 10766 |
| 419 | Ga0501047_0054575 | 3300049581 | Bacteria | 3865 |
| 420 | Ga0501047_0119654 | 3300049581 | Bacteria | 2516 |
| 421 | Ga0501069_0000499 | 3300049585 | Bacteria | 17869 |
| 422 | Ga0501070_0000922 | 3300049586 | Bacteria | 26611 |
| 423 | Ga0501070_0872733 | 3300049586 | Bacteria | 703 |
| 424 | Ga0501073_0000119 | 3300049589 | Bacteria | 50663 |
| 425 | Ga0501073_0299291 | 3300049589 | Bacteria | 1110 |
| 426 | Ga0501074_0000634 | 3300049590 | Bacteria | 21786 |
| 427 | Ga0501074_0295343 | 3300049590 | Bacteria | 1151 |
| 428 | Ga0501079_0006014 | 3300049741 | Bacteria | 9092 |
| 429 | Ga0501080_0010597 | 3300049742 | Bacteria | 8437 |
| 430 | Ga0501080_0053239 | 3300049742 | Bacteria | 3767 |
| 431 | Ga0501080_0080270 | 3300049742 | Bacteria | 3032 |
| 432 | Ga0501083_0020281 | 3300049744 | Bacteria | 4625 |
| 433 | Ga0501035_0047595 | 3300049822 | Bacteria | 3849 |
| 434 | Ga0501044_0158568 | 3300049823 | Bacteria | 2241 |
| 435 | nmdc:mga03683_24737_c1 | 3300050489 | Bacteria | 2352 |
| 436 | nmdc:mga03n38_187918_c1 | 3300050490 | Bacteria | 1062 |
| 437 | nmdc:mga00v17_164927_c1 | 3300050491 | Bacteria | 1427 |
| 438 | nmdc:mga00v17_2243_c1 | 3300050491 | Bacteria | 9905 |
| 439 | nmdc:mga00v17_322747_c1 | 3300050491 | Unclassified | 1003 |
| 440 | nmdc:mga0k408_13210_c1 | 3300050493 | Bacteria | 4525 |
| 441 | nmdc:mga0k408_15090_c1 | 3300050493 | Bacteria | 4270 |
| 442 | nmdc:mga0k408_17607_c1 | 3300050493 | Bacteria | 3982 |
| 443 | nmdc:mga0k408_26290_c1 | 3300050493 | Bacteria | 3299 |
| 444 | nmdc:mga0k408_438539_c1 | 3300050493 | Bacteria | 776 |
| 445 | nmdc:mga0k408_6775_c1 | 3300050493 | Bacteria | 6111 |
| 446 | nmdc:mga06z11_143334_c1 | 3300050494 | Bacteria | 1352 |
| 447 | nmdc:mga08y16_2348_c1 | 3300050511 | Bacteria | 19397 |
| 448 | nmdc:mga08y16_995811_c1 | 3300050511 | Bacteria | 818 |
| 449 | nmdc:mga0n895_175554_c1 | 3300050512 | Bacteria | 2173 |
| 450 | nmdc:mga0n895_256358_c1 | 3300050512 | Bacteria | 1775 |
| 451 | nmdc:mga0n895_97840_c1 | 3300050512 | Bacteria | 2940 |
| 452 | nmdc:mga0rr50_453274_c1 | 3300050513 | Bacteria | 1087 |
| 453 | nmdc:mga0rr50_508897_c1 | 3300050513 | Bacteria | 1024 |
| 454 | nmdc:mga0rr50_80035_c1 | 3300050513 | Bacteria | 2518 |
| 455 | nmdc:mga08x19_46760_c1 | 3300050514 | Bacteria | 2769 |
| 456 | nmdc:mga08x19_591654_c1 | 3300050514 | Bacteria | 786 |
| 457 | nmdc:mga08x19_93490_c1 | 3300050514 | Bacteria | 1987 |
| 458 | nmdc:mga0a205_25697_c2 | 3300050515 | Bacteria | 3168 |
| 459 | Ga0495601_0005289 | 3300053077 | Bacteria | 7511 |
| 460 | Ga0495619_0102050 | 3300053085 | Bacteria | 1953 |
| 461 | Ga0500641_0173406 | 3300053096 | Bacteria | 928 |
| 462 | Ga0466962_0069427 | 3300061719 | Bacteria | 1683 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031911 | Ga0307412_10113384 | Ga0307412_101133842 | 152 |
| 2 | 3300032002 | Ga0307416_100637088 | Ga0307416_1006370883 | 152 |
| 3 | 3300032126 | Ga0307415_101102313 | Ga0307415_1011023132 | 152 |
| 4 | 3300014326 | Ga0157380_10598992 | Ga0157380_105989922 | 156 |
| 5 | 3300050491 | nmdc:mga00v17_322747_c1 | nmdc:mga00v17_322747_c1_433_915 | 159 |
| 6 | 3300050493 | nmdc:mga0k408_26290_c1 | nmdc:mga0k408_26290_c1_1318_1800 | 159 |
| 7 | 3300050493 | nmdc:mga0k408_6775_c1 | nmdc:mga0k408_6775_c1_3704_4186 | 159 |
| 8 | 3300031911 | Ga0307412_10313376 | Ga0307412_103133761 | 160 |
| 9 | 3300032002 | Ga0307416_100258468 | Ga0307416_1002584683 | 160 |
| 10 | 3300032126 | Ga0307415_100527249 | Ga0307415_1005272492 | 160 |
| 11 | 3300049514 | Ga0501291_036414 | Ga0501291_036414_220_732 | 160 |
| 12 | 3300005459 | Ga0068867_100342166 | Ga0068867_1003421662 | 161 |
| 13 | 3300025937 | Ga0207669_10171802 | Ga0207669_101718022 | 161 |
| 14 | 3300005440 | Ga0070705_100131025 | Ga0070705_1001310253 | 162 |
| 15 | 3300005436 | Ga0070713_101545344 | Ga0070713_1015453441 | 163 |
| 16 | 3300005343 | Ga0070687_100029755 | Ga0070687_1000297552 | 165 |
| 17 | 3300005459 | Ga0068867_101049986 | Ga0068867_1010499862 | 165 |
| 18 | 3300005466 | Ga0070685_10107237 | Ga0070685_101072371 | 165 |
| 19 | 3300005719 | Ga0068861_100108694 | Ga0068861_1001086945 | 165 |
| 20 | 3300005842 | Ga0068858_100005000 | Ga0068858_10000500013 | 165 |
| 21 | 3300009176 | Ga0105242_10003249 | Ga0105242_100032497 | 165 |
| 22 | 3300013306 | Ga0163162_10068743 | Ga0163162_100687432 | 165 |
| 23 | 3300014968 | Ga0157379_10033222 | Ga0157379_100332227 | 165 |
| 24 | 3300025918 | Ga0207662_10030115 | Ga0207662_100301153 | 165 |
| 25 | 3300025924 | Ga0207694_10040105 | Ga0207694_100401054 | 165 |
| 26 | 3300025934 | Ga0207686_10002739 | Ga0207686_100027393 | 165 |
| 27 | 3300026035 | Ga0207703_10055278 | Ga0207703_100552786 | 165 |
| 28 | 3300026089 | Ga0207648_11045533 | Ga0207648_110455332 | 165 |
