F448855

General Info

Members Datasets Scaffolds Average Seq Length
462 245 462 170

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100860158|Ga0070683_1008601581
Length 171
Sequence MGRRTGLREFQLSVAERLRTAATSRTALSSKLGFQVGADNWFVSLHQVSEVIPVPASVPVPLTHSWFRGVANVRGNLYSIIDFSAFQGGDPISPGVERRVILVSDRLVGGSGLLVSRMLGLRNPEQFNAAPRPAGAGPWVGNAFTDAGGTRWLELDLTALVREQRFLEVGA

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
170 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
171 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
189 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
190 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
191 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
192 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
195 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
210 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
233 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
236 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
244 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
245 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.41
Nodule 0
Rhizoplane 1.3
Rhizosphere 91.99
Stem 0
Stem Tuber 0
Unclassified 1.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10080002 3300005290 Bacteria 3156
2 Ga0070658_10044818 3300005327 Bacteria 3575
3 Ga0070658_10276503 3300005327 Bacteria 1429
4 Ga0070658_10291056 3300005327 Bacteria 1392
5 Ga0070676_10569857 3300005328 Bacteria 813
6 Ga0070683_100055071 3300005329 Bacteria 3689
7 Ga0070683_100146743 3300005329 Bacteria 2236
8 Ga0070683_100860158 3300005329 Bacteria 870
9 Ga0070690_100032911 3300005330 Bacteria 3241
10 Ga0070690_100203595 3300005330 Bacteria 1378
11 Ga0070690_100227774 3300005330 Bacteria 1309
12 Ga0070670_100236329 3300005331 Bacteria 1591
13 Ga0068869_100017993 3300005334 Bacteria 4802
14 Ga0070666_10835878 3300005335 Bacteria 679
15 Ga0070680_100438584 3300005336 Bacteria 1115
16 Ga0068868_100015562 3300005338 Bacteria 5630
17 Ga0068868_100674280 3300005338 Bacteria 923
18 Ga0070660_100184314 3300005339 Bacteria 1690
19 Ga0070689_100003209 3300005340 Bacteria 10832
20 Ga0070689_100401954 3300005340 Bacteria 1158
21 Ga0070687_100029755 3300005343 Bacteria 2663
22 Ga0070687_100042780 3300005343 Bacteria 2297
23 Ga0070687_100092202 3300005343 Bacteria 1678
24 Ga0070687_100277940 3300005343 Bacteria 1053
25 Ga0070661_100690518 3300005344 Bacteria 831
26 Ga0070692_10287626 3300005345 Bacteria 999
27 Ga0070692_10326855 3300005345 Bacteria 945
28 Ga0070669_100508788 3300005353 Bacteria 1000
29 Ga0070675_100105382 3300005354 Bacteria 2379
30 Ga0070675_101649886 3300005354 Unclassified 591
31 Ga0070671_100224950 3300005355 Bacteria 1592
32 Ga0070674_100064737 3300005356 Bacteria 2563
33 Ga0070674_100326713 3300005356 Bacteria 1231
34 Ga0070674_100415355 3300005356 Bacteria 1103
35 Ga0070673_100024659 3300005364 Bacteria 4414
36 Ga0070673_100061662 3300005364 Bacteria 2976
37 Ga0070659_100213708 3300005366 Bacteria 1590
38 Ga0070709_10054032 3300005434 Bacteria 2531
39 Ga0070714_100089470 3300005435 Bacteria 2695
40 Ga0070713_100001908 3300005436 Bacteria 13439
41 Ga0070713_101007362 3300005436 Bacteria 804
42 Ga0070713_101545344 3300005436 Bacteria 644
43 Ga0070710_10223136 3300005437 Bacteria 1200
44 Ga0070701_10090468 3300005438 Bacteria 1676
45 Ga0070701_10473918 3300005438 Bacteria 808
46 Ga0070711_100910245 3300005439 Bacteria 751
47 Ga0070705_100131025 3300005440 Bacteria 1636
48 Ga0070694_100229188 3300005444 Bacteria 1397
49 Ga0070678_100084387 3300005456 Bacteria 2417
50 Ga0070678_100453353 3300005456 Bacteria 1124
51 Ga0070678_100997397 3300005456 Bacteria 770
52 Ga0070678_101014561 3300005456 Bacteria 763
53 Ga0070678_101131643 3300005456 Unclassified 724
54 Ga0070681_10004695 3300005458 Bacteria 13072
55 Ga0070681_10182842 3300005458 Bacteria 2017
56 Ga0068867_100046141 3300005459 Bacteria 3199
57 Ga0068867_100342166 3300005459 Bacteria 1246
58 Ga0068867_101049986 3300005459 Bacteria 741
59 Ga0070685_10014304 3300005466 Bacteria 4201
60 Ga0070685_10107237 3300005466 Bacteria 1715
61 Ga0070685_10136474 3300005466 Bacteria 1540
62 Ga0070685_10178830 3300005466 Bacteria 1364
63 Ga0070698_100365617 3300005471 Bacteria 1375
64 Ga0070699_100232943 3300005518 Bacteria 1642
65 Ga0070679_100143561 3300005530 Bacteria 2366
66 Ga0070679_100167031 3300005530 Bacteria 2174
67 Ga0068853_100036967 3300005539 Bacteria 4153
68 Ga0068853_100085845 3300005539 Bacteria 2760
69 Ga0068853_100498800 3300005539 Bacteria 1149
70 Ga0070672_100039923 3300005543 Bacteria 3598
71 Ga0070672_101074896 3300005543 Bacteria 714
72 Ga0070686_100236067 3300005544 Bacteria 1329
73 Ga0070686_100867987 3300005544 Bacteria 732
74 Ga0070695_100932160 3300005545 Bacteria 703
75 Ga0070696_100008517 3300005546 Bacteria 6867
76 Ga0070693_100026306 3300005547 Bacteria 3140
77 Ga0070693_100271894 3300005547 Bacteria 1131
78 Ga0070704_100142914 3300005549 Bacteria 1871
79 Ga0070704_101286330 3300005549 Bacteria 669
80 Ga0068855_100021633 3300005563 Bacteria 7714
81 Ga0068855_100023905 3300005563 Bacteria 7317
82 Ga0068855_100108838 3300005563 Bacteria 3183
83 Ga0068855_100416724 3300005563 Bacteria 1470
84 Ga0068855_100609419 3300005563 Bacteria 1176
85 Ga0070664_101105276 3300005564 Bacteria 747
86 Ga0068857_100021385 3300005577 Bacteria 5695
87 Ga0068857_101090238 3300005577 Bacteria 771
88 Ga0068854_100132195 3300005578 Bacteria 1907
89 Ga0068854_100186829 3300005578 Bacteria 1622
90 Ga0068854_100326657 3300005578 Bacteria 1249
91 Ga0068854_100593603 3300005578 Bacteria 945
92 Ga0068856_100033170 3300005614 Bacteria 5056
93 Ga0068856_100470886 3300005614 Unclassified 1277
94 Ga0070702_100666228 3300005615 Bacteria 789
95 Ga0068852_100000366 3300005616 Bacteria 30499
96 Ga0068852_100009416 3300005616 Bacteria 7255
97 Ga0068852_100017259 3300005616 Bacteria 5659
98 Ga0068852_100068664 3300005616 Bacteria 3103
99 Ga0068859_100076300 3300005617 Bacteria 3392
100 Ga0068859_100097344 3300005617 Bacteria 2995
101 Ga0068859_101288936 3300005617 Bacteria 805
102 Ga0068864_100114603 3300005618 Bacteria 2404
103 Ga0068864_101509600 3300005618 Unclassified 675
104 Ga0068861_100108694 3300005719 Bacteria 2219
105 Ga0068861_100318317 3300005719 Bacteria 1354
106 Ga0068851_10000446 3300005834 Bacteria 18427
107 Ga0068870_10335113 3300005840 Bacteria 966
108 Ga0068870_10582540 3300005840 Bacteria 758
109 Ga0068863_100043189 3300005841 Bacteria 4280
110 Ga0068863_100847534 3300005841 Bacteria 913
111 Ga0068858_100005000 3300005842 Bacteria 12990
112 Ga0068858_100115283 3300005842 Bacteria 2510
113 Ga0068860_100238668 3300005843 Bacteria 1768