| 29 | 3300005290 | Ga0065712_10080002 | Ga0065712_100800022 | 170 |
| 30 | 3300005327 | Ga0070658_10044818 | Ga0070658_100448184 | 170 |
| 31 | 3300005327 | Ga0070658_10276503 | Ga0070658_102765032 | 170 |
| 32 | 3300005327 | Ga0070658_10291056 | Ga0070658_102910563 | 170 |
| 33 | 3300005328 | Ga0070676_10569857 | Ga0070676_105698572 | 170 |
| 34 | 3300005329 | Ga0070683_100055071 | Ga0070683_1000550715 | 170 |
| 35 | 3300005329 | Ga0070683_100146743 | Ga0070683_1001467431 | 170 |
| 36 | 3300005329 | Ga0070683_100860158 | Ga0070683_1008601581 | 170 |
| 37 | 3300005330 | Ga0070690_100032911 | Ga0070690_1000329112 | 170 |
| 38 | 3300005330 | Ga0070690_100203595 | Ga0070690_1002035953 | 170 |
| 39 | 3300005330 | Ga0070690_100227774 | Ga0070690_1002277742 | 170 |
| 40 | 3300005331 | Ga0070670_100236329 | Ga0070670_1002363292 | 170 |
| 41 | 3300005334 | Ga0068869_100017993 | Ga0068869_1000179932 | 170 |
| 42 | 3300005335 | Ga0070666_10835878 | Ga0070666_108358781 | 170 |
| 43 | 3300005336 | Ga0070680_100438584 | Ga0070680_1004385841 | 170 |
| 44 | 3300005338 | Ga0068868_100015562 | Ga0068868_1000155627 | 170 |
| 45 | 3300005338 | Ga0068868_100674280 | Ga0068868_1006742802 | 170 |
| 46 | 3300005339 | Ga0070660_100184314 | Ga0070660_1001843142 | 170 |
| 47 | 3300005340 | Ga0070689_100003209 | Ga0070689_1000032094 | 170 |
| 48 | 3300005340 | Ga0070689_100401954 | Ga0070689_1004019542 | 170 |
| 49 | 3300005343 | Ga0070687_100042780 | Ga0070687_1000427802 | 170 |
| 50 | 3300005343 | Ga0070687_100092202 | Ga0070687_1000922022 | 170 |
| 51 | 3300005343 | Ga0070687_100277940 | Ga0070687_1002779402 | 170 |
| 52 | 3300005344 | Ga0070661_100690518 | Ga0070661_1006905182 | 170 |
| 53 | 3300005345 | Ga0070692_10287626 | Ga0070692_102876262 | 170 |
| 54 | 3300005345 | Ga0070692_10326855 | Ga0070692_103268552 | 170 |
| 55 | 3300005353 | Ga0070669_100508788 | Ga0070669_1005087882 | 170 |
| 56 | 3300005354 | Ga0070675_100105382 | Ga0070675_1001053824 | 170 |
| 57 | 3300005354 | Ga0070675_101649886 | Ga0070675_1016498861 | 170 |
| 58 | 3300005355 | Ga0070671_100224950 | Ga0070671_1002249502 | 170 |
| 59 | 3300005356 | Ga0070674_100064737 | Ga0070674_1000647372 | 170 |
| 60 | 3300005356 | Ga0070674_100326713 | Ga0070674_1003267131 | 170 |
| 61 | 3300005356 | Ga0070674_100415355 | Ga0070674_1004153552 | 170 |
| 62 | 3300005364 | Ga0070673_100024659 | Ga0070673_1000246597 | 170 |
| 63 | 3300005364 | Ga0070673_100061662 | Ga0070673_1000616623 | 170 |
| 64 | 3300005366 | Ga0070659_100213708 | Ga0070659_1002137082 | 170 |
| 65 | 3300005434 | Ga0070709_10054032 | Ga0070709_100540322 | 170 |
| 66 | 3300005435 | Ga0070714_100089470 | Ga0070714_1000894702 | 170 |
| 67 | 3300005436 | Ga0070713_100001908 | Ga0070713_1000019083 | 170 |
| 68 | 3300005436 | Ga0070713_101007362 | Ga0070713_1010073622 | 170 |
| 69 | 3300005437 | Ga0070710_10223136 | Ga0070710_102231363 | 170 |
| 70 | 3300005438 | Ga0070701_10090468 | Ga0070701_100904682 | 170 |
| 71 | 3300005438 | Ga0070701_10473918 | Ga0070701_104739182 | 170 |
| 72 | 3300005439 | Ga0070711_100910245 | Ga0070711_1009102451 | 170 |
| 73 | 3300005444 | Ga0070694_100229188 | Ga0070694_1002291882 | 170 |
| 74 | 3300005456 | Ga0070678_100084387 | Ga0070678_1000843871 | 170 |
| 75 | 3300005456 | Ga0070678_100453353 | Ga0070678_1004533533 | 170 |
| 76 | 3300005456 | Ga0070678_100997397 | Ga0070678_1009973971 | 170 |
| 77 | 3300005456 | Ga0070678_101014561 | Ga0070678_1010145612 | 170 |
| 78 | 3300005456 | Ga0070678_101131643 | Ga0070678_1011316431 | 170 |
| 79 | 3300005458 | Ga0070681_10004695 | Ga0070681_100046953 | 170 |
| 80 | 3300005458 | Ga0070681_10182842 | Ga0070681_101828422 | 170 |
| 81 | 3300005459 | Ga0068867_100046141 | Ga0068867_1000461412 | 170 |
| 82 | 3300005466 | Ga0070685_10014304 | Ga0070685_100143045 | 170 |
| 83 | 3300005466 | Ga0070685_10136474 | Ga0070685_101364742 | 170 |
| 84 | 3300005466 | Ga0070685_10178830 | Ga0070685_101788302 | 170 |
| 85 | 3300005471 | Ga0070698_100365617 | Ga0070698_1003656171 | 170 |
| 86 | 3300005518 | Ga0070699_100232943 | Ga0070699_1002329432 | 170 |
| 87 | 3300005530 | Ga0070679_100143561 | Ga0070679_1001435612 | 170 |
| 88 | 3300005530 | Ga0070679_100167031 | Ga0070679_1001670313 | 170 |
| 89 | 3300005539 | Ga0068853_100036967 | Ga0068853_1000369675 | 170 |
| 90 | 3300005539 | Ga0068853_100085845 | Ga0068853_1000858452 | 170 |
| 91 | 3300005539 | Ga0068853_100498800 | Ga0068853_1004988001 | 170 |
| 92 | 3300005543 | Ga0070672_100039923 | Ga0070672_1000399236 | 170 |
| 93 | 3300005543 | Ga0070672_101074896 | Ga0070672_1010748961 | 170 |
| 94 | 3300005544 | Ga0070686_100236067 | Ga0070686_1002360672 | 170 |
| 95 | 3300005544 | Ga0070686_100867987 | Ga0070686_1008679871 | 170 |