114 Ga0068860_100828536 3300005843 Bacteria 939
115 Ga0068860_101690768 3300005843 Bacteria 655
116 Ga0068862_100101773 3300005844 Bacteria 2514
117 Ga0070717_10201669 3300006028 Bacteria 1743
118 Ga0075364_10023591 3300006051 Bacteria 3896
119 Ga0075364_10109474 3300006051 Bacteria 1843
120 Ga0075364_10169895 3300006051 Bacteria 1474
121 Ga0075432_10086405 3300006058 Bacteria 1143
122 Ga0070716_100689435 3300006173 Bacteria 779
123 Ga0070716_100945856 3300006173 Bacteria 678
124 Ga0075362_10030186 3300006177 Bacteria 2340
125 Ga0075362_10136490 3300006177 Bacteria 1170
126 Ga0075369_10000795 3300006186 Bacteria 10326
127 Ga0075366_10002459 3300006195 Bacteria 9484
128 Ga0075366_10007847 3300006195 Bacteria 5905
129 Ga0075366_10008100 3300006195 Bacteria 5827
130 Ga0075366_10035799 3300006195 Bacteria 2927
131 Ga0075366_10037017 3300006195 Bacteria 2879
132 Ga0075366_10401774 3300006195 Bacteria 843
133 Ga0097621_100017590 3300006237 Bacteria 5432
134 Ga0097621_100020123 3300006237 Bacteria 5139
135 Ga0097621_100146595 3300006237 Bacteria 2021
136 Ga0097621_100206404 3300006237 Bacteria 1707
137 Ga0068871_100045534 3300006358 Bacteria 3531
138 Ga0068871_100051801 3300006358 Bacteria 3324
139 Ga0068871_100849454 3300006358 Unclassified 844
140 Ga0068871_101381020 3300006358 Bacteria 664
141 Ga0075428_100369171 3300006844 Bacteria 1539
142 Ga0075430_100305874 3300006846 Bacteria 1315
143 Ga0075434_100050939 3300006871 Bacteria 4113
144 Ga0075434_100091551 3300006871 Bacteria 3043
145 Ga0075434_100139184 3300006871 Bacteria 2447
146 Ga0075429_100126485 3300006880 Bacteria 2235
147 Ga0068865_100487167 3300006881 Bacteria 1026
148 Ga0068865_100521961 3300006881 Bacteria 993
149 Ga0075436_100003266 3300006914 Bacteria 11107
150 Ga0075436_100059214 3300006914 Bacteria 2646
151 Ga0075436_100320327 3300006914 Bacteria 1114
152 Ga0097620_100076307 3300006931 Bacteria 3392
153 Ga0097620_100097345 3300006931 Bacteria 2995
154 Ga0097620_101289166 3300006931 Bacteria 805
155 Ga0075435_100149405 3300007076 Bacteria 1963
156 Ga0075435_100280295 3300007076 Bacteria 1423
157 Ga0075435_100308449 3300007076 Bacteria 1354
158 Ga0105240_10028255 3300009093 Bacteria 7327
159 Ga0105240_10127476 3300009093 Bacteria 3056
160 Ga0105240_10131593 3300009093 Bacteria 3000
161 Ga0105240_10165926 3300009093 Bacteria 2619
162 Ga0111539_10002062 3300009094 Bacteria 26871
163 Ga0111539_11095578 3300009094 Bacteria 925
164 Ga0105245_10330592 3300009098 Bacteria 1504
165 Ga0105245_10509690 3300009098 Bacteria 1220
166 Ga0105245_10634709 3300009098 Bacteria 1097
167 Ga0105245_10675690 3300009098 Bacteria 1064
168 Ga0105243_11024551 3300009148 Bacteria 829
169 Ga0105241_10015972 3300009174 Bacteria 5502
170 Ga0105241_10488787 3300009174 Bacteria 1095
171 Ga0105241_11909053 3300009174 Bacteria 582
172 Ga0105242_10003249 3300009176 Bacteria 12682
173 Ga0105242_10039194 3300009176 Bacteria 3812
174 Ga0105242_10085855 3300009176 Bacteria 2640
175 Ga0105242_10349499 3300009176 Bacteria 1365
176 Ga0105242_10479404 3300009176 Bacteria 1179
177 Ga0105242_10676547 3300009176 Bacteria 1007
178 Ga0105248_10045481 3300009177 Bacteria 4922
179 Ga0105248_10047767 3300009177 Bacteria 4800
180 Ga0105248_10081168 3300009177 Bacteria 3645
181 Ga0105248_11006648 3300009177 Bacteria 941
182 Ga0105238_10014448 3300009551 Bacteria 7984
183 Ga0105238_10555001 3300009551 Bacteria 1153
184 Ga0105238_11467381 3300009551 Bacteria 710
185 Ga0105249_10191356 3300009553 Bacteria 1997
186 Ga0105249_10839242 3300009553 Bacteria 984
187 Ga0157371_10147734 3300013102 Bacteria 1676
188 Ga0157371_10376088 3300013102 Bacteria 1037
189 Ga0157370_10011580 3300013104 Bacteria 9205
190 Ga0157370_10891957 3300013104 Bacteria 807
191 Ga0157369_10060943 3300013105 Bacteria 4068
192 Ga0157369_10135858 3300013105 Bacteria 2604
193 Ga0157374_10041952 3300013296 Bacteria 4219
194 Ga0157374_10154778 3300013296 Bacteria 2230
195 Ga0157378_10014205 3300013297 Bacteria 6969
196 Ga0157378_10199294 3300013297 Bacteria 1893
197 Ga0157378_10792742 3300013297 Bacteria 973
198 Ga0163162_10068743 3300013306 Bacteria 3594
199 Ga0163162_10403036 3300013306 Bacteria 1500
200 Ga0163162_11630773 3300013306 Bacteria 736
201 Ga0157372_10000909 3300013307 Bacteria 32178
202 Ga0157372_10050929 3300013307 Bacteria 4606
203 Ga0157372_10555043 3300013307 Bacteria 1339
204 Ga0157375_10011811 3300013308 Bacteria 7722
205 Ga0157375_10920972 3300013308 Bacteria 1017
206 Ga0157375_10972770 3300013308 Bacteria 990
207 Ga0163163_11019424 3300014325 Bacteria 891
208 Ga0157380_10028919 3300014326 Bacteria 4232
209 Ga0157380_10358192 3300014326 Bacteria 1368
210 Ga0157380_10598992 3300014326 Bacteria 1090
211 Ga0157380_10910037 3300014326 Bacteria 906
212 Ga0157377_10298907 3300014745 Bacteria 1062
213 Ga0157379_10033222 3300014968 Bacteria 4601
214 Ga0157379_10106641 3300014968 Bacteria 2515
215 Ga0157376_10037328 3300014969 Bacteria 3943
216 Ga0157376_11290530 3300014969 Bacteria 760
217 Ga0163161_10547228 3300017792 Bacteria 948
218 Ga0207656_10005870 3300025321 Bacteria 4376
219 Ga0207682_10072180 3300025893 Bacteria 1464
220 Ga0207682_10104966 3300025893 Bacteria 1239
221 Ga0207692_10110247 3300025898 Bacteria 1525
222 Ga0207688_10022551 3300025901 Bacteria 3446
223 Ga0207685_10052236 3300025905 Bacteria 1583
224 Ga0207645_10367190 3300025907 Bacteria 964
225 Ga0207643_10223404 3300025908 Bacteria 1153
226 Ga0207643_10452259 3300025908 Bacteria 817
227 Ga0207705_10020878 3300025909 Bacteria 4674
228 Ga0207705_10164506 3300025909 Bacteria 1668
229 Ga0207705_10210687 3300025909 Bacteria 1474
230 Ga0207654_10019029 3300025911 Bacteria 3614
231 Ga0207654_10093195 3300025911 Bacteria 1841
232 Ga0207695_10038032 3300025913 Bacteria 5187
233 Ga0207695_10081577 3300025913 Bacteria 3273
234 Ga0207695_10212860 3300025913 Bacteria 1842
235 Ga0207663_10261629 3300025916 Bacteria 1278
236 Ga0207660_10256127 3300025917 Bacteria 1382
237 Ga0207660_10670972 3300025917 Bacteria 845
238 Ga0207662_10030115 3300025918 Bacteria 3148
239 Ga0207662_10056285 3300025918 Bacteria 2348
240 Ga0207662_10062899 3300025918 Bacteria 2231
241 Ga0207662_10075703 3300025918 Bacteria 2045
242 Ga0207662_10205489 3300025918 Bacteria 1276
243 Ga0207662_10222130 3300025918 Bacteria 1231
244 Ga0207662_10688746 3300025918 Bacteria 716
245 Ga0207657_10226620 3300025919 Bacteria 1496
246 Ga0207649_10628861 3300025920 Bacteria 828
247 Ga0207649_10935943 3300025920 Bacteria 680
248 Ga0207652_10113446 3300025921 Bacteria 2406
249 Ga0207652_10138715 3300025921 Bacteria 2173
250 Ga0207646_10731683 3300025922 Bacteria 883
251 Ga0207681_10134117 3300025923 Bacteria 1835
252 Ga0207694_10004983 3300025924 Bacteria 10276