| 96 | 3300005545 | Ga0070695_100932160 | Ga0070695_1009321601 | 170 |
| 97 | 3300005546 | Ga0070696_100008517 | Ga0070696_1000085176 | 170 |
| 98 | 3300005547 | Ga0070693_100026306 | Ga0070693_1000263063 | 170 |
| 99 | 3300005547 | Ga0070693_100271894 | Ga0070693_1002718942 | 170 |
| 100 | 3300005549 | Ga0070704_100142914 | Ga0070704_1001429142 | 170 |
| 101 | 3300005549 | Ga0070704_101286330 | Ga0070704_1012863301 | 170 |
| 102 | 3300005563 | Ga0068855_100021633 | Ga0068855_1000216338 | 170 |
| 103 | 3300005563 | Ga0068855_100023905 | Ga0068855_1000239052 | 170 |
| 104 | 3300005563 | Ga0068855_100108838 | Ga0068855_1001088382 | 170 |
| 105 | 3300005563 | Ga0068855_100416724 | Ga0068855_1004167242 | 170 |
| 106 | 3300005563 | Ga0068855_100609419 | Ga0068855_1006094192 | 170 |
| 107 | 3300005564 | Ga0070664_101105276 | Ga0070664_1011052762 | 170 |
| 108 | 3300005577 | Ga0068857_100021385 | Ga0068857_1000213858 | 170 |
| 109 | 3300005577 | Ga0068857_101090238 | Ga0068857_1010902382 | 170 |
| 110 | 3300005578 | Ga0068854_100132195 | Ga0068854_1001321952 | 170 |
| 111 | 3300005578 | Ga0068854_100186829 | Ga0068854_1001868292 | 170 |
| 112 | 3300005578 | Ga0068854_100326657 | Ga0068854_1003266572 | 170 |
| 113 | 3300005578 | Ga0068854_100593603 | Ga0068854_1005936031 | 170 |
| 114 | 3300005614 | Ga0068856_100033170 | Ga0068856_1000331703 | 170 |
| 115 | 3300005614 | Ga0068856_100470886 | Ga0068856_1004708862 | 170 |
| 116 | 3300005615 | Ga0070702_100666228 | Ga0070702_1006662281 | 170 |
| 117 | 3300005616 | Ga0068852_100000366 | Ga0068852_1000003664 | 170 |
| 118 | 3300005616 | Ga0068852_100009416 | Ga0068852_1000094163 | 170 |
| 119 | 3300005616 | Ga0068852_100017259 | Ga0068852_1000172592 | 170 |
| 120 | 3300005616 | Ga0068852_100068664 | Ga0068852_1000686643 | 170 |
| 121 | 3300005617 | Ga0068859_100076300 | Ga0068859_1000763002 | 170 |
| 122 | 3300005617 | Ga0068859_100097344 | Ga0068859_1000973443 | 170 |
| 123 | 3300005617 | Ga0068859_101288936 | Ga0068859_1012889362 | 170 |
| 124 | 3300005618 | Ga0068864_100114603 | Ga0068864_1001146033 | 170 |
| 125 | 3300005618 | Ga0068864_101509600 | Ga0068864_1015096001 | 170 |
| 126 | 3300005719 | Ga0068861_100318317 | Ga0068861_1003183172 | 170 |
| 127 | 3300005834 | Ga0068851_10000446 | Ga0068851_100004462 | 170 |
| 128 | 3300005840 | Ga0068870_10335113 | Ga0068870_103351132 | 170 |
| 129 | 3300005840 | Ga0068870_10582540 | Ga0068870_105825401 | 170 |
| 130 | 3300005841 | Ga0068863_100043189 | Ga0068863_1000431892 | 170 |
| 131 | 3300005841 | Ga0068863_100847534 | Ga0068863_1008475342 | 170 |
| 132 | 3300005842 | Ga0068858_100115283 | Ga0068858_1001152832 | 170 |
| 133 | 3300005843 | Ga0068860_100238668 | Ga0068860_1002386682 | 170 |
| 134 | 3300005843 | Ga0068860_100828536 | Ga0068860_1008285362 | 170 |
| 135 | 3300005843 | Ga0068860_101690768 | Ga0068860_1016907681 | 170 |
| 136 | 3300005844 | Ga0068862_100101773 | Ga0068862_1001017732 | 170 |
| 137 | 3300006028 | Ga0070717_10201669 | Ga0070717_102016693 | 170 |
| 138 | 3300006051 | Ga0075364_10023591 | Ga0075364_100235915 | 170 |
| 139 | 3300006051 | Ga0075364_10109474 | Ga0075364_101094742 | 170 |
| 140 | 3300006051 | Ga0075364_10169895 | Ga0075364_101698952 | 170 |
| 141 | 3300006058 | Ga0075432_10086405 | Ga0075432_100864052 | 170 |
| 142 | 3300006173 | Ga0070716_100689435 | Ga0070716_1006894352 | 170 |
| 143 | 3300006173 | Ga0070716_100945856 | Ga0070716_1009458562 | 170 |
| 144 | 3300006177 | Ga0075362_10030186 | Ga0075362_100301862 | 170 |
| 145 | 3300006177 | Ga0075362_10136490 | Ga0075362_101364902 | 170 |
| 146 | 3300006186 | Ga0075369_10000795 | Ga0075369_100007953 | 170 |
| 147 | 3300006195 | Ga0075366_10002459 | Ga0075366_100024593 | 170 |
| 148 | 3300006195 | Ga0075366_10007847 | Ga0075366_100078473 | 170 |
| 149 | 3300006195 | Ga0075366_10008100 | Ga0075366_100081002 | 170 |
| 150 | 3300006195 | Ga0075366_10035799 | Ga0075366_100357994 | 170 |
| 151 | 3300006195 | Ga0075366_10037017 | Ga0075366_100370172 | 170 |
| 152 | 3300006195 | Ga0075366_10401774 | Ga0075366_104017741 | 170 |
| 153 | 3300006237 | Ga0097621_100017590 | Ga0097621_1000175905 | 170 |
| 154 | 3300006237 | Ga0097621_100020123 | Ga0097621_1000201233 | 170 |
| 155 | 3300006237 | Ga0097621_100146595 | Ga0097621_1001465953 | 170 |
| 156 | 3300006237 | Ga0097621_100206404 | Ga0097621_1002064042 | 170 |
| 157 | 3300006358 | Ga0068871_100045534 | Ga0068871_1000455342 | 170 |
| 158 | 3300006358 | Ga0068871_100051801 | Ga0068871_1000518012 | 170 |
| 159 | 3300006358 | Ga0068871_100849454 | Ga0068871_1008494542 | 170 |
| 160 | 3300006358 | Ga0068871_101381020 | Ga0068871_1013810202 | 170 |
| 161 | 3300006844 | Ga0075428_100369171 | Ga0075428_1003691712 | 170 |
| 162 | 3300006846 | Ga0075430_100305874 | Ga0075430_1003058742 | 170 |