253 Ga0207694_10040105 3300025924 Bacteria 3604
254 Ga0207694_10743948 3300025924 Bacteria 827
255 Ga0207694_10771752 3300025924 Bacteria 812
256 Ga0207694_11313679 3300025924 Unclassified 612
257 Ga0207650_10207056 3300025925 Bacteria 1574
258 Ga0207650_11000726 3300025925 Bacteria 711
259 Ga0207659_10034365 3300025926 Bacteria 3495
260 Ga0207687_10065936 3300025927 Bacteria 2572
261 Ga0207687_10730526 3300025927 Bacteria 842
262 Ga0207687_10819497 3300025927 Bacteria 794
263 Ga0207700_10658939 3300025928 Bacteria 933
264 Ga0207664_10123357 3300025929 Bacteria 2171
265 Ga0207664_10682803 3300025929 Bacteria 923
266 Ga0207644_10204699 3300025931 Bacteria 1558
267 Ga0207690_10195511 3300025932 Bacteria 1532
268 Ga0207686_10002739 3300025934 Bacteria 9551
269 Ga0207686_10012336 3300025934 Bacteria 4698
270 Ga0207686_10020528 3300025934 Bacteria 3775
271 Ga0207686_10203501 3300025934 Bacteria 1419
272 Ga0207686_10524440 3300025934 Bacteria 922
273 Ga0207709_10246130 3300025935 Bacteria 1303
274 Ga0207670_10161583 3300025936 Bacteria 1672
275 Ga0207670_10190367 3300025936 Bacteria 1552
276 Ga0207669_10074937 3300025937 Bacteria 2142
277 Ga0207669_10171802 3300025937 Bacteria 1544
278 Ga0207704_10328500 3300025938 Bacteria 1182
279 Ga0207704_10803787 3300025938 Bacteria 785
280 Ga0207665_10395478 3300025939 Bacteria 1051
281 Ga0207691_10059323 3300025940 Bacteria 3480
282 Ga0207691_10705382 3300025940 Bacteria 851
283 Ga0207711_10020985 3300025941 Bacteria 5454
284 Ga0207711_10026751 3300025941 Bacteria 4842
285 Ga0207689_10025409 3300025942 Bacteria 4964
286 Ga0207689_10535906 3300025942 Bacteria 983
287 Ga0207661_10083258 3300025944 Bacteria 2647
288 Ga0207661_10798402 3300025944 Bacteria 869
289 Ga0207679_11098948 3300025945 Unclassified 729
290 Ga0207667_10019072 3300025949 Bacteria 7667
291 Ga0207667_10029787 3300025949 Bacteria 5913
292 Ga0207667_10090885 3300025949 Bacteria 3155
293 Ga0207667_10091933 3300025949 Bacteria 3134
294 Ga0207667_10104227 3300025949 Bacteria 2925
295 Ga0207667_10265385 3300025949 Bacteria 1756
296 Ga0207667_11159839 3300025949 Bacteria 754
297 Ga0207651_10226175 3300025960 Bacteria 1516
298 Ga0207651_11030802 3300025960 Bacteria 736
299 Ga0207712_10926995 3300025961 Bacteria 771
300 Ga0207640_10162558 3300025981 Bacteria 1654
301 Ga0207640_10237130 3300025981 Bacteria 1407
302 Ga0207640_10530666 3300025981 Bacteria 985
303 Ga0207677_10009354 3300026023 Bacteria 5514
304 Ga0207677_11306142 3300026023 Bacteria 666
305 Ga0207703_10055278 3300026035 Bacteria 3229
306 Ga0207639_10077288 3300026041 Bacteria 2623
307 Ga0207639_10132529 3300026041 Bacteria 2065
308 Ga0207708_10362772 3300026075 Bacteria 1191
309 Ga0207702_10014800 3300026078 Bacteria 6471
310 Ga0207702_10146697 3300026078 Bacteria 2142
311 Ga0207641_10067647 3300026088 Bacteria 3061
312 Ga0207648_10029370 3300026089 Bacteria 4876
313 Ga0207648_10762428 3300026089 Bacteria 899
314 Ga0207648_11045533 3300026089 Bacteria 765
315 Ga0207676_10842158 3300026095 Bacteria 897
316 Ga0207674_10010500 3300026116 Bacteria 10481
317 Ga0207675_100388638 3300026118 Bacteria 1373
318 Ga0207675_101196125 3300026118 Bacteria 780
319 Ga0207683_10198241 3300026121 Bacteria 1824
320 Ga0207683_10345216 3300026121 Bacteria 1366
321 Ga0207683_10550537 3300026121 Bacteria 1067
322 Ga0207683_10863333 3300026121 Bacteria 840
323 Ga0207698_10004231 3300026142 Bacteria 8731
324 Ga0207698_10012782 3300026142 Bacteria 5512
325 Ga0207698_10094025 3300026142 Bacteria 2463
326 Ga0207698_10120165 3300026142 Bacteria 2222
327 Ga0207698_10176002 3300026142 Bacteria 1889
328 Ga0207698_11163018 3300026142 Bacteria 785
329 Ga0207428_10002330 3300027907 Bacteria 19019
330 Ga0268266_10041941 3300028379 Bacteria 3907
331 Ga0268265_10509495 3300028380 Bacteria 1135
332 Ga0268265_11080262 3300028380 Bacteria 796
333 Ga0268264_10268065 3300028381 Bacteria 1594
334 Ga0268264_10691145 3300028381 Bacteria 1013
335 Ga0265330_10157369 3300031235 Bacteria 965
336 Ga0265316_10085942 3300031344 Bacteria 2406
337 Ga0265342_10187302 3300031712 Bacteria 1131
338 Ga0307413_10068378 3300031824 Bacteria 2225
339 Ga0307410_10244846 3300031852 Bacteria 1391
340 Ga0307407_10620947 3300031903 Bacteria 807
341 Ga0307412_10113384 3300031911 Bacteria 1939
342 Ga0307412_10313376 3300031911 Bacteria 1245
343 Ga0307409_100731298 3300031995 Bacteria 992
344 Ga0307409_101004219 3300031995 Bacteria 853
345 Ga0307416_100192126 3300032002 Bacteria 1927
346 Ga0307416_100258468 3300032002 Bacteria 1700
347 Ga0307416_100320458 3300032002 Bacteria 1552
348 Ga0307416_100637088 3300032002 Bacteria 1149
349 Ga0307416_100638706 3300032002 Bacteria 1148
350 Ga0307414_10710957 3300032004 Bacteria 910
351 Ga0307411_10677894 3300032005 Bacteria 895
352 Ga0307415_100446804 3300032126 Bacteria 1117
353 Ga0307415_100527249 3300032126 Bacteria 1038
354 Ga0307415_101102313 3300032126 Bacteria 743
355 Ga0307415_101278939 3300032126 Bacteria 694
356 Ga0373958_0160734 3300034819 Unclassified 568
357 Ga0373938_0166512 3300034957 Bacteria 595
358 Ga0373944_0078514 3300035089 Bacteria 1087
359 Ga0373932_0173442 3300035112 Unclassified 753
360 Ga0373936_0254705 3300035113 Bacteria 785
361 Ga0373960_0122613 3300035121 Bacteria 864
362 Ga0373943_0111243 3300035170 Bacteria 1445
363 Ga0373924_0051052 3300035410 Bacteria 1714
364 Ga0373931_0355224 3300035691 Bacteria 918
365 Ga0373935_0156858 3300035692 Bacteria 1549
366 Ga0373927_0023854 3300035695 Bacteria 4002
367 Ga0373927_0391058 3300035695 Bacteria 917
368 Ga0373933_0041325 3300035724 Bacteria 2722
369 Ga0373947_0255515 3300035725 Bacteria 1160
370 Ga0373937_0001850 3300036401 Bacteria 17770
371 Ga0373937_0060235 3300036401 Bacteria 3489
372 Ga0373925_0034927 3300037068 Bacteria 3707
373 Ga0373925_0436102 3300037068 Bacteria 1072
374 Ga0395900_0084328 3300037418 Bacteria 3265
375 Ga0395905_0004647 3300037471 Bacteria 14196
376 Ga0395901_0212566 3300038443 Bacteria 2024
377 Ga0436365_0986860 3300039437 Bacteria 2560
378 Ga0436365_1524731 3300039437 Bacteria 643
379 Ga0436365_1604790 3300039437 Bacteria 5268
380 Ga0451807_1278057 3300041486 Bacteria 970
381 Ga0451839_0477412 3300041496 Bacteria 608
382 Ga0451853_0117916 3300041512 Bacteria 816
383 Ga0451853_0593964 3300041512 Bacteria 1388
384 Ga0450898_085587 3300042134 Bacteria 645
385 Ga0439446_0028503 3300042156 Bacteria 1608
386 Ga0451577_0406269 3300042876 Bacteria 1236
387 Ga0466966_0018413 3300044684 Bacteria 4607
388 Ga0466971_0151191 3300044719 Bacteria 1084
389 Ga0466957_0012177 3300044842 Bacteria 4977
390 Ga0466959_0171422 3300045049 Bacteria 1522
391 Ga0466958_0008233 3300045836 Bacteria 5774
392 Ga0466967_0986070 3300045976 Bacteria 839
393 Ga0495592_0013889 3300046454 Bacteria 6120
394 Ga0495653_0089398 3300046463 Bacteria 2257
395 Ga0495608_0015577 3300046511 Bacteria 5268
396 Ga0495628_0144327 3300046516 Bacteria 1815
397 Ga0495587_0033850 3300046536 Bacteria 3083
398 Ga0495598_0132725 3300046537 Bacteria 855
399 Ga0495621_0001542 3300046539 Bacteria 5997
400 Ga0495621_0003013 3300046539 Bacteria 4596
401 Ga0495621_0042092 3300046539 Bacteria 1607
402 Ga0495645_0002710 3300046543 Bacteria 12020
403 Ga0495635_0042213 3300046663 Bacteria 3150
404 Ga0495599_0112911 3300046678 Bacteria 1691
405 Ga0495623_0063157 3300046679 Bacteria 2319
406 Ga0495658_0094905 3300046683 Bacteria 1772
407 Ga0495658_0136128 3300046683 Bacteria 1499
408 Ga0495670_0187916 3300046691 Unclassified 1092
409 Ga0495604_0188667 3300047317 Bacteria 1438
410 Ga0495675_0170067 3300047444 Bacteria 1339
411 Ga0495602_0072581 3300048088 Bacteria 2934
412 Ga0496100_1068049 3300048903 Unclassified 636
413 Ga0496104_0001840 3300048907 Bacteria 18346
414 Ga0496105_0122145 3300048908 Bacteria 2147
415 Ga0496109_0068047 3300048912 Bacteria 3264
416 Ga0496110_0005881 3300048913 Bacteria 9654
417 Ga0501291_036414 3300049514 Bacteria 850
418 Ga0501047_0006773 3300049581 Bacteria 10766
419 Ga0501047_0054575 3300049581 Bacteria 3865
420 Ga0501047_0119654 3300049581 Bacteria 2516
421 Ga0501069_0000499 3300049585 Bacteria 17869
422 Ga0501070_0000922 3300049586 Bacteria 26611
423 Ga0501070_0872733 3300049586 Bacteria 703
424 Ga0501073_0000119 3300049589 Bacteria 50663
425 Ga0501073_0299291 3300049589 Bacteria 1110
426 Ga0501074_0000634 3300049590 Bacteria 21786
427 Ga0501074_0295343 3300049590 Bacteria 1151
428 Ga0501079_0006014 3300049741 Bacteria 9092
429 Ga0501080_0010597 3300049742 Bacteria 8437
430 Ga0501080_0053239 3300049742 Bacteria 3767
431 Ga0501080_0080270 3300049742 Bacteria 3032
432 Ga0501083_0020281 3300049744 Bacteria 4625
433 Ga0501035_0047595 3300049822 Bacteria 3849
434 Ga0501044_0158568 3300049823 Bacteria 2241
435 nmdc:mga03683_24737_c1 3300050489 Bacteria 2352
436 nmdc:mga03n38_187918_c1 3300050490 Bacteria 1062
437 nmdc:mga00v17_164927_c1 3300050491 Bacteria 1427
438 nmdc:mga00v17_2243_c1 3300050491 Bacteria 9905
439 nmdc:mga00v17_322747_c1 3300050491 Unclassified 1003
440 nmdc:mga0k408_13210_c1 3300050493 Bacteria 4525
441 nmdc:mga0k408_15090_c1 3300050493 Bacteria 4270
442 nmdc:mga0k408_17607_c1 3300050493 Bacteria 3982
443 nmdc:mga0k408_26290_c1 3300050493 Bacteria 3299
444 nmdc:mga0k408_438539_c1 3300050493 Bacteria 776
445 nmdc:mga0k408_6775_c1 3300050493 Bacteria 6111
446 nmdc:mga06z11_143334_c1 3300050494 Bacteria 1352
447 nmdc:mga08y16_2348_c1 3300050511 Bacteria 19397
448 nmdc:mga08y16_995811_c1 3300050511 Bacteria 818
449 nmdc:mga0n895_175554_c1 3300050512 Bacteria 2173
450 nmdc:mga0n895_256358_c1 3300050512 Bacteria 1775
451 nmdc:mga0n895_97840_c1 3300050512 Bacteria 2940
452 nmdc:mga0rr50_453274_c1 3300050513 Bacteria 1087
453 nmdc:mga0rr50_508897_c1 3300050513 Bacteria 1024
454 nmdc:mga0rr50_80035_c1 3300050513 Bacteria 2518
455 nmdc:mga08x19_46760_c1 3300050514 Bacteria 2769
456 nmdc:mga08x19_591654_c1 3300050514 Bacteria 786
457 nmdc:mga08x19_93490_c1 3300050514 Bacteria 1987
458 nmdc:mga0a205_25697_c2 3300050515 Bacteria 3168
459 Ga0495601_0005289 3300053077 Bacteria 7511
460 Ga0495619_0102050 3300053085 Bacteria 1953
461 Ga0500641_0173406 3300053096 Bacteria 928
462 Ga0466962_0069427 3300061719 Bacteria 1683

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031911 Ga0307412_10113384 Ga0307412_101133842 152
2 3300032002 Ga0307416_100637088 Ga0307416_1006370883 152
3 3300032126 Ga0307415_101102313 Ga0307415_1011023132 152
4 3300014326 Ga0157380_10598992 Ga0157380_105989922 156
5 3300050491 nmdc:mga00v17_322747_c1 nmdc:mga00v17_322747_c1_433_915 159
6 3300050493 nmdc:mga0k408_26290_c1 nmdc:mga0k408_26290_c1_1318_1800 159
7 3300050493 nmdc:mga0k408_6775_c1 nmdc:mga0k408_6775_c1_3704_4186 159
8 3300031911 Ga0307412_10313376 Ga0307412_103133761 160
9 3300032002 Ga0307416_100258468 Ga0307416_1002584683 160
10 3300032126 Ga0307415_100527249 Ga0307415_1005272492 160
11 3300049514 Ga0501291_036414 Ga0501291_036414_220_732 160
12 3300005459 Ga0068867_100342166 Ga0068867_1003421662 161
13 3300025937 Ga0207669_10171802 Ga0207669_101718022 161
14 3300005440 Ga0070705_100131025 Ga0070705_1001310253 162
15 3300005436 Ga0070713_101545344 Ga0070713_1015453441 163
16 3300005343 Ga0070687_100029755 Ga0070687_1000297552 165
17 3300005459 Ga0068867_101049986 Ga0068867_1010499862 165
18 3300005466 Ga0070685_10107237 Ga0070685_101072371 165
19 3300005719 Ga0068861_100108694 Ga0068861_1001086945 165
20 3300005842 Ga0068858_100005000 Ga0068858_10000500013 165
21 3300009176 Ga0105242_10003249 Ga0105242_100032497 165
22 3300013306 Ga0163162_10068743 Ga0163162_100687432 165
23 3300014968 Ga0157379_10033222 Ga0157379_100332227 165
24 3300025918 Ga0207662_10030115 Ga0207662_100301153 165
25 3300025924 Ga0207694_10040105 Ga0207694_100401054 165
26 3300025934 Ga0207686_10002739 Ga0207686_100027393 165
27 3300026035 Ga0207703_10055278 Ga0207703_100552786 165
28 3300026089 Ga0207648_11045533 Ga0207648_110455332 165
29 3300005290 Ga0065712_10080002 Ga0065712_100800022 170
30 3300005327 Ga0070658_10044818 Ga0070658_100448184 170
31 3300005327 Ga0070658_10276503 Ga0070658_102765032 170
32 3300005327 Ga0070658_10291056 Ga0070658_102910563 170
33 3300005328 Ga0070676_10569857 Ga0070676_105698572 170
34 3300005329 Ga0070683_100055071 Ga0070683_1000550715 170
35 3300005329 Ga0070683_100146743 Ga0070683_1001467431 170
36 3300005329 Ga0070683_100860158 Ga0070683_1008601581 170
37 3300005330 Ga0070690_100032911 Ga0070690_1000329112 170
38 3300005330 Ga0070690_100203595 Ga0070690_1002035953 170
39 3300005330 Ga0070690_100227774 Ga0070690_1002277742 170
40 3300005331 Ga0070670_100236329 Ga0070670_1002363292 170
41 3300005334 Ga0068869_100017993 Ga0068869_1000179932 170
42 3300005335 Ga0070666_10835878 Ga0070666_108358781 170
43 3300005336 Ga0070680_100438584 Ga0070680_1004385841 170
44 3300005338 Ga0068868_100015562 Ga0068868_1000155627 170
45 3300005338 Ga0068868_100674280 Ga0068868_1006742802 170
46 3300005339 Ga0070660_100184314 Ga0070660_1001843142 170
47 3300005340 Ga0070689_100003209 Ga0070689_1000032094 170
48 3300005340 Ga0070689_100401954 Ga0070689_1004019542 170
49 3300005343 Ga0070687_100042780 Ga0070687_1000427802 170
50 3300005343 Ga0070687_100092202 Ga0070687_1000922022 170
51 3300005343 Ga0070687_100277940 Ga0070687_1002779402 170
52 3300005344 Ga0070661_100690518 Ga0070661_1006905182 170
53 3300005345 Ga0070692_10287626 Ga0070692_102876262 170