| 163 | 3300006871 | Ga0075434_100050939 | Ga0075434_1000509396 | 170 |
| 164 | 3300006871 | Ga0075434_100091551 | Ga0075434_1000915512 | 170 |
| 165 | 3300006871 | Ga0075434_100139184 | Ga0075434_1001391842 | 170 |
| 166 | 3300006880 | Ga0075429_100126485 | Ga0075429_1001264854 | 170 |
| 167 | 3300006881 | Ga0068865_100487167 | Ga0068865_1004871672 | 170 |
| 168 | 3300006881 | Ga0068865_100521961 | Ga0068865_1005219611 | 170 |
| 169 | 3300006914 | Ga0075436_100003266 | Ga0075436_10000326610 | 170 |
| 170 | 3300006914 | Ga0075436_100059214 | Ga0075436_1000592143 | 170 |
| 171 | 3300006914 | Ga0075436_100320327 | Ga0075436_1003203273 | 170 |
| 172 | 3300006931 | Ga0097620_100076307 | Ga0097620_1000763072 | 170 |
| 173 | 3300006931 | Ga0097620_100097345 | Ga0097620_1000973453 | 170 |
| 174 | 3300006931 | Ga0097620_101289166 | Ga0097620_1012891662 | 170 |
| 175 | 3300007076 | Ga0075435_100149405 | Ga0075435_1001494052 | 170 |
| 176 | 3300007076 | Ga0075435_100280295 | Ga0075435_1002802952 | 170 |
| 177 | 3300007076 | Ga0075435_100308449 | Ga0075435_1003084492 | 170 |
| 178 | 3300009093 | Ga0105240_10028255 | Ga0105240_100282557 | 170 |
| 179 | 3300009093 | Ga0105240_10127476 | Ga0105240_101274762 | 170 |
| 180 | 3300009093 | Ga0105240_10131593 | Ga0105240_101315932 | 170 |
| 181 | 3300009093 | Ga0105240_10165926 | Ga0105240_101659265 | 170 |
| 182 | 3300009094 | Ga0111539_10002062 | Ga0111539_100020622 | 170 |
| 183 | 3300009094 | Ga0111539_11095578 | Ga0111539_110955782 | 170 |
| 184 | 3300009098 | Ga0105245_10330592 | Ga0105245_103305923 | 170 |
| 185 | 3300009098 | Ga0105245_10509690 | Ga0105245_105096902 | 170 |
| 186 | 3300009098 | Ga0105245_10634709 | Ga0105245_106347092 | 170 |
| 187 | 3300009098 | Ga0105245_10675690 | Ga0105245_106756902 | 170 |
| 188 | 3300009148 | Ga0105243_11024551 | Ga0105243_110245511 | 170 |
| 189 | 3300009174 | Ga0105241_10015972 | Ga0105241_100159722 | 170 |
| 190 | 3300009174 | Ga0105241_10488787 | Ga0105241_104887873 | 170 |
| 191 | 3300009174 | Ga0105241_11909053 | Ga0105241_119090531 | 170 |
| 192 | 3300009176 | Ga0105242_10039194 | Ga0105242_100391945 | 170 |
| 193 | 3300009176 | Ga0105242_10085855 | Ga0105242_100858552 | 170 |
| 194 | 3300009176 | Ga0105242_10349499 | Ga0105242_103494991 | 170 |
| 195 | 3300009176 | Ga0105242_10479404 | Ga0105242_104794043 | 170 |
| 196 | 3300009176 | Ga0105242_10676547 | Ga0105242_106765472 | 170 |
| 197 | 3300009177 | Ga0105248_10045481 | Ga0105248_100454812 | 170 |
| 198 | 3300009177 | Ga0105248_10047767 | Ga0105248_100477672 | 170 |
| 199 | 3300009177 | Ga0105248_10081168 | Ga0105248_100811685 | 170 |
| 200 | 3300009177 | Ga0105248_11006648 | Ga0105248_110066481 | 170 |
| 201 | 3300009551 | Ga0105238_10014448 | Ga0105238_100144489 | 170 |
| 202 | 3300009551 | Ga0105238_10555001 | Ga0105238_105550012 | 170 |
| 203 | 3300009551 | Ga0105238_11467381 | Ga0105238_114673812 | 170 |
| 204 | 3300009553 | Ga0105249_10191356 | Ga0105249_101913564 | 170 |
| 205 | 3300009553 | Ga0105249_10839242 | Ga0105249_108392422 | 170 |
| 206 | 3300013102 | Ga0157371_10147734 | Ga0157371_101477343 | 170 |
| 207 | 3300013102 | Ga0157371_10376088 | Ga0157371_103760882 | 170 |
| 208 | 3300013104 | Ga0157370_10011580 | Ga0157370_100115806 | 170 |
| 209 | 3300013104 | Ga0157370_10891957 | Ga0157370_108919572 | 170 |
| 210 | 3300013105 | Ga0157369_10060943 | Ga0157369_100609435 | 170 |
| 211 | 3300013105 | Ga0157369_10135858 | Ga0157369_101358583 | 170 |
| 212 | 3300013296 | Ga0157374_10041952 | Ga0157374_100419527 | 170 |
| 213 | 3300013296 | Ga0157374_10154778 | Ga0157374_101547785 | 170 |
| 214 | 3300013297 | Ga0157378_10014205 | Ga0157378_100142053 | 170 |
| 215 | 3300013297 | Ga0157378_10199294 | Ga0157378_101992942 | 170 |
| 216 | 3300013297 | Ga0157378_10792742 | Ga0157378_107927422 | 170 |
| 217 | 3300013306 | Ga0163162_10403036 | Ga0163162_104030362 | 170 |
| 218 | 3300013306 | Ga0163162_11630773 | Ga0163162_116307731 | 170 |
| 219 | 3300013307 | Ga0157372_10000909 | Ga0157372_1000090933 | 170 |
| 220 | 3300013307 | Ga0157372_10050929 | Ga0157372_100509292 | 170 |
| 221 | 3300013307 | Ga0157372_10555043 | Ga0157372_105550432 | 170 |
| 222 | 3300013308 | Ga0157375_10011811 | Ga0157375_100118113 | 170 |
| 223 | 3300013308 | Ga0157375_10920972 | Ga0157375_109209722 | 170 |
| 224 | 3300013308 | Ga0157375_10972770 | Ga0157375_109727702 | 170 |
| 225 | 3300014325 | Ga0163163_11019424 | Ga0163163_110194243 | 170 |
| 226 | 3300014326 | Ga0157380_10028919 | Ga0157380_100289192 | 170 |
| 227 | 3300014326 | Ga0157380_10358192 | Ga0157380_103581922 | 170 |
| 228 | 3300014326 | Ga0157380_10910037 | Ga0157380_109100372 | 170 |
| 229 | 3300014745 | Ga0157377_10298907 | Ga0157377_102989072 | 170 |
| 230 | 3300014968 | Ga0157379_10106641 | Ga0157379_101066412 | 170 |