54 3300005345 Ga0070692_10326855 Ga0070692_103268552 170
55 3300005353 Ga0070669_100508788 Ga0070669_1005087882 170
56 3300005354 Ga0070675_100105382 Ga0070675_1001053824 170
57 3300005354 Ga0070675_101649886 Ga0070675_1016498861 170
58 3300005355 Ga0070671_100224950 Ga0070671_1002249502 170
59 3300005356 Ga0070674_100064737 Ga0070674_1000647372 170
60 3300005356 Ga0070674_100326713 Ga0070674_1003267131 170
61 3300005356 Ga0070674_100415355 Ga0070674_1004153552 170
62 3300005364 Ga0070673_100024659 Ga0070673_1000246597 170
63 3300005364 Ga0070673_100061662 Ga0070673_1000616623 170
64 3300005366 Ga0070659_100213708 Ga0070659_1002137082 170
65 3300005434 Ga0070709_10054032 Ga0070709_100540322 170
66 3300005435 Ga0070714_100089470 Ga0070714_1000894702 170
67 3300005436 Ga0070713_100001908 Ga0070713_1000019083 170
68 3300005436 Ga0070713_101007362 Ga0070713_1010073622 170
69 3300005437 Ga0070710_10223136 Ga0070710_102231363 170
70 3300005438 Ga0070701_10090468 Ga0070701_100904682 170
71 3300005438 Ga0070701_10473918 Ga0070701_104739182 170
72 3300005439 Ga0070711_100910245 Ga0070711_1009102451 170
73 3300005444 Ga0070694_100229188 Ga0070694_1002291882 170
74 3300005456 Ga0070678_100084387 Ga0070678_1000843871 170
75 3300005456 Ga0070678_100453353 Ga0070678_1004533533 170
76 3300005456 Ga0070678_100997397 Ga0070678_1009973971 170
77 3300005456 Ga0070678_101014561 Ga0070678_1010145612 170
78 3300005456 Ga0070678_101131643 Ga0070678_1011316431 170
79 3300005458 Ga0070681_10004695 Ga0070681_100046953 170
80 3300005458 Ga0070681_10182842 Ga0070681_101828422 170
81 3300005459 Ga0068867_100046141 Ga0068867_1000461412 170
82 3300005466 Ga0070685_10014304 Ga0070685_100143045 170
83 3300005466 Ga0070685_10136474 Ga0070685_101364742 170
84 3300005466 Ga0070685_10178830 Ga0070685_101788302 170
85 3300005471 Ga0070698_100365617 Ga0070698_1003656171 170
86 3300005518 Ga0070699_100232943 Ga0070699_1002329432 170
87 3300005530 Ga0070679_100143561 Ga0070679_1001435612 170
88 3300005530 Ga0070679_100167031 Ga0070679_1001670313 170
89 3300005539 Ga0068853_100036967 Ga0068853_1000369675 170
90 3300005539 Ga0068853_100085845 Ga0068853_1000858452 170
91 3300005539 Ga0068853_100498800 Ga0068853_1004988001 170
92 3300005543 Ga0070672_100039923 Ga0070672_1000399236 170
93 3300005543 Ga0070672_101074896 Ga0070672_1010748961 170
94 3300005544 Ga0070686_100236067 Ga0070686_1002360672 170
95 3300005544 Ga0070686_100867987 Ga0070686_1008679871 170
96 3300005545 Ga0070695_100932160 Ga0070695_1009321601 170
97 3300005546 Ga0070696_100008517 Ga0070696_1000085176 170
98 3300005547 Ga0070693_100026306 Ga0070693_1000263063 170
99 3300005547 Ga0070693_100271894 Ga0070693_1002718942 170
100 3300005549 Ga0070704_100142914 Ga0070704_1001429142 170
101 3300005549 Ga0070704_101286330 Ga0070704_1012863301 170
102 3300005563 Ga0068855_100021633 Ga0068855_1000216338 170
103 3300005563 Ga0068855_100023905 Ga0068855_1000239052 170
104 3300005563 Ga0068855_100108838 Ga0068855_1001088382 170
105 3300005563 Ga0068855_100416724 Ga0068855_1004167242 170
106 3300005563 Ga0068855_100609419 Ga0068855_1006094192 170
107 3300005564 Ga0070664_101105276 Ga0070664_1011052762 170
108 3300005577 Ga0068857_100021385 Ga0068857_1000213858 170
109 3300005577 Ga0068857_101090238 Ga0068857_1010902382 170
110 3300005578 Ga0068854_100132195 Ga0068854_1001321952 170
111 3300005578 Ga0068854_100186829 Ga0068854_1001868292 170
112 3300005578 Ga0068854_100326657 Ga0068854_1003266572 170
113 3300005578 Ga0068854_100593603 Ga0068854_1005936031 170
114 3300005614 Ga0068856_100033170 Ga0068856_1000331703 170
115 3300005614 Ga0068856_100470886 Ga0068856_1004708862 170
116 3300005615 Ga0070702_100666228 Ga0070702_1006662281 170
117 3300005616 Ga0068852_100000366 Ga0068852_1000003664 170
118 3300005616 Ga0068852_100009416 Ga0068852_1000094163 170
119 3300005616 Ga0068852_100017259 Ga0068852_1000172592 170
120 3300005616 Ga0068852_100068664 Ga0068852_1000686643 170
121 3300005617 Ga0068859_100076300 Ga0068859_1000763002 170
122 3300005617 Ga0068859_100097344 Ga0068859_1000973443 170
123 3300005617 Ga0068859_101288936 Ga0068859_1012889362 170
124 3300005618 Ga0068864_100114603 Ga0068864_1001146033 170
125 3300005618 Ga0068864_101509600 Ga0068864_1015096001 170
126 3300005719 Ga0068861_100318317 Ga0068861_1003183172 170
127 3300005834 Ga0068851_10000446 Ga0068851_100004462 170
128 3300005840 Ga0068870_10335113 Ga0068870_103351132 170
129 3300005840 Ga0068870_10582540 Ga0068870_105825401 170
130 3300005841 Ga0068863_100043189 Ga0068863_1000431892 170
131 3300005841 Ga0068863_100847534 Ga0068863_1008475342 170
132 3300005842 Ga0068858_100115283 Ga0068858_1001152832 170
133 3300005843 Ga0068860_100238668 Ga0068860_1002386682 170
134 3300005843 Ga0068860_100828536 Ga0068860_1008285362 170
135 3300005843 Ga0068860_101690768 Ga0068860_1016907681 170
136 3300005844 Ga0068862_100101773 Ga0068862_1001017732 170
137 3300006028 Ga0070717_10201669 Ga0070717_102016693 170
138 3300006051 Ga0075364_10023591 Ga0075364_100235915 170
139 3300006051 Ga0075364_10109474 Ga0075364_101094742 170
140 3300006051 Ga0075364_10169895 Ga0075364_101698952 170
141 3300006058 Ga0075432_10086405 Ga0075432_100864052 170
142 3300006173 Ga0070716_100689435 Ga0070716_1006894352 170
143 3300006173 Ga0070716_100945856 Ga0070716_1009458562 170
144 3300006177 Ga0075362_10030186 Ga0075362_100301862 170
145 3300006177 Ga0075362_10136490 Ga0075362_101364902 170
146 3300006186 Ga0075369_10000795 Ga0075369_100007953 170
147 3300006195 Ga0075366_10002459 Ga0075366_100024593 170
148 3300006195 Ga0075366_10007847 Ga0075366_100078473 170
149 3300006195 Ga0075366_10008100 Ga0075366_100081002 170
150 3300006195 Ga0075366_10035799 Ga0075366_100357994 170
151 3300006195 Ga0075366_10037017 Ga0075366_100370172 170
152 3300006195 Ga0075366_10401774 Ga0075366_104017741 170
153 3300006237 Ga0097621_100017590 Ga0097621_1000175905 170
154 3300006237 Ga0097621_100020123 Ga0097621_1000201233 170
155 3300006237 Ga0097621_100146595 Ga0097621_1001465953 170
156 3300006237 Ga0097621_100206404 Ga0097621_1002064042 170
157 3300006358 Ga0068871_100045534 Ga0068871_1000455342 170
158 3300006358 Ga0068871_100051801 Ga0068871_1000518012 170
159 3300006358 Ga0068871_100849454 Ga0068871_1008494542 170
160 3300006358 Ga0068871_101381020 Ga0068871_1013810202 170
161 3300006844 Ga0075428_100369171 Ga0075428_1003691712 170
162 3300006846 Ga0075430_100305874 Ga0075430_1003058742 170
163 3300006871 Ga0075434_100050939 Ga0075434_1000509396 170
164 3300006871 Ga0075434_100091551 Ga0075434_1000915512 170
165 3300006871 Ga0075434_100139184 Ga0075434_1001391842 170
166 3300006880 Ga0075429_100126485 Ga0075429_1001264854 170
167 3300006881 Ga0068865_100487167 Ga0068865_1004871672 170
168 3300006881 Ga0068865_100521961 Ga0068865_1005219611 170
169 3300006914 Ga0075436_100003266 Ga0075436_10000326610 170
170 3300006914 Ga0075436_100059214 Ga0075436_1000592143 170
171 3300006914 Ga0075436_100320327 Ga0075436_1003203273 170
172 3300006931 Ga0097620_100076307 Ga0097620_1000763072 170
173 3300006931 Ga0097620_100097345 Ga0097620_1000973453 170
174 3300006931 Ga0097620_101289166 Ga0097620_1012891662 170
175 3300007076 Ga0075435_100149405 Ga0075435_1001494052 170
176 3300007076 Ga0075435_100280295 Ga0075435_1002802952 170
177 3300007076 Ga0075435_100308449 Ga0075435_1003084492 170
178 3300009093 Ga0105240_10028255 Ga0105240_100282557 170
179 3300009093 Ga0105240_10127476 Ga0105240_101274762 170
180 3300009093 Ga0105240_10131593 Ga0105240_101315932 170
181 3300009093 Ga0105240_10165926 Ga0105240_101659265 170
182 3300009094 Ga0111539_10002062 Ga0111539_100020622 170
183 3300009094 Ga0111539_11095578 Ga0111539_110955782 170
184 3300009098 Ga0105245_10330592 Ga0105245_103305923 170
185 3300009098 Ga0105245_10509690 Ga0105245_105096902 170
186 3300009098 Ga0105245_10634709 Ga0105245_106347092 170
187 3300009098 Ga0105245_10675690 Ga0105245_106756902 170
188 3300009148 Ga0105243_11024551 Ga0105243_110245511 170
189 3300009174 Ga0105241_10015972 Ga0105241_100159722 170
190 3300009174 Ga0105241_10488787 Ga0105241_104887873 170
191 3300009174 Ga0105241_11909053 Ga0105241_119090531 170
192 3300009176 Ga0105242_10039194 Ga0105242_100391945 170
193 3300009176 Ga0105242_10085855 Ga0105242_100858552 170
194 3300009176 Ga0105242_10349499 Ga0105242_103494991 170
195 3300009176 Ga0105242_10479404 Ga0105242_104794043 170
196 3300009176 Ga0105242_10676547 Ga0105242_106765472 170
197 3300009177 Ga0105248_10045481 Ga0105248_100454812 170
198 3300009177 Ga0105248_10047767 Ga0105248_100477672 170
199 3300009177 Ga0105248_10081168 Ga0105248_100811685 170
200 3300009177 Ga0105248_11006648 Ga0105248_110066481 170
201 3300009551 Ga0105238_10014448 Ga0105238_100144489 170
202 3300009551 Ga0105238_10555001 Ga0105238_105550012 170
203 3300009551 Ga0105238_11467381 Ga0105238_114673812 170
204 3300009553 Ga0105249_10191356 Ga0105249_101913564 170
205 3300009553 Ga0105249_10839242 Ga0105249_108392422 170
206 3300013102 Ga0157371_10147734 Ga0157371_101477343 170
207 3300013102 Ga0157371_10376088 Ga0157371_103760882 170
208 3300013104 Ga0157370_10011580 Ga0157370_100115806 170
209 3300013104 Ga0157370_10891957 Ga0157370_108919572 170
210 3300013105 Ga0157369_10060943 Ga0157369_100609435 170
211 3300013105 Ga0157369_10135858 Ga0157369_101358583 170
212 3300013296 Ga0157374_10041952 Ga0157374_100419527 170
213 3300013296 Ga0157374_10154778 Ga0157374_101547785 170
214 3300013297 Ga0157378_10014205 Ga0157378_100142053 170
215 3300013297 Ga0157378_10199294 Ga0157378_101992942 170
216 3300013297 Ga0157378_10792742 Ga0157378_107927422 170
217 3300013306 Ga0163162_10403036 Ga0163162_104030362 170
218 3300013306 Ga0163162_11630773 Ga0163162_116307731 170
219 3300013307 Ga0157372_10000909 Ga0157372_1000090933 170
220 3300013307 Ga0157372_10050929 Ga0157372_100509292 170
221 3300013307 Ga0157372_10555043 Ga0157372_105550432 170
222 3300013308 Ga0157375_10011811 Ga0157375_100118113 170
223 3300013308 Ga0157375_10920972 Ga0157375_109209722 170
224 3300013308 Ga0157375_10972770 Ga0157375_109727702 170
225 3300014325 Ga0163163_11019424 Ga0163163_110194243 170
226 3300014326 Ga0157380_10028919 Ga0157380_100289192 170
227 3300014326 Ga0157380_10358192 Ga0157380_103581922 170
228 3300014326 Ga0157380_10910037 Ga0157380_109100372 170
229 3300014745 Ga0157377_10298907 Ga0157377_102989072 170
230 3300014968 Ga0157379_10106641 Ga0157379_101066412 170
231 3300014969 Ga0157376_10037328 Ga0157376_100373283 170
232 3300014969 Ga0157376_11290530 Ga0157376_112905302 170
233 3300017792 Ga0163161_10547228 Ga0163161_105472282 170
234 3300025321 Ga0207656_10005870 Ga0207656_100058701 170
235 3300025893 Ga0207682_10072180 Ga0207682_100721802 170
236 3300025893 Ga0207682_10104966 Ga0207682_101049662 170
237 3300025898 Ga0207692_10110247 Ga0207692_101102472 170
238 3300025901 Ga0207688_10022551 Ga0207688_100225512 170
239 3300025905 Ga0207685_10052236 Ga0207685_100522362 170
240 3300025907 Ga0207645_10367190 Ga0207645_103671902 170
241 3300025908 Ga0207643_10223404 Ga0207643_102234042 170
242 3300025908 Ga0207643_10452259 Ga0207643_104522592 170
243 3300025909 Ga0207705_10020878 Ga0207705_100208786 170
244 3300025909 Ga0207705_10164506 Ga0207705_101645062 170
245 3300025909 Ga0207705_10210687 Ga0207705_102106872 170
246 3300025911 Ga0207654_10019029 Ga0207654_100190295 170
247 3300025911 Ga0207654_10093195 Ga0207654_100931952 170
248 3300025913 Ga0207695_10038032 Ga0207695_100380326 170
249 3300025913 Ga0207695_10081577 Ga0207695_100815776 170
250 3300025913 Ga0207695_10212860 Ga0207695_102128602 170
251 3300025916 Ga0207663_10261629 Ga0207663_102616292 170
252 3300025917 Ga0207660_10256127 Ga0207660_102561272 170
253 3300025917 Ga0207660_10670972 Ga0207660_106709722 170
254 3300025918 Ga0207662_10056285 Ga0207662_100562852 170
255 3300025918 Ga0207662_10062899 Ga0207662_100628995 170
256 3300025918 Ga0207662_10075703 Ga0207662_100757033 170
257 3300025918 Ga0207662_10205489 Ga0207662_102054892 170
258 3300025918 Ga0207662_10222130 Ga0207662_102221302 170
259 3300025918 Ga0207662_10688746 Ga0207662_106887462 170
260 3300025919 Ga0207657_10226620 Ga0207657_102266203 170
261 3300025920 Ga0207649_10628861 Ga0207649_106288611 170
262 3300025920 Ga0207649_10935943 Ga0207649_109359432 170
263 3300025921 Ga0207652_10113446 Ga0207652_101134464 170
264 3300025921 Ga0207652_10138715 Ga0207652_101387153 170
265 3300025922 Ga0207646_10731683 Ga0207646_107316832 170
266 3300025923 Ga0207681_10134117 Ga0207681_101341172 170
267 3300025924 Ga0207694_10004983 Ga0207694_100049839 170
268 3300025924 Ga0207694_10743948 Ga0207694_107439481 170
269 3300025924 Ga0207694_10771752 Ga0207694_107717522 170
270 3300025924 Ga0207694_11313679 Ga0207694_113136791 170
271 3300025925 Ga0207650_10207056 Ga0207650_102070562 170
272 3300025925 Ga0207650_11000726 Ga0207650_110007262 170
273 3300025926 Ga0207659_10034365 Ga0207659_100343652 170
274 3300025927 Ga0207687_10065936 Ga0207687_100659362 170
275 3300025927 Ga0207687_10730526 Ga0207687_107305262 170
276 3300025927 Ga0207687_10819497 Ga0207687_108194972 170
277 3300025928 Ga0207700_10658939 Ga0207700_106589392 170
278 3300025929 Ga0207664_10123357 Ga0207664_101233572 170
279 3300025929 Ga0207664_10682803 Ga0207664_106828031 170
280 3300025931 Ga0207644_10204699 Ga0207644_102046991 170