| 231 | 3300014969 | Ga0157376_10037328 | Ga0157376_100373283 | 170 |
| 232 | 3300014969 | Ga0157376_11290530 | Ga0157376_112905302 | 170 |
| 233 | 3300017792 | Ga0163161_10547228 | Ga0163161_105472282 | 170 |
| 234 | 3300025321 | Ga0207656_10005870 | Ga0207656_100058701 | 170 |
| 235 | 3300025893 | Ga0207682_10072180 | Ga0207682_100721802 | 170 |
| 236 | 3300025893 | Ga0207682_10104966 | Ga0207682_101049662 | 170 |
| 237 | 3300025898 | Ga0207692_10110247 | Ga0207692_101102472 | 170 |
| 238 | 3300025901 | Ga0207688_10022551 | Ga0207688_100225512 | 170 |
| 239 | 3300025905 | Ga0207685_10052236 | Ga0207685_100522362 | 170 |
| 240 | 3300025907 | Ga0207645_10367190 | Ga0207645_103671902 | 170 |
| 241 | 3300025908 | Ga0207643_10223404 | Ga0207643_102234042 | 170 |
| 242 | 3300025908 | Ga0207643_10452259 | Ga0207643_104522592 | 170 |
| 243 | 3300025909 | Ga0207705_10020878 | Ga0207705_100208786 | 170 |
| 244 | 3300025909 | Ga0207705_10164506 | Ga0207705_101645062 | 170 |
| 245 | 3300025909 | Ga0207705_10210687 | Ga0207705_102106872 | 170 |
| 246 | 3300025911 | Ga0207654_10019029 | Ga0207654_100190295 | 170 |
| 247 | 3300025911 | Ga0207654_10093195 | Ga0207654_100931952 | 170 |
| 248 | 3300025913 | Ga0207695_10038032 | Ga0207695_100380326 | 170 |
| 249 | 3300025913 | Ga0207695_10081577 | Ga0207695_100815776 | 170 |
| 250 | 3300025913 | Ga0207695_10212860 | Ga0207695_102128602 | 170 |
| 251 | 3300025916 | Ga0207663_10261629 | Ga0207663_102616292 | 170 |
| 252 | 3300025917 | Ga0207660_10256127 | Ga0207660_102561272 | 170 |
| 253 | 3300025917 | Ga0207660_10670972 | Ga0207660_106709722 | 170 |
| 254 | 3300025918 | Ga0207662_10056285 | Ga0207662_100562852 | 170 |
| 255 | 3300025918 | Ga0207662_10062899 | Ga0207662_100628995 | 170 |
| 256 | 3300025918 | Ga0207662_10075703 | Ga0207662_100757033 | 170 |
| 257 | 3300025918 | Ga0207662_10205489 | Ga0207662_102054892 | 170 |
| 258 | 3300025918 | Ga0207662_10222130 | Ga0207662_102221302 | 170 |
| 259 | 3300025918 | Ga0207662_10688746 | Ga0207662_106887462 | 170 |
| 260 | 3300025919 | Ga0207657_10226620 | Ga0207657_102266203 | 170 |
| 261 | 3300025920 | Ga0207649_10628861 | Ga0207649_106288611 | 170 |
| 262 | 3300025920 | Ga0207649_10935943 | Ga0207649_109359432 | 170 |
| 263 | 3300025921 | Ga0207652_10113446 | Ga0207652_101134464 | 170 |
| 264 | 3300025921 | Ga0207652_10138715 | Ga0207652_101387153 | 170 |
| 265 | 3300025922 | Ga0207646_10731683 | Ga0207646_107316832 | 170 |
| 266 | 3300025923 | Ga0207681_10134117 | Ga0207681_101341172 | 170 |
| 267 | 3300025924 | Ga0207694_10004983 | Ga0207694_100049839 | 170 |
| 268 | 3300025924 | Ga0207694_10743948 | Ga0207694_107439481 | 170 |
| 269 | 3300025924 | Ga0207694_10771752 | Ga0207694_107717522 | 170 |
| 270 | 3300025924 | Ga0207694_11313679 | Ga0207694_113136791 | 170 |
| 271 | 3300025925 | Ga0207650_10207056 | Ga0207650_102070562 | 170 |
| 272 | 3300025925 | Ga0207650_11000726 | Ga0207650_110007262 | 170 |
| 273 | 3300025926 | Ga0207659_10034365 | Ga0207659_100343652 | 170 |
| 274 | 3300025927 | Ga0207687_10065936 | Ga0207687_100659362 | 170 |
| 275 | 3300025927 | Ga0207687_10730526 | Ga0207687_107305262 | 170 |
| 276 | 3300025927 | Ga0207687_10819497 | Ga0207687_108194972 | 170 |
| 277 | 3300025928 | Ga0207700_10658939 | Ga0207700_106589392 | 170 |
| 278 | 3300025929 | Ga0207664_10123357 | Ga0207664_101233572 | 170 |
| 279 | 3300025929 | Ga0207664_10682803 | Ga0207664_106828031 | 170 |
| 280 | 3300025931 | Ga0207644_10204699 | Ga0207644_102046991 | 170 |
| 281 | 3300025932 | Ga0207690_10195511 | Ga0207690_101955113 | 170 |
| 282 | 3300025934 | Ga0207686_10012336 | Ga0207686_100123365 | 170 |
| 283 | 3300025934 | Ga0207686_10020528 | Ga0207686_100205282 | 170 |
| 284 | 3300025934 | Ga0207686_10203501 | Ga0207686_102035012 | 170 |
| 285 | 3300025934 | Ga0207686_10524440 | Ga0207686_105244402 | 170 |
| 286 | 3300025935 | Ga0207709_10246130 | Ga0207709_102461302 | 170 |
| 287 | 3300025936 | Ga0207670_10161583 | Ga0207670_101615832 | 170 |
| 288 | 3300025936 | Ga0207670_10190367 | Ga0207670_101903671 | 170 |
| 289 | 3300025937 | Ga0207669_10074937 | Ga0207669_100749373 | 170 |
| 290 | 3300025938 | Ga0207704_10328500 | Ga0207704_103285002 | 170 |
| 291 | 3300025938 | Ga0207704_10803787 | Ga0207704_108037871 | 170 |
| 292 | 3300025939 | Ga0207665_10395478 | Ga0207665_103954782 | 170 |
| 293 | 3300025940 | Ga0207691_10059323 | Ga0207691_100593236 | 170 |
| 294 | 3300025940 | Ga0207691_10705382 | Ga0207691_107053822 | 170 |
| 295 | 3300025941 | Ga0207711_10020985 | Ga0207711_100209856 | 170 |
| 296 | 3300025941 | Ga0207711_10026751 | Ga0207711_100267516 | 170 |
| 297 | 3300025942 | Ga0207689_10025409 | Ga0207689_100254093 | 170 |
| 298 | 3300025942 | Ga0207689_10535906 | Ga0207689_105359062 | 170 |
| 299 | 3300025944 | Ga0207661_10083258 | Ga0207661_100832581 | 170 |
| 300 | 3300025944 | Ga0207661_10798402 | Ga0207661_107984022 | 170 |
| 301 | 3300025945 | Ga0207679_11098948 | Ga0207679_110989482 | 170 |
| 302 | 3300025949 | Ga0207667_10019072 | Ga0207667_100190723 | 170 |
| 303 | 3300025949 | Ga0207667_10029787 | Ga0207667_100297872 | 170 |
| 304 | 3300025949 | Ga0207667_10090885 | Ga0207667_100908854 | 170 |
| 305 | 3300025949 | Ga0207667_10091933 | Ga0207667_100919332 | 170 |
| 306 | 3300025949 | Ga0207667_10104227 | Ga0207667_101042272 | 170 |
| 307 | 3300025949 | Ga0207667_10265385 | Ga0207667_102653852 | 170 |
| 308 | 3300025949 | Ga0207667_11159839 | Ga0207667_111598392 | 170 |
| 309 | 3300025960 | Ga0207651_10226175 | Ga0207651_102261752 | 170 |
| 310 | 3300025960 | Ga0207651_11030802 | Ga0207651_110308022 | 170 |
| 311 | 3300025961 | Ga0207712_10926995 | Ga0207712_109269952 | 170 |
| 312 | 3300025981 | Ga0207640_10162558 | Ga0207640_101625582 | 170 |
| 313 | 3300025981 | Ga0207640_10237130 | Ga0207640_102371302 | 170 |
| 314 | 3300025981 | Ga0207640_10530666 | Ga0207640_105306662 | 170 |
| 315 | 3300026023 | Ga0207677_10009354 | Ga0207677_100093542 | 170 |
| 316 | 3300026023 | Ga0207677_11306142 | Ga0207677_113061422 | 170 |
| 317 | 3300026041 | Ga0207639_10077288 | Ga0207639_100772882 | 170 |
| 318 | 3300026041 | Ga0207639_10132529 | Ga0207639_101325292 | 170 |
| 319 | 3300026075 | Ga0207708_10362772 | Ga0207708_103627722 | 170 |
| 320 | 3300026078 | Ga0207702_10014800 | Ga0207702_100148003 | 170 |
| 321 | 3300026078 | Ga0207702_10146697 | Ga0207702_101466973 | 170 |
| 322 | 3300026088 | Ga0207641_10067647 | Ga0207641_100676472 | 170 |
| 323 | 3300026089 | Ga0207648_10029370 | Ga0207648_100293702 | 170 |
| 324 | 3300026089 | Ga0207648_10762428 | Ga0207648_107624281 | 170 |
| 325 | 3300026095 | Ga0207676_10842158 | Ga0207676_108421582 | 170 |
| 326 | 3300026116 | Ga0207674_10010500 | Ga0207674_100105009 | 170 |
| 327 | 3300026118 | Ga0207675_100388638 | Ga0207675_1003886382 | 170 |
| 328 | 3300026118 | Ga0207675_101196125 | Ga0207675_1011961252 | 170 |
| 329 | 3300026121 | Ga0207683_10198241 | Ga0207683_101982412 | 170 |
| 330 | 3300026121 | Ga0207683_10345216 | Ga0207683_103452162 | 170 |
| 331 | 3300026121 | Ga0207683_10550537 | Ga0207683_105505372 | 170 |
| 332 | 3300026121 | Ga0207683_10863333 | Ga0207683_108633332 | 170 |
| 333 | 3300026142 | Ga0207698_10004231 | Ga0207698_100042315 | 170 |
| 334 | 3300026142 | Ga0207698_10012782 | Ga0207698_100127823 | 170 |
| 335 | 3300026142 | Ga0207698_10094025 | Ga0207698_100940253 | 170 |
| 336 | 3300026142 | Ga0207698_10120165 | Ga0207698_101201655 | 170 |
| 337 | 3300026142 | Ga0207698_10176002 | Ga0207698_101760021 | 170 |
| 338 | 3300026142 | Ga0207698_11163018 | Ga0207698_111630182 | 170 |
| 339 | 3300027907 | Ga0207428_10002330 | Ga0207428_100023302 | 170 |
| 340 | 3300028379 | Ga0268266_10041941 | Ga0268266_100419414 | 170 |
| 341 | 3300028380 | Ga0268265_10509495 | Ga0268265_105094952 | 170 |
| 342 | 3300028380 | Ga0268265_11080262 | Ga0268265_110802621 | 170 |
| 343 | 3300028381 | Ga0268264_10268065 | Ga0268264_102680652 | 170 |
| 344 | 3300028381 | Ga0268264_10691145 | Ga0268264_106911451 | 170 |
| 345 | 3300031235 | Ga0265330_10157369 | Ga0265330_101573692 | 170 |
| 346 | 3300031344 | Ga0265316_10085942 | Ga0265316_100859422 | 170 |
| 347 | 3300031712 | Ga0265342_10187302 | Ga0265342_101873022 | 170 |
| 348 | 3300031824 | Ga0307413_10068378 | Ga0307413_100683782 | 170 |
| 349 | 3300031852 | Ga0307410_10244846 | Ga0307410_102448462 | 170 |
| 350 | 3300031903 | Ga0307407_10620947 | Ga0307407_106209472 | 170 |
| 351 | 3300031995 | Ga0307409_100731298 | Ga0307409_1007312982 | 170 |
| 352 | 3300031995 | Ga0307409_101004219 | Ga0307409_1010042192 | 170 |
| 353 | 3300032002 | Ga0307416_100192126 | Ga0307416_1001921262 | 170 |
| 354 | 3300032002 | Ga0307416_100320458 | Ga0307416_1003204582 | 170 |
| 355 | 3300032002 | Ga0307416_100638706 | Ga0307416_1006387062 | 170 |
| 356 | 3300032004 | Ga0307414_10710957 | Ga0307414_107109572 | 170 |
| 357 | 3300032005 | Ga0307411_10677894 | Ga0307411_106778941 | 170 |
| 358 | 3300032126 | Ga0307415_100446804 | Ga0307415_1004468042 | 170 |
| 359 | 3300032126 | Ga0307415_101278939 | Ga0307415_1012789391 | 170 |
| 360 | 3300034819 | Ga0373958_0160734 | Ga0373958_0160734_38_550 | 170 |
| 361 | 3300034957 | Ga0373938_0166512 | Ga0373938_0166512_35_547 | 170 |
| 362 | 3300035089 | Ga0373944_0078514 | Ga0373944_0078514_314_829 | 170 |
| 363 | 3300035112 | Ga0373932_0173442 | Ga0373932_0173442_72_584 | 170 |
| 364 | 3300035113 | Ga0373936_0254705 | Ga0373936_0254705_215_727 | 170 |
| 365 | 3300035121 | Ga0373960_0122613 | Ga0373960_0122613_30_542 | 170 |