281 3300025932 Ga0207690_10195511 Ga0207690_101955113 170
282 3300025934 Ga0207686_10012336 Ga0207686_100123365 170
283 3300025934 Ga0207686_10020528 Ga0207686_100205282 170
284 3300025934 Ga0207686_10203501 Ga0207686_102035012 170
285 3300025934 Ga0207686_10524440 Ga0207686_105244402 170
286 3300025935 Ga0207709_10246130 Ga0207709_102461302 170
287 3300025936 Ga0207670_10161583 Ga0207670_101615832 170
288 3300025936 Ga0207670_10190367 Ga0207670_101903671 170
289 3300025937 Ga0207669_10074937 Ga0207669_100749373 170
290 3300025938 Ga0207704_10328500 Ga0207704_103285002 170
291 3300025938 Ga0207704_10803787 Ga0207704_108037871 170
292 3300025939 Ga0207665_10395478 Ga0207665_103954782 170
293 3300025940 Ga0207691_10059323 Ga0207691_100593236 170
294 3300025940 Ga0207691_10705382 Ga0207691_107053822 170
295 3300025941 Ga0207711_10020985 Ga0207711_100209856 170
296 3300025941 Ga0207711_10026751 Ga0207711_100267516 170
297 3300025942 Ga0207689_10025409 Ga0207689_100254093 170
298 3300025942 Ga0207689_10535906 Ga0207689_105359062 170
299 3300025944 Ga0207661_10083258 Ga0207661_100832581 170
300 3300025944 Ga0207661_10798402 Ga0207661_107984022 170
301 3300025945 Ga0207679_11098948 Ga0207679_110989482 170
302 3300025949 Ga0207667_10019072 Ga0207667_100190723 170
303 3300025949 Ga0207667_10029787 Ga0207667_100297872 170
304 3300025949 Ga0207667_10090885 Ga0207667_100908854 170
305 3300025949 Ga0207667_10091933 Ga0207667_100919332 170
306 3300025949 Ga0207667_10104227 Ga0207667_101042272 170
307 3300025949 Ga0207667_10265385 Ga0207667_102653852 170
308 3300025949 Ga0207667_11159839 Ga0207667_111598392 170
309 3300025960 Ga0207651_10226175 Ga0207651_102261752 170
310 3300025960 Ga0207651_11030802 Ga0207651_110308022 170
311 3300025961 Ga0207712_10926995 Ga0207712_109269952 170
312 3300025981 Ga0207640_10162558 Ga0207640_101625582 170
313 3300025981 Ga0207640_10237130 Ga0207640_102371302 170
314 3300025981 Ga0207640_10530666 Ga0207640_105306662 170
315 3300026023 Ga0207677_10009354 Ga0207677_100093542 170
316 3300026023 Ga0207677_11306142 Ga0207677_113061422 170
317 3300026041 Ga0207639_10077288 Ga0207639_100772882 170
318 3300026041 Ga0207639_10132529 Ga0207639_101325292 170
319 3300026075 Ga0207708_10362772 Ga0207708_103627722 170
320 3300026078 Ga0207702_10014800 Ga0207702_100148003 170
321 3300026078 Ga0207702_10146697 Ga0207702_101466973 170
322 3300026088 Ga0207641_10067647 Ga0207641_100676472 170
323 3300026089 Ga0207648_10029370 Ga0207648_100293702 170
324 3300026089 Ga0207648_10762428 Ga0207648_107624281 170
325 3300026095 Ga0207676_10842158 Ga0207676_108421582 170
326 3300026116 Ga0207674_10010500 Ga0207674_100105009 170
327 3300026118 Ga0207675_100388638 Ga0207675_1003886382 170
328 3300026118 Ga0207675_101196125 Ga0207675_1011961252 170
329 3300026121 Ga0207683_10198241 Ga0207683_101982412 170
330 3300026121 Ga0207683_10345216 Ga0207683_103452162 170
331 3300026121 Ga0207683_10550537 Ga0207683_105505372 170
332 3300026121 Ga0207683_10863333 Ga0207683_108633332 170
333 3300026142 Ga0207698_10004231 Ga0207698_100042315 170
334 3300026142 Ga0207698_10012782 Ga0207698_100127823 170
335 3300026142 Ga0207698_10094025 Ga0207698_100940253 170
336 3300026142 Ga0207698_10120165 Ga0207698_101201655 170
337 3300026142 Ga0207698_10176002 Ga0207698_101760021 170
338 3300026142 Ga0207698_11163018 Ga0207698_111630182 170
339 3300027907 Ga0207428_10002330 Ga0207428_100023302 170
340 3300028379 Ga0268266_10041941 Ga0268266_100419414 170
341 3300028380 Ga0268265_10509495 Ga0268265_105094952 170
342 3300028380 Ga0268265_11080262 Ga0268265_110802621 170
343 3300028381 Ga0268264_10268065 Ga0268264_102680652 170
344 3300028381 Ga0268264_10691145 Ga0268264_106911451 170
345 3300031235 Ga0265330_10157369 Ga0265330_101573692 170
346 3300031344 Ga0265316_10085942 Ga0265316_100859422 170
347 3300031712 Ga0265342_10187302 Ga0265342_101873022 170
348 3300031824 Ga0307413_10068378 Ga0307413_100683782 170
349 3300031852 Ga0307410_10244846 Ga0307410_102448462 170
350 3300031903 Ga0307407_10620947 Ga0307407_106209472 170
351 3300031995 Ga0307409_100731298 Ga0307409_1007312982 170
352 3300031995 Ga0307409_101004219 Ga0307409_1010042192 170
353 3300032002 Ga0307416_100192126 Ga0307416_1001921262 170
354 3300032002 Ga0307416_100320458 Ga0307416_1003204582 170
355 3300032002 Ga0307416_100638706 Ga0307416_1006387062 170
356 3300032004 Ga0307414_10710957 Ga0307414_107109572 170
357 3300032005 Ga0307411_10677894 Ga0307411_106778941 170
358 3300032126 Ga0307415_100446804 Ga0307415_1004468042 170
359 3300032126 Ga0307415_101278939 Ga0307415_1012789391 170
360 3300034819 Ga0373958_0160734 Ga0373958_0160734_38_550 170
361 3300034957 Ga0373938_0166512 Ga0373938_0166512_35_547 170
362 3300035089 Ga0373944_0078514 Ga0373944_0078514_314_829 170
363 3300035112 Ga0373932_0173442 Ga0373932_0173442_72_584 170
364 3300035113 Ga0373936_0254705 Ga0373936_0254705_215_727 170
365 3300035121 Ga0373960_0122613 Ga0373960_0122613_30_542 170
366 3300035170 Ga0373943_0111243 Ga0373943_0111243_289_801 170
367 3300035410 Ga0373924_0051052 Ga0373924_0051052_676_1188 170
368 3300035691 Ga0373931_0355224 Ga0373931_0355224_25_537 170
369 3300035692 Ga0373935_0156858 Ga0373935_0156858_98_610 170
370 3300035695 Ga0373927_0023854 Ga0373927_0023854_960_1472 170
371 3300035695 Ga0373927_0391058 Ga0373927_0391058_337_852 170
372 3300035724 Ga0373933_0041325 Ga0373933_0041325_1702_2214 170
373 3300035725 Ga0373947_0255515 Ga0373947_0255515_378_893 170
374 3300036401 Ga0373937_0001850 Ga0373937_0001850_11571_12083 170
375 3300036401 Ga0373937_0060235 Ga0373937_0060235_1075_1587 170
376 3300037068 Ga0373925_0034927 Ga0373925_0034927_1767_2279 170
377 3300037068 Ga0373925_0436102 Ga0373925_0436102_335_847 170
378 3300037418 Ga0395900_0084328 Ga0395900_0084328_2238_2750 170
379 3300037471 Ga0395905_0004647 Ga0395905_0004647_9821_10333 170
380 3300038443 Ga0395901_0212566 Ga0395901_0212566_1454_1966 170
381 3300039437 Ga0436365_0986860 Ga0436365_0986860_2006_2518 170
382 3300039437 Ga0436365_1524731 Ga0436365_1524731_12_524 170
383 3300039437 Ga0436365_1604790 Ga0436365_1604790_518_1030 170
384 3300041486 Ga0451807_1278057 Ga0451807_1278057_306_818 170
385 3300041496 Ga0451839_0477412 Ga0451839_0477412_78_590 170
386 3300041512 Ga0451853_0117916 Ga0451853_0117916_122_682 170
387 3300041512 Ga0451853_0593964 Ga0451853_0593964_733_1245 170
388 3300042134 Ga0450898_085587 Ga0450898_085587_11_523 170
389 3300042156 Ga0439446_0028503 Ga0439446_0028503_312_824 170
390 3300042876 Ga0451577_0406269 Ga0451577_0406269_140_655 170
391 3300044684 Ga0466966_0018413 Ga0466966_0018413_62_574 170
392 3300044719 Ga0466971_0151191 Ga0466971_0151191_34_546 170
393 3300044842 Ga0466957_0012177 Ga0466957_0012177_2833_3345 170
394 3300045049 Ga0466959_0171422 Ga0466959_0171422_562_1074 170
395 3300045836 Ga0466958_0008233 Ga0466958_0008233_1008_1520 170
396 3300045976 Ga0466967_0986070 Ga0466967_0986070_144_656 170
397 3300046454 Ga0495592_0013889 Ga0495592_0013889_1259_1771 170
398 3300046463 Ga0495653_0089398 Ga0495653_0089398_1068_1580 170
399 3300046511 Ga0495608_0015577 Ga0495608_0015577_1628_2140 170
400 3300046516 Ga0495628_0144327 Ga0495628_0144327_361_873 170
401 3300046536 Ga0495587_0033850 Ga0495587_0033850_1269_1781 170
402 3300046537 Ga0495598_0132725 Ga0495598_0132725_101_616 170
403 3300046539 Ga0495621_0001542 Ga0495621_0001542_1769_2281 170
404 3300046539 Ga0495621_0003013 Ga0495621_0003013_3794_4306 170
405 3300046539 Ga0495621_0042092 Ga0495621_0042092_606_1121 170
406 3300046543 Ga0495645_0002710 Ga0495645_0002710_10291_10803 170
407 3300046663 Ga0495635_0042213 Ga0495635_0042213_1051_1563 170
408 3300046678 Ga0495599_0112911 Ga0495599_0112911_664_1176 170
409 3300046679 Ga0495623_0063157 Ga0495623_0063157_740_1252 170
410 3300046683 Ga0495658_0094905 Ga0495658_0094905_1014_1529 170
411 3300046683 Ga0495658_0136128 Ga0495658_0136128_832_1347 170
412 3300046691 Ga0495670_0187916 Ga0495670_0187916_524_1036 170
413 3300047317 Ga0495604_0188667 Ga0495604_0188667_560_1072 170
414 3300047444 Ga0495675_0170067 Ga0495675_0170067_374_886 170
415 3300048088 Ga0495602_0072581 Ga0495602_0072581_510_1022 170
416 3300048903 Ga0496100_1068049 Ga0496100_1068049_73_588 170
417 3300048907 Ga0496104_0001840 Ga0496104_0001840_9615_10130 170
418 3300048908 Ga0496105_0122145 Ga0496105_0122145_1590_2105 170
419 3300048912 Ga0496109_0068047 Ga0496109_0068047_2391_2906 170
420 3300048913 Ga0496110_0005881 Ga0496110_0005881_4459_4974 170
421 3300049581 Ga0501047_0006773 Ga0501047_0006773_1330_1842 170
422 3300049581 Ga0501047_0054575 Ga0501047_0054575_424_936 170
423 3300049581 Ga0501047_0119654 Ga0501047_0119654_200_712 170
424 3300049585 Ga0501069_0000499 Ga0501069_0000499_9523_10035 170
425 3300049586 Ga0501070_0000922 Ga0501070_0000922_10180_10692 170
426 3300049586 Ga0501070_0872733 Ga0501070_0872733_47_559 170
427 3300049589 Ga0501073_0000119 Ga0501073_0000119_12785_13297 170
428 3300049589 Ga0501073_0299291 Ga0501073_0299291_474_986 170
429 3300049590 Ga0501074_0000634 Ga0501074_0000634_1668_2180 170
430 3300049590 Ga0501074_0295343 Ga0501074_0295343_414_926 170
431 3300049741 Ga0501079_0006014 Ga0501079_0006014_1432_1944 170
432 3300049742 Ga0501080_0010597 Ga0501080_0010597_1927_2439 170
433 3300049742 Ga0501080_0053239 Ga0501080_0053239_722_1234 170
434 3300049742 Ga0501080_0080270 Ga0501080_0080270_70_582 170
435 3300049744 Ga0501083_0020281 Ga0501083_0020281_3061_3573 170
436 3300049822 Ga0501035_0047595 Ga0501035_0047595_1121_1633 170
437 3300049823 Ga0501044_0158568 Ga0501044_0158568_1433_1945 170
438 3300050489 nmdc:mga03683_24737_c1 nmdc:mga03683_24737_c1_1121_1633 170
439 3300050490 nmdc:mga03n38_187918_c1 nmdc:mga03n38_187918_c1_333_848 170
440 3300050491 nmdc:mga00v17_164927_c1 nmdc:mga00v17_164927_c1_729_1241 170
441 3300050491 nmdc:mga00v17_2243_c1 nmdc:mga00v17_2243_c1_7811_8326 170
442 3300050493 nmdc:mga0k408_13210_c1 nmdc:mga0k408_13210_c1_2454_2966 170
443 3300050493 nmdc:mga0k408_15090_c1 nmdc:mga0k408_15090_c1_2181_2696 170
444 3300050493 nmdc:mga0k408_17607_c1 nmdc:mga0k408_17607_c1_2584_3096 170
445 3300050493 nmdc:mga0k408_438539_c1 nmdc:mga0k408_438539_c1_53_568 170
446 3300050494 nmdc:mga06z11_143334_c1 nmdc:mga06z11_143334_c1_674_1186 170
447 3300050511 nmdc:mga08y16_2348_c1 nmdc:mga08y16_2348_c1_12813_13328 170
448 3300050511 nmdc:mga08y16_995811_c1 nmdc:mga08y16_995811_c1_95_607 170
449 3300050512 nmdc:mga0n895_175554_c1 nmdc:mga0n895_175554_c1_387_902 170
450 3300050512 nmdc:mga0n895_256358_c1 nmdc:mga0n895_256358_c1_758_1270 170
451 3300050512 nmdc:mga0n895_97840_c1 nmdc:mga0n895_97840_c1_550_1062 170
452 3300050513 nmdc:mga0rr50_453274_c1 nmdc:mga0rr50_453274_c1_280_792 170
453 3300050513 nmdc:mga0rr50_508897_c1 nmdc:mga0rr50_508897_c1_328_843 170
454 3300050513 nmdc:mga0rr50_80035_c1 nmdc:mga0rr50_80035_c1_262_774 170
455 3300050514 nmdc:mga08x19_46760_c1 nmdc:mga08x19_46760_c1_681_1193 170
456 3300050514 nmdc:mga08x19_591654_c1 nmdc:mga08x19_591654_c1_154_666 170
457 3300050514 nmdc:mga08x19_93490_c1 nmdc:mga08x19_93490_c1_317_829 170
458 3300050515 nmdc:mga0a205_25697_c2 nmdc:mga0a205_25697_c2_2384_2896 170
459 3300053077 Ga0495601_0005289 Ga0495601_0005289_5137_5649 170
460 3300053085 Ga0495619_0102050 Ga0495619_0102050_742_1254 170
461 3300053096 Ga0500641_0173406 Ga0500641_0173406_193_708 170
462 3300061719 Ga0466962_0069427 Ga0466962_0069427_818_1330 170

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01584

CheW

CheW-like domain

31

165

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jpb-assembly1.cif.gz_W the structure of a ternary complex between chea domains p4 and p5 with chew and with an unzipped fragment of tm14, a chemoreceptor analog from thermotoga maritima. 0.8573 29 160
8c5v-assembly1.cif.gz_H chemotaxis core signalling unit from e protein lysed e. coli cells 0.8253 26 165
2ch4-assembly1.cif.gz_A complex between bacterial chemotaxis histidine kinase chea domains p4 and p5 and receptor-adaptor protein chew 0.8081 28 158
8c5v-assembly1.cif.gz_H chemotaxis core signalling unit from e protein lysed e. coli cells 0.8046 26 165
2qdl-assembly2.cif.gz_B crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis 0.8031 27 164
ID Description Score Start End Superfamily
2qdlB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.8609 48 114 2.40.50.180
af_P0A964_36_100_2.40.50.180 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.8249 47 114 2.40.50.180
2ch4W02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.8224 47 114 2.40.50.180
af_P0A964_36_100_2.40.50.180 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.8137 47 114 2.40.50.180
2ch4W02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.6928 47 114 2.40.50.180
ID Description Score Start End GO Terms
AF-A0A7X1P764-F1-model_v4 Chemotaxis protein CheW 0.9335 23 170 GO:0005829
GO:0006935
GO:0007165
AF-A0A4Q3HYU0-F1-model_v4 deleted 0.9322 26 119
AF-A0A1I7HJ60-F1-model_v4 Twitching motility protein PilI 0.93 28 170 GO:0006935
GO:0007165
AF-A0A1V5FR67-F1-model_v4 Chemotaxis protein CheW 0.9299 42 166 GO:0006935
GO:0007165
AF-A0A2W4LXC6-F1-model_v4 CheW-like domain-containing protein 0.9274 33 170 GO:0005829
GO:0006935
GO:0007165

Feature Viewer

pLDDT pTM Quality
85.83 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map