| 366 | 3300035170 | Ga0373943_0111243 | Ga0373943_0111243_289_801 | 170 |
| 367 | 3300035410 | Ga0373924_0051052 | Ga0373924_0051052_676_1188 | 170 |
| 368 | 3300035691 | Ga0373931_0355224 | Ga0373931_0355224_25_537 | 170 |
| 369 | 3300035692 | Ga0373935_0156858 | Ga0373935_0156858_98_610 | 170 |
| 370 | 3300035695 | Ga0373927_0023854 | Ga0373927_0023854_960_1472 | 170 |
| 371 | 3300035695 | Ga0373927_0391058 | Ga0373927_0391058_337_852 | 170 |
| 372 | 3300035724 | Ga0373933_0041325 | Ga0373933_0041325_1702_2214 | 170 |
| 373 | 3300035725 | Ga0373947_0255515 | Ga0373947_0255515_378_893 | 170 |
| 374 | 3300036401 | Ga0373937_0001850 | Ga0373937_0001850_11571_12083 | 170 |
| 375 | 3300036401 | Ga0373937_0060235 | Ga0373937_0060235_1075_1587 | 170 |
| 376 | 3300037068 | Ga0373925_0034927 | Ga0373925_0034927_1767_2279 | 170 |
| 377 | 3300037068 | Ga0373925_0436102 | Ga0373925_0436102_335_847 | 170 |
| 378 | 3300037418 | Ga0395900_0084328 | Ga0395900_0084328_2238_2750 | 170 |
| 379 | 3300037471 | Ga0395905_0004647 | Ga0395905_0004647_9821_10333 | 170 |
| 380 | 3300038443 | Ga0395901_0212566 | Ga0395901_0212566_1454_1966 | 170 |
| 381 | 3300039437 | Ga0436365_0986860 | Ga0436365_0986860_2006_2518 | 170 |
| 382 | 3300039437 | Ga0436365_1524731 | Ga0436365_1524731_12_524 | 170 |
| 383 | 3300039437 | Ga0436365_1604790 | Ga0436365_1604790_518_1030 | 170 |
| 384 | 3300041486 | Ga0451807_1278057 | Ga0451807_1278057_306_818 | 170 |
| 385 | 3300041496 | Ga0451839_0477412 | Ga0451839_0477412_78_590 | 170 |
| 386 | 3300041512 | Ga0451853_0117916 | Ga0451853_0117916_122_682 | 170 |
| 387 | 3300041512 | Ga0451853_0593964 | Ga0451853_0593964_733_1245 | 170 |
| 388 | 3300042134 | Ga0450898_085587 | Ga0450898_085587_11_523 | 170 |
| 389 | 3300042156 | Ga0439446_0028503 | Ga0439446_0028503_312_824 | 170 |
| 390 | 3300042876 | Ga0451577_0406269 | Ga0451577_0406269_140_655 | 170 |
| 391 | 3300044684 | Ga0466966_0018413 | Ga0466966_0018413_62_574 | 170 |
| 392 | 3300044719 | Ga0466971_0151191 | Ga0466971_0151191_34_546 | 170 |
| 393 | 3300044842 | Ga0466957_0012177 | Ga0466957_0012177_2833_3345 | 170 |
| 394 | 3300045049 | Ga0466959_0171422 | Ga0466959_0171422_562_1074 | 170 |
| 395 | 3300045836 | Ga0466958_0008233 | Ga0466958_0008233_1008_1520 | 170 |
| 396 | 3300045976 | Ga0466967_0986070 | Ga0466967_0986070_144_656 | 170 |
| 397 | 3300046454 | Ga0495592_0013889 | Ga0495592_0013889_1259_1771 | 170 |
| 398 | 3300046463 | Ga0495653_0089398 | Ga0495653_0089398_1068_1580 | 170 |
| 399 | 3300046511 | Ga0495608_0015577 | Ga0495608_0015577_1628_2140 | 170 |
| 400 | 3300046516 | Ga0495628_0144327 | Ga0495628_0144327_361_873 | 170 |
| 401 | 3300046536 | Ga0495587_0033850 | Ga0495587_0033850_1269_1781 | 170 |
| 402 | 3300046537 | Ga0495598_0132725 | Ga0495598_0132725_101_616 | 170 |
| 403 | 3300046539 | Ga0495621_0001542 | Ga0495621_0001542_1769_2281 | 170 |
| 404 | 3300046539 | Ga0495621_0003013 | Ga0495621_0003013_3794_4306 | 170 |
| 405 | 3300046539 | Ga0495621_0042092 | Ga0495621_0042092_606_1121 | 170 |
| 406 | 3300046543 | Ga0495645_0002710 | Ga0495645_0002710_10291_10803 | 170 |
| 407 | 3300046663 | Ga0495635_0042213 | Ga0495635_0042213_1051_1563 | 170 |
| 408 | 3300046678 | Ga0495599_0112911 | Ga0495599_0112911_664_1176 | 170 |
| 409 | 3300046679 | Ga0495623_0063157 | Ga0495623_0063157_740_1252 | 170 |
| 410 | 3300046683 | Ga0495658_0094905 | Ga0495658_0094905_1014_1529 | 170 |
| 411 | 3300046683 | Ga0495658_0136128 | Ga0495658_0136128_832_1347 | 170 |
| 412 | 3300046691 | Ga0495670_0187916 | Ga0495670_0187916_524_1036 | 170 |
| 413 | 3300047317 | Ga0495604_0188667 | Ga0495604_0188667_560_1072 | 170 |
| 414 | 3300047444 | Ga0495675_0170067 | Ga0495675_0170067_374_886 | 170 |
| 415 | 3300048088 | Ga0495602_0072581 | Ga0495602_0072581_510_1022 | 170 |
| 416 | 3300048903 | Ga0496100_1068049 | Ga0496100_1068049_73_588 | 170 |
| 417 | 3300048907 | Ga0496104_0001840 | Ga0496104_0001840_9615_10130 | 170 |
| 418 | 3300048908 | Ga0496105_0122145 | Ga0496105_0122145_1590_2105 | 170 |
| 419 | 3300048912 | Ga0496109_0068047 | Ga0496109_0068047_2391_2906 | 170 |
| 420 | 3300048913 | Ga0496110_0005881 | Ga0496110_0005881_4459_4974 | 170 |
| 421 | 3300049581 | Ga0501047_0006773 | Ga0501047_0006773_1330_1842 | 170 |
| 422 | 3300049581 | Ga0501047_0054575 | Ga0501047_0054575_424_936 | 170 |
| 423 | 3300049581 | Ga0501047_0119654 | Ga0501047_0119654_200_712 | 170 |
| 424 | 3300049585 | Ga0501069_0000499 | Ga0501069_0000499_9523_10035 | 170 |
| 425 | 3300049586 | Ga0501070_0000922 | Ga0501070_0000922_10180_10692 | 170 |
| 426 | 3300049586 | Ga0501070_0872733 | Ga0501070_0872733_47_559 | 170 |
| 427 | 3300049589 | Ga0501073_0000119 | Ga0501073_0000119_12785_13297 | 170 |
| 428 | 3300049589 | Ga0501073_0299291 | Ga0501073_0299291_474_986 | 170 |
| 429 | 3300049590 | Ga0501074_0000634 | Ga0501074_0000634_1668_2180 | 170 |
| 430 | 3300049590 | Ga0501074_0295343 | Ga0501074_0295343_414_926 | 170 |
| 431 | 3300049741 | Ga0501079_0006014 | Ga0501079_0006014_1432_1944 | 170 |
| 432 | 3300049742 | Ga0501080_0010597 | Ga0501080_0010597_1927_2439 | 170 |
| 433 | 3300049742 | Ga0501080_0053239 | Ga0501080_0053239_722_1234 | 170 |
| 434 | 3300049742 | Ga0501080_0080270 | Ga0501080_0080270_70_582 | 170 |
| 435 | 3300049744 | Ga0501083_0020281 | Ga0501083_0020281_3061_3573 | 170 |
| 436 | 3300049822 | Ga0501035_0047595 | Ga0501035_0047595_1121_1633 | 170 |
| 437 | 3300049823 | Ga0501044_0158568 | Ga0501044_0158568_1433_1945 | 170 |
| 438 | 3300050489 | nmdc:mga03683_24737_c1 | nmdc:mga03683_24737_c1_1121_1633 | 170 |
| 439 | 3300050490 | nmdc:mga03n38_187918_c1 | nmdc:mga03n38_187918_c1_333_848 | 170 |
| 440 | 3300050491 | nmdc:mga00v17_164927_c1 | nmdc:mga00v17_164927_c1_729_1241 | 170 |
| 441 | 3300050491 | nmdc:mga00v17_2243_c1 | nmdc:mga00v17_2243_c1_7811_8326 | 170 |
| 442 | 3300050493 | nmdc:mga0k408_13210_c1 | nmdc:mga0k408_13210_c1_2454_2966 | 170 |
| 443 | 3300050493 | nmdc:mga0k408_15090_c1 | nmdc:mga0k408_15090_c1_2181_2696 | 170 |
| 444 | 3300050493 | nmdc:mga0k408_17607_c1 | nmdc:mga0k408_17607_c1_2584_3096 | 170 |
| 445 | 3300050493 | nmdc:mga0k408_438539_c1 | nmdc:mga0k408_438539_c1_53_568 | 170 |
| 446 | 3300050494 | nmdc:mga06z11_143334_c1 | nmdc:mga06z11_143334_c1_674_1186 | 170 |
| 447 | 3300050511 | nmdc:mga08y16_2348_c1 | nmdc:mga08y16_2348_c1_12813_13328 | 170 |
| 448 | 3300050511 | nmdc:mga08y16_995811_c1 | nmdc:mga08y16_995811_c1_95_607 | 170 |
| 449 | 3300050512 | nmdc:mga0n895_175554_c1 | nmdc:mga0n895_175554_c1_387_902 | 170 |
| 450 | 3300050512 | nmdc:mga0n895_256358_c1 | nmdc:mga0n895_256358_c1_758_1270 | 170 |
| 451 | 3300050512 | nmdc:mga0n895_97840_c1 | nmdc:mga0n895_97840_c1_550_1062 | 170 |
| 452 | 3300050513 | nmdc:mga0rr50_453274_c1 | nmdc:mga0rr50_453274_c1_280_792 | 170 |
| 453 | 3300050513 | nmdc:mga0rr50_508897_c1 | nmdc:mga0rr50_508897_c1_328_843 | 170 |
| 454 | 3300050513 | nmdc:mga0rr50_80035_c1 | nmdc:mga0rr50_80035_c1_262_774 | 170 |
| 455 | 3300050514 | nmdc:mga08x19_46760_c1 | nmdc:mga08x19_46760_c1_681_1193 | 170 |
| 456 | 3300050514 | nmdc:mga08x19_591654_c1 | nmdc:mga08x19_591654_c1_154_666 | 170 |
| 457 | 3300050514 | nmdc:mga08x19_93490_c1 | nmdc:mga08x19_93490_c1_317_829 | 170 |
| 458 | 3300050515 | nmdc:mga0a205_25697_c2 | nmdc:mga0a205_25697_c2_2384_2896 | 170 |
| 459 | 3300053077 | Ga0495601_0005289 | Ga0495601_0005289_5137_5649 | 170 |
| 460 | 3300053085 | Ga0495619_0102050 | Ga0495619_0102050_742_1254 | 170 |
| 461 | 3300053096 | Ga0500641_0173406 | Ga0500641_0173406_193_708 | 170 |
| 462 | 3300061719 | Ga0466962_0069427 | Ga0466962_0069427_818_1330 | 170 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4jpb-assembly1.cif.gz_W | the structure of a ternary complex between chea domains p4 and p5 with chew and with an unzipped fragment of tm14, a chemoreceptor analog from thermotoga maritima. | 0.8573 | 29 | 160 |
| 8c5v-assembly1.cif.gz_H | chemotaxis core signalling unit from e protein lysed e. coli cells | 0.8253 | 26 | 165 |
| 2ch4-assembly1.cif.gz_A | complex between bacterial chemotaxis histidine kinase chea domains p4 and p5 and receptor-adaptor protein chew | 0.8081 | 28 | 158 |
| 8c5v-assembly1.cif.gz_H | chemotaxis core signalling unit from e protein lysed e. coli cells | 0.8046 | 26 | 165 |
| 2qdl-assembly2.cif.gz_B | crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis | 0.8031 | 27 | 164 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2qdlB02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.8609 | 48 | 114 | 2.40.50.180 |
| af_P0A964_36_100_2.40.50.180 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.8249 | 47 | 114 | 2.40.50.180 |
| 2ch4W02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.8224 | 47 | 114 | 2.40.50.180 |
| af_P0A964_36_100_2.40.50.180 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.8137 | 47 | 114 | 2.40.50.180 |
| 2ch4W02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.6928 | 47 | 114 | 2.40.50.180 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X1P764-F1-model_v4 | Chemotaxis protein CheW | 0.9335 | 23 | 170 |
GO:0005829
GO:0006935 GO:0007165 |
| AF-A0A4Q3HYU0-F1-model_v4 | deleted | 0.9322 | 26 | 119 |
|
| AF-A0A1I7HJ60-F1-model_v4 | Twitching motility protein PilI | 0.93 | 28 | 170 |
GO:0006935
GO:0007165 |
| AF-A0A1V5FR67-F1-model_v4 | Chemotaxis protein CheW | 0.9299 | 42 | 166 |
GO:0006935
GO:0007165 |
| AF-A0A2W4LXC6-F1-model_v4 | CheW-like domain-containing protein | 0.9274 | 33 | 170 |
GO:0005829
GO:0006935 GO:0007165 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar