F448751

General Info

Members Datasets Scaffolds Average Seq Length
461 226 922 314

Family's Representative Sequence

Representative Sequence 3300025925|Ga0207650_10122402|Ga0207650_101224022
Length 317
Sequence MSTPVSVVTGAAGFLGSHLVDILLSKGHSVIGYDNLATGSTDNIAHLAGNPAFRFIKQDITEYLYLPGPVDYVWHFASPASPVDYLELPIQTLKVGSLGTHKALGLAKAKGARFLLTSTSEIYGDPEIHPQTESYWGNVNTIGPRGCYDESKRFAEALTMAYFREHKVATRIVRIFNTYGPRMRLNDGRVVPAFIGQALRGESLTIFGEGRQTRSFCYVSDLLDGIVRLMFCSAADAHLPVNVGNPHELTIREFAQEIMRLTGTSAPLVHQPLPQDDPQQRQPDITRAIKLLGWSPRVELAQGLKETIEWFRPRFVH

Samples

Sample ID Description Type Environment
1 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
74 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
123 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
126 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.69
Nodule 0
Rhizoplane 2.82
Rhizosphere 93.28
Stem 0
Stem Tuber 0
Unclassified 6.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207650_10122402 3300025925 Bacteria 2027
2 Ga0070658_10048339 3300005327 Bacteria 3444
3 Ga0070683_100000041 3300005329 Bacteria 116748
4 Ga0070683_100004694 3300005329 Bacteria 11294
5 Ga0070683_100009811 3300005329 Bacteria 8203
6 Ga0070683_100016942 3300005329 Bacteria 6430
7 Ga0070690_100119563 3300005330 Bacteria 1767
8 Ga0070670_100151601 3300005331 Bacteria 2006
9 Ga0068869_100061821 3300005334 Bacteria 2748
10 Ga0068869_100094826 3300005334 Bacteria 2250
11 Ga0070680_100001305 3300005336 Bacteria 18052
12 Ga0070680_100013336 3300005336 Bacteria 6401
13 Ga0070691_10010245 3300005341 Bacteria 4276
14 Ga0070692_10019361 3300005345 Bacteria 3284
15 Ga0070692_10035236 3300005345 Bacteria 2532
16 Ga0070673_100017268 3300005364 Bacteria 5125
17 Ga0070673_100133679 3300005364 Bacteria 2085
18 Ga0070673_100293528 3300005364 Bacteria 1429
19 Ga0070659_100051503 3300005366 Bacteria 3237
20 Ga0070659_100062428 3300005366 Bacteria 2945
21 Ga0070667_100062370 3300005367 Bacteria 3157
22 Ga0070713_100007030 3300005436 Bacteria 7859
23 Ga0070713_100061366 3300005436 Bacteria 3145
24 Ga0070710_10159414 3300005437 Bacteria 1398
25 Ga0070711_100039049 3300005439 Bacteria 3195
26 Ga0070711_100045926 3300005439 Bacteria 2974
27 Ga0070711_100085889 3300005439 Bacteria 2255
28 Ga0070700_100051760 3300005441 Bacteria 2557
29 Ga0070708_100314509 3300005445 Bacteria 1475
30 Ga0070708_100383117 3300005445 Bacteria 1326
31 Ga0070662_100000008 3300005457 Bacteria 168754
32 Ga0070662_100013772 3300005457 Bacteria 5387
33 Ga0070662_100214152 3300005457 Bacteria 1534
34 Ga0070681_10149555 3300005458 Bacteria 2262
35 Ga0070681_10258658 3300005458 Bacteria 1653
36 Ga0070681_10341271 3300005458 Bacteria 1408
37 Ga0068867_100042649 3300005459 Bacteria 3320
38 Ga0068867_100106207 3300005459 Bacteria 2151
39 Ga0068867_100164719 3300005459 Bacteria 1751
40 Ga0070706_100070351 3300005467 Unclassified 3236
41 Ga0070699_100212125 3300005518 Bacteria 1724
42 Ga0070679_100038034 3300005530 Bacteria 4782
43 Ga0070679_100134164 3300005530 Bacteria 2457
44 Ga0070679_100198639 3300005530 Bacteria 1972
45 Ga0070679_100202177 3300005530 Unclassified 1952
46 Ga0070684_100000029 3300005535 Bacteria 116370
47 Ga0070684_100011022 3300005535 Bacteria 7190
48 Ga0070684_100014595 3300005535 Bacteria 6369
49 Ga0070684_100018299 3300005535 Bacteria 5770
50 Ga0070684_100133960 3300005535 Bacteria 2237
51 Ga0070672_100037190 3300005543 Bacteria 3712
52 Ga0070696_100001474 3300005546 Bacteria 15414
53 Ga0070693_100018256 3300005547 Bacteria 3661
54 Ga0070665_100110813 3300005548 Bacteria 2747
55 Ga0070665_100265988 3300005548 Bacteria 1716
56 Ga0068855_100008893 3300005563 Bacteria 12142
57 Ga0068855_100036945 3300005563 Bacteria 5811
58 Ga0068857_100000805 3300005577 Bacteria 23475
59 Ga0068857_100001185 3300005577 Bacteria 20363
60 Ga0068857_100187415 3300005577 Bacteria 1884
61 Ga0068854_100126692 3300005578 Bacteria 1945
62 Ga0068856_100009628 3300005614 Bacteria 9381
63 Ga0068852_100032057 3300005616 Bacteria 4346
64 Ga0068864_100417435 3300005618 Unclassified 1278
65 Ga0068861_100235920 3300005719 Bacteria 1553
66 Ga0068851_10049137 3300005834 Bacteria 2139
67 Ga0081538_10000296 3300005981 Bacteria 57287
68 Ga0081538_10014804 3300005981 Bacteria 6080
69 Ga0081538_10015448 3300005981 Bacteria 5906
70 Ga0070717_10024063 3300006028 Bacteria 4833
71 Ga0070717_10087734 3300006028 Bacteria 2621
72 Ga0075365_10030468 3300006038 Bacteria 3455
73 Ga0075365_10034869 3300006038 Bacteria 3252
74 Ga0075365_10193746 3300006038 Bacteria 1423
75 Ga0075363_100017478 3300006048 Bacteria 3558
76 Ga0075363_100028237 3300006048 Bacteria 2884
77 Ga0075363_100090568 3300006048 Bacteria 1683
78 Ga0075364_10011975 3300006051 Bacteria 5287
79 Ga0070716_100182609 3300006173 Bacteria 1379
80 Ga0097621_100028162 3300006237 Bacteria 4427
81 Ga0097621_100034779 3300006237 Bacteria 4021
82 Ga0097621_100091059 3300006237 Bacteria 2553
83 Ga0097621_100113510 3300006237 Bacteria 2292
84 Ga0097621_100338768 3300006237 Bacteria 1335
85 Ga0068871_100029166 3300006358 Bacteria 4332
86 Ga0068871_100078391 3300006358 Bacteria 2732
87 Ga0075431_100041177 3300006847 Bacteria 4763
88 Ga0075429_100131305 3300006880 Bacteria 2191
89 Ga0068865_100028934 3300006881 Bacteria 3671
90 Ga0068865_100050885 3300006881 Bacteria 2864
91 Ga0075436_100008343 3300006914 Bacteria 7086
92 Ga0105240_10000337 3300009093 Bacteria 87719
93 Ga0105240_10013290 3300009093 Bacteria 11318
94 Ga0105240_10016781 3300009093 Bacteria 9901
95 Ga0105240_10040561 3300009093 Bacteria 5952
96 Ga0105240_10147634 3300009093 Bacteria 2804
97 Ga0105240_10191489 3300009093 Unclassified 2405
98 Ga0105240_10337739 3300009093 Bacteria 1712
99 Ga0105240_10373901 3300009093 Bacteria 1611
100 Ga0111539_10075470 3300009094 Bacteria 3971
101 Ga0105245_10001470 3300009098 Bacteria 21288
102 Ga0105245_10164559 3300009098 Bacteria 2107
103 Ga0105245_10268203 3300009098 Unclassified 1664
104 Ga0105245_10424997 3300009098 Bacteria 1333
105 Ga0105243_10022810 3300009148 Bacteria 4758
106 Ga0105241_10008109 3300009174 Bacteria 7731
107 Ga0105241_10034712 3300009174 Unclassified 3791
108 Ga0105242_10110761 3300009176 Bacteria 2340
109 Ga0105242_10157887 3300009176 Bacteria 1983
110 Ga0105242_10388872 3300009176 Bacteria 1298
111 Ga0105242_10605848 3300009176 Bacteria 1059
112 Ga0105248_10003588 3300009177 Bacteria 17196
113 Ga0105237_10016271 3300009545 Bacteria 7730
114 Ga0105237_10038464 3300009545 Bacteria 4830
115 Ga0105237_10148227 3300009545 Bacteria 2342
116 Ga0105237_10323572 3300009545 Bacteria 1546
117 Ga0105237_10334319 3300009545 Unclassified 1519
118 Ga0105238_10006669 3300009551 Bacteria 11514
119 Ga0105238_10012835 3300009551 Bacteria 8452
120 Ga0105238_10288022 3300009551 Bacteria 1624
121 Ga0105249_10063956 3300009553 Bacteria 3381
122 Ga0105249_10220715 3300009553 Bacteria 1865
123 Ga0105239_10008245 3300010375 Bacteria 11882
124 Ga0105239_10070631 3300010375 Bacteria 3836
125 Ga0105239_10566870 3300010375 Bacteria 1294
126 Ga0105246_10227607 3300011119 Bacteria 1466
127 Ga0157371_10262844 3300013102 Bacteria 1244
128 Ga0157370_10023159 3300013104 Bacteria 6171
129 Ga0157369_10007677 3300013105 Bacteria 12410
130 Ga0157369_10016194 3300013105 Bacteria 8392
131 Ga0157374_10010399 3300013296 Bacteria 8001
132 Ga0157374_10446374 3300013296 Bacteria 1294
133 Ga0157378_10005261 3300013297 Bacteria 11370
134 Ga0157378_10212752 3300013297 Bacteria 1834
135 Ga0157378_10215164 3300013297 Bacteria 1824
136 Ga0163162_10179993 3300013306 Bacteria 2240
137 Ga0163162_10365216 3300013306 Bacteria 1576
138 Ga0157372_10003096 3300013307 Bacteria 17910
139 Ga0157372_10014528 3300013307 Bacteria 8425
140 Ga0157372_10040131 3300013307 Bacteria 5168
141 Ga0157372_10159446 3300013307 Bacteria 2607
142 Ga0157372_10179485 3300013307 Bacteria 2451
143 Ga0157372_10399977 3300013307 Bacteria 1600
144 Ga0157375_10238427 3300013308 Unclassified 1978
145 Ga0157375_10274347 3300013308 Bacteria 1848
146 Ga0157375_10390288 3300013308 Unclassified 1559
147 Ga0157375_10460866 3300013308 Bacteria 1436
148 Ga0163163_10016798 3300014325 Bacteria 6812
149 Ga0163163_10045503 3300014325 Bacteria 4308
150 Ga0163163_10080819 3300014325 Bacteria 3251
151 Ga0163163_10126757 3300014325 Unclassified 2591
152 Ga0157380_10075291 3300014326 Bacteria 2743
153 Ga0157379_10255103 3300014968 Bacteria 1593
154 Ga0157376_10015613 3300014969 Bacteria 5742
155 Ga0206355_1237293 3300020076 Unclassified 1386
156 Ga0206350_10559822 3300020080 Bacteria 1941
157 Ga0207699_10109544 3300025906 Bacteria 1767
158 Ga0207699_10111294 3300025906 Bacteria 1755
159 Ga0207705_10032154 3300025909 Bacteria 3749
160 Ga0207654_10006623 3300025911 Bacteria 5827
161 Ga0207654_10073380 3300025911 Unclassified 2039
162 Ga0207707_10006092 3300025912 Bacteria 10551
163 Ga0207707_10037159 3300025912 Bacteria 4255
164 Ga0207695_10000563 3300025913 Bacteria 76084
165 Ga0207695_10001289 3300025913 Bacteria 42571
166 Ga0207695_10060235 3300025913 Unclassified 3931
167 Ga0207695_10121969 3300025913 Bacteria 2573
168 Ga0207695_10162068 3300025913 Unclassified 2167
169 Ga0207671_10014083 3300025914 Bacteria 6339
170 Ga0207671_10022600 3300025914 Bacteria 4752
171 Ga0207671_10192339 3300025914 Bacteria 1591
172 Ga0207671_10325382 3300025914 Bacteria 1217
173 Ga0207663_10040943 3300025916 Bacteria 2820
174 Ga0207660_10008097 3300025917 Bacteria 6800
175 Ga0207660_10010910 3300025917 Bacteria 5906
176 Ga0207660_10146206 3300025917 Bacteria 1812
177 Ga0207652_10040699 3300025921 Bacteria 3947
178 Ga0207652_10170993 3300025921 Bacteria 1950
179 Ga0207694_10003536 3300025924 Bacteria 12410
180 Ga0207694_10133237 3300025924 Bacteria 1993
181 Ga0207694_10217234 3300025924 Bacteria 1559
182 Ga0207694_10340981 3300025924 Bacteria 1239
183 Ga0207659_10080789 3300025926 Bacteria 2402
184 Ga0207687_10000638 3300025927 Bacteria 23682
185 Ga0207687_10282250 3300025927 Bacteria 1331
186 Ga0207706_10000016 3300025933 Bacteria 170697
187 Ga0207706_10035533 3300025933 Bacteria 4429
188 Ga0207706_10253600 3300025933 Bacteria 1536
189 Ga0207686_10049975 3300025934 Bacteria 2599
190 Ga0207709_10016059 3300025935 Bacteria 4156
191 Ga0207709_10045911 3300025935 Bacteria 2648
192 Ga0207709_10169500 3300025935 Bacteria 1531
193 Ga0207670_10059665 3300025936 Bacteria 2596
194 Ga0207704_10018132 3300025938 Bacteria 3667
195 Ga0207665_10148911 3300025939 Bacteria 1675
196 Ga0207691_10052264 3300025940 Bacteria 3732
197 Ga0207711_10053278 3300025941 Bacteria 3470
198 Ga0207711_10186199 3300025941 Unclassified 1890
199 Ga0207689_10095903 3300025942 Bacteria 2436
200 Ga0207661_10000040 3300025944 Bacteria 126775
201 Ga0207661_10012018 3300025944 Bacteria 6290
202 Ga0207661_10012737 3300025944 Bacteria 6126
203 Ga0207661_10017810 3300025944 Bacteria 5264
204 Ga0207661_10024324 3300025944 Bacteria 4589
205 Ga0207661_10055838 3300025944 Bacteria 3169
206 Ga0207661_10433028 3300025944 Unclassified 1196
207 Ga0207679_10195299 3300025945 Bacteria 1686
208 Ga0207667_10001778 3300025949 Bacteria 27124
209 Ga0207667_10016431 3300025949 Bacteria 8364
210 Ga0207667_10067198 3300025949 Bacteria 3735
211 Ga0207651_10035542 3300025960 Bacteria 3242
212 Ga0207651_10258056 3300025960 Bacteria 1429
213 Ga0207658_10341948 3300025986 Bacteria 1301
214 Ga0207677_10139298 3300026023 Bacteria 1855
215 Ga0207703_10160520 3300026035 Bacteria 1968
216 Ga0207639_10067469 3300026041 Bacteria 2783
217 Ga0207639_10072060 3300026041 Bacteria 2704
218 Ga0207639_10288555 3300026041 Bacteria 1446
219 Ga0207702_10008198 3300026078 Bacteria 8831
220 Ga0207648_10029512 3300026089 Bacteria 4863
221 Ga0207648_10057295 3300026089 Bacteria 3399
222 Ga0207676_10122069 3300026095 Unclassified 2199
223 Ga0207676_10500814 3300026095 Unclassified 1153
224 Ga0207674_10001486 3300026116 Bacteria 30262
225 Ga0207674_10046021 3300026116 Bacteria 4483
226 Ga0207675_100130556 3300026118 Bacteria 2382
227 Ga0207698_10008360 3300026142 Bacteria 6540
228 Ga0207698_10182948 3300026142 Bacteria 1858
229 Ga0207698_10303664 3300026142 Bacteria 1487
230 Ga0265322_10000899 3300028654 Bacteria 10532
231 Ga0265338_10000139 3300028800 Bacteria 135334
232 Ga0265338_10242921 3300028800 Bacteria 1333
233 Ga0265330_10084002 3300031235 Bacteria 1370
234 Ga0265331_10051330 3300031250 Bacteria 1974
235 Ga0265316_10005883 3300031344 Bacteria 11819
236 Ga0265316_10022170 3300031344 Bacteria 5364
237 Ga0265316_10081799 3300031344 Bacteria 2475
238 Ga0265316_10092121 3300031344 Bacteria 2311
239 Ga0265316_10144957 3300031344 Bacteria 1781
240 Ga0265313_10006141 3300031595 Bacteria 8626
241 Ga0265314_10001753 3300031711 Bacteria 23442
242 Ga0265314_10024065 3300031711 Bacteria 4626
243 Ga0265342_10062615 3300031712 Unclassified 2189
244 Ga0265342_10153946 3300031712 Bacteria 1275
245 Ga0307406_10073990 3300031901 Bacteria 2242
246 Ga0307406_10078501 3300031901 Bacteria 2187
247 Ga0307407_10379685 3300031903 Bacteria 1009
248 Ga0307416_100003100 3300032002 Bacteria 9727
249 Ga0307415_100000999 3300032126 Bacteria 13060
250 Ga0373934_0009509 3300035086 Bacteria 3641
251 Ga0373945_0055103 3300035116 Unclassified 1471
252 Ga0373954_0008557 3300035118 Bacteria 4497
253 Ga0373954_0008698 3300035118 Bacteria 4463
254 Ga0373957_0131231 3300035120 Bacteria 1020
255 Ga0373946_0130709 3300035171 Bacteria 1155
256 Ga0373955_0038939 3300035172 Bacteria 2535
257 Ga0373955_0040624 3300035172 Bacteria 2489
258 Ga0373955_0192209 3300035172 Bacteria 1214
259 Ga0373935_0116149 3300035692 Bacteria 1782
260 Ga0373927_0003148 3300035695 Bacteria 11917
261 Ga0373927_0020427 3300035695 Bacteria 4342
262 Ga0373927_0118462 3300035695 Unclassified 1728
263 Ga0373933_0013186 3300035724 Unclassified 4578
264 Ga0373937_0004213 3300036401 Bacteria 12200
265 Ga0373937_0014646 3300036401 Bacteria 6925
266 Ga0373937_0062013 3300036401 Bacteria 3437
267 Ga0373937_0066284 3300036401 Bacteria 3325
268 Ga0373937_0076578 3300036401 Bacteria 3090
269 Ga0373937_0112222 3300036401 Bacteria 2536
270 Ga0316584_0196067 3300036712 Bacteria 1492
271 Ga0373925_0000641 3300037068 Bacteria 32911
272 Ga0373925_0124100 3300037068 Bacteria 2007
273 Ga0395899_0011149 3300037312 Bacteria 6886
274 Ga0395900_0013968 3300037418 Bacteria 8195
275 Ga0395900_0275565 3300037418 Bacteria 1676
276 Ga0395898_0008873 3300037466 Bacteria 10592
277 Ga0395898_0017283 3300037466 Bacteria 7367
278 Ga0395898_0052119 3300037466 Bacteria 3998
279 Ga0395905_0003280 3300037471 Bacteria 17376
280 Ga0395905_0160955 3300037471 Bacteria 2109
281 Ga0395901_0012860 3300038443 Bacteria 8488
282 Ga0395901_0015078 3300038443 Bacteria 7860
283 Ga0395901_0095315 3300038443 Bacteria 3118
284 Ga0451577_0071590 3300042876 Bacteria 3092
285 Ga0453684_0000184 3300044712 Bacteria 274619
286 Ga0451576_0165870 3300045051 Archaea 2305
287 Ga0451576_0398905 3300045051 Bacteria 1442
288 Ga0466967_0236813 3300045976 Bacteria 1740
289 Ga0466967_0445554 3300045976 Bacteria 1265
290 Ga0495592_0054577 3300046454 Bacteria 2960
291 Ga0495641_0019721 3300046461 Bacteria 3441
292 Ga0495651_0105738 3300046462 Bacteria 2087
293 Ga0495651_0177090 3300046462 Bacteria 1513
294 Ga0495580_0004273 3300046472 Bacteria 12013
295 Ga0495580_0031934 3300046472 Bacteria 3802
296 Ga0495580_0054522 3300046472 Bacteria 2820
297 Ga0495580_0084429 3300046472 Bacteria 2212
298 Ga0495580_0208499 3300046472 Bacteria 1345
299 Ga0495582_0002022 3300046473 Bacteria 11367
300 Ga0495662_0016035 3300046476 Bacteria 3635
301 Ga0495662_0146244 3300046476 Bacteria 1164
302 Ga0495608_0036445 3300046511 Bacteria 3312
303 Ga0495628_0075111 3300046516 Bacteria 2632
304 Ga0495628_0158660 3300046516 Bacteria 1720
305 Ga0495628_0263134 3300046516 Bacteria 1285
306 Ga0495630_0359954 3300046517 Bacteria 1114
307 Ga0495652_0016592 3300046529 Bacteria 6584
308 Ga0495652_0110679 3300046529 Bacteria 2209
309 Ga0495640_0034995 3300046533 Bacteria 3557
310 Ga0495586_0024730 3300046535 Bacteria 3212
311 Ga0495587_0010342 3300046536 Bacteria 5944
312 Ga0495587_0145405 3300046536 Unclassified 1352
313 Ga0495645_0001477 3300046543 Bacteria 15912
314 Ga0495645_0117820 3300046543 Bacteria 1873
315 Ga0495667_0017247 3300046559 Bacteria 4878
316 Ga0495667_0084053 3300046559 Bacteria 2067
317 Ga0495634_0000013 3300046642 Bacteria 130546
318 Ga0495635_0013103 3300046663 Bacteria 5805
319 Ga0495635_0191357 3300046663 Bacteria 1389
320 Ga0495623_0027350 3300046679 Bacteria 3669
321 Ga0495646_0236836 3300046680 Bacteria 982
322 Ga0495613_0062578 3300046689 Bacteria 2723
323 Ga0495613_0314899 3300046689 Bacteria 1081
324 Ga0495613_0357278 3300046689 Bacteria 1002
325 Ga0495624_0153007 3300046690 Bacteria 1411
326 Ga0495624_0198472 3300046690 Bacteria 1219
327 Ga0495600_0075137 3300046809 Bacteria 2207
328 Ga0495604_0045501 3300047317 Bacteria 3425
329 Ga0495674_0004177 3300047319 Bacteria 13925
330 Ga0495674_0016429 3300047319 Bacteria 6904
331 Ga0495674_0125730 3300047319 Bacteria 2164
332 Ga0495674_0139645 3300047319 Bacteria 2037
333 Ga0495676_0187356 3300047321 Bacteria 1445
334 Ga0495675_0045976 3300047444 Bacteria 2780
335 Ga0495675_0069678 3300047444 Bacteria 2221
336 Ga0495675_0096817 3300047444 Unclassified 1850
337 Ga0495675_0181452 3300047444 Bacteria 1288
338 Ga0495684_0000610 3300047471 Bacteria 28733
339 Ga0495684_0019830 3300047471 Bacteria 5181
340 Ga0495684_0231499 3300047471 Bacteria 1351
341 Ga0495602_0000669 3300048088 Bacteria 32135
342 Ga0495602_0003149 3300048088 Bacteria 16988
343 Ga0495602_0101777 3300048088 Bacteria 2356
344 Ga0495614_0055155 3300048089 Bacteria 1705
345 Ga0495614_0085114 3300048089 Bacteria 1372
346 Ga0496100_0000063 3300048903 Bacteria 60957
347 Ga0496101_0000012 3300048904 Bacteria 268127
348 Ga0496106_0000020 3300048909 Bacteria 169168
349 Ga0496107_0000014 3300048910 Bacteria 176738
350 Ga0496107_0237160 3300048910 Bacteria 1357
351 Ga0496108_0002731 3300048911 Bacteria 14111
352 Ga0496108_0299555 3300048911 Bacteria 1400
353 Ga0496109_0063035 3300048912 Bacteria 3390
354 Ga0496109_0115624 3300048912 Bacteria 2496
355 Ga0496109_0288891 3300048912 Bacteria 1546
356 Ga0496111_0154485 3300048914 Bacteria 1703
357 Ga0496113_0040911 3300048916 Bacteria 3418
358 Ga0496113_0289046 3300048916 Bacteria 1311
359 Ga0496126_0144814 3300048929 Bacteria 2042
360 Ga0501031_0004305 3300049568 Bacteria 9212
361 Ga0501031_0024603 3300049568 Bacteria 3925
362 Ga0501031_0116164 3300049568 Bacteria 1748
363 Ga0501032_0004786 3300049569 Bacteria 10151
364 Ga0501033_0052951 3300049570 Unclassified 3007
365 Ga0501033_0064225 3300049570 Bacteria 2701
366 Ga0501034_0025300 3300049571 Bacteria 6042
367 Ga0501034_0044612 3300049571 Bacteria 4482
368 Ga0501036_0030663 3300049572 Bacteria 4541
369 Ga0501036_0072301 3300049572 Bacteria 2915
370 Ga0501037_0059703 3300049573 Bacteria 2781
371 Ga0501037_0152651 3300049573 Bacteria 1650
372 Ga0501038_0246972 3300049574 Bacteria 1415
373 Ga0501038_0373555 3300049574 Unclassified 1107
374 Ga0501039_0002775 3300049575 Bacteria 13071
375 Ga0501039_0086228 3300049575 Bacteria 2445
376 Ga0501039_0182606 3300049575 Bacteria 1650
377 Ga0501040_0018413 3300049576 Bacteria 4636
378 Ga0501040_0084969 3300049576 Bacteria 2196
379 Ga0501041_0055904 3300049577 Bacteria 2410
380 Ga0501041_0168715 3300049577 Bacteria 1369
381 Ga0501042_0002200 3300049578 Bacteria 11889
382 Ga0501042_0047682 3300049578 Bacteria 3055
383 Ga0501043_0006228 3300049579 Bacteria 9581
384 Ga0501046_0001552 3300049580 Bacteria 21926
385 Ga0501046_0154520 3300049580 Bacteria 1730
386 Ga0501047_0092800 3300049581 Bacteria 2898
387 Ga0501047_0186337 3300049581 Bacteria 1940
388 Ga0501048_0004722 3300049582 Bacteria 10372
389 Ga0501067_0001264 3300049583 Bacteria 13743
390 Ga0501068_0002365 3300049584 Bacteria 10034
391 Ga0501069_0082895 3300049585 Bacteria 1807
392 Ga0501070_0020137 3300049586 Bacteria 5596
393 Ga0501070_0088156 3300049586 Bacteria 2568
394 Ga0501071_0010975 3300049587 Bacteria 6082
395 Ga0501071_0049825 3300049587 Bacteria 3015
396 Ga0501071_0050521 3300049587 Bacteria 2995
397 Ga0501072_0000733 3300049588 Bacteria 23903
398 Ga0501072_0002015 3300049588 Bacteria 15125
399 Ga0501072_0010896 3300049588 Bacteria 6935
400 Ga0501072_0081308 3300049588 Bacteria 2568
401 Ga0501072_0441690 3300049588 Bacteria 1030
402 Ga0501073_0003111 3300049589 Bacteria 12428
403 Ga0501073_0061077 3300049589 Bacteria 2630
404 Ga0501074_0003904 3300049590 Bacteria 10619
405 Ga0501074_0014977 3300049590 Bacteria 5643
406 Ga0501075_0018033 3300049591 Bacteria 5102
407 Ga0501075_0040977 3300049591 Bacteria 3470
408 Ga0501076_0002365 3300049592 Bacteria 12908
409 Ga0501076_0018130 3300049592 Bacteria 5360
410 Ga0501076_0097643 3300049592 Bacteria 2366
411 Ga0501076_0162351 3300049592 Bacteria 1820
412 Ga0501077_0004437 3300049593 Bacteria 8521
413 Ga0501077_0009528 3300049593 Bacteria 6039
414 Ga0501079_0003782 3300049741 Bacteria 11175
415 Ga0501079_0008093 3300049741 Bacteria 7964
416 Ga0501079_0008558 3300049741 Bacteria 7763
417 Ga0501079_0125873 3300049741 Bacteria 1993
418 Ga0501080_0000147 3300049742 Bacteria 50079
419 Ga0501080_0152533 3300049742 Unclassified 2135
420 Ga0501080_0238723 3300049742 Bacteria 1659
421 Ga0501081_0013427 3300049743 Bacteria 5387
422 Ga0501081_0045996 3300049743 Bacteria 2998
423 Ga0501083_0013897 3300049744 Bacteria 5628
424 Ga0501083_0106148 3300049744 Bacteria 1849
425 Ga0501035_0014192 3300049822 Bacteria 7352
426 Ga0501035_0089410 3300049822 Bacteria 2712
427 Ga0501044_0000597 3300049823 Bacteria 43761
428 Ga0501044_0014800 3300049823 Bacteria 8410
429 Ga0501044_0048110 3300049823 Unclassified 4407
430 Ga0501044_0063453 3300049823 Bacteria 3774
431 Ga0501044_0074402 3300049823 Bacteria 3451
432 Ga0501045_0021322 3300049824 Bacteria 4635
433 Ga0501045_0027426 3300049824 Bacteria 4104
434 Ga0501045_0123248 3300049824 Bacteria 1925
435 Ga0501045_0370491 3300049824 Bacteria 1066
436 nmdc:mga03n38_11211_c1 3300050490 Bacteria 3330
437 nmdc:mga03n38_21849_c1 3300050490 Bacteria 2581
438 nmdc:mga03n38_32035_c1 3300050490 Bacteria 2223
439 nmdc:mga00v17_156521_c1 3300050491 Bacteria 1465
440 nmdc:mga00v17_6630_c1 3300050491 Bacteria 6148
441 nmdc:mga0yw44_22628_c1 3300050492 Bacteria 3527
442 nmdc:mga0yw44_27336_c1 3300050492 Bacteria 3266
443 nmdc:mga0yw44_35017_c1 3300050492 Bacteria 2947
444 nmdc:mga0yw44_5717_c1 3300050492 Bacteria 5925
445 nmdc:mga09592_226887_c1 3300050508 Bacteria 1618
446 nmdc:mga08y16_101941_c1 3300050511 Bacteria 2988
447 nmdc:mga0rr50_125141_c1 3300050513 Bacteria 2051
448 nmdc:mga08x19_5182_c1 3300050514 Bacteria 7706
449 Ga0495612_0091494 3300053078 Bacteria 1288
450 Ga0495619_0001428 3300053085 Bacteria 15706
451 Ga0495619_0012998 3300053085 Bacteria 5245
452 Ga0500568_0000018 3300053139 Bacteria 196030
453 Ga0501084_0000404 3300054114 Bacteria 33318
454 Ga0501084_0042410 3300054114 Bacteria 3806
455 Ga0501084_0094135 3300054114 Bacteria 2516
456 Ga0501084_0114217 3300054114 Bacteria 2270
457 Ga0501082_0024148 3300060353 Bacteria 5243
458 Ga0501082_0058111 3300060353 Bacteria 3333
459 Ga0530510_0003831 3300061734 Bacteria 10365
460 Ga0530510_0008970 3300061734 Bacteria 7008
461 Ga0530510_0039247 3300061734 Bacteria 3418
462 Ga0207650_10122402
463 Ga0070658_10048339
464 Ga0070683_100000041
465 Ga0070683_100004694
466 Ga0070683_100009811
467 Ga0070683_100016942
468 Ga0070690_100119563
469 Ga0070670_100151601
470 Ga0068869_100061821
471 Ga0068869_100094826
472 Ga0070680_100001305
473 Ga0070680_100013336
474 Ga0070691_10010245
475 Ga0070692_10019361
476 Ga0070692_10035236
477 Ga0070673_100017268
478 Ga0070673_100133679
479 Ga0070673_100293528
480 Ga0070659_100051503
481 Ga0070659_100062428
482 Ga0070667_100062370
483 Ga0070713_100007030
484 Ga0070713_100061366
485 Ga0070710_10159414
486 Ga0070711_100039049
487 Ga0070711_100045926
488 Ga0070711_100085889
489 Ga0070700_100051760
490 Ga0070708_100314509
491 Ga0070708_100383117
492 Ga0070662_100000008
493 Ga0070662_100013772
494 Ga0070662_100214152
495 Ga0070681_10149555
496 Ga0070681_10258658
497 Ga0070681_10341271
498 Ga0068867_100042649
499 Ga0068867_100106207
500 Ga0068867_100164719
501 Ga0070706_100070351
502 Ga0070699_100212125
503 Ga0070679_100038034
504 Ga0070679_100134164
505 Ga0070679_100198639
506 Ga0070679_100202177
507 Ga0070684_100000029
508 Ga0070684_100011022
509 Ga0070684_100014595
510 Ga0070684_100018299
511 Ga0070684_100133960
512 Ga0070672_100037190
513 Ga0070696_100001474
514 Ga0070693_100018256
515 Ga0070665_100110813
516 Ga0070665_100265988
517 Ga0068855_100008893
518 Ga0068855_100036945
519 Ga0068857_100000805
520 Ga0068857_100001185
521 Ga0068857_100187415
522 Ga0068854_100126692
523 Ga0068856_100009628
524 Ga0068852_100032057
525 Ga0068864_100417435
526 Ga0068861_100235920
527 Ga0068851_10049137
528 Ga0081538_10000296
529 Ga0081538_10014804
530 Ga0081538_10015448
531 Ga0070717_10024063
532 Ga0070717_10087734
533 Ga0075365_10030468
534 Ga0075365_10034869
535 Ga0075365_10193746
536 Ga0075363_100017478
537 Ga0075363_100028237
538 Ga0075363_100090568
539 Ga0075364_10011975
540 Ga0070716_100182609
541 Ga0097621_100028162
542 Ga0097621_100034779
543 Ga0097621_100091059
544 Ga0097621_100113510
545 Ga0097621_100338768
546 Ga0068871_100029166
547 Ga0068871_100078391
548 Ga0075431_100041177
549 Ga0075429_100131305
550 Ga0068865_100028934
551 Ga0068865_100050885
552 Ga0075436_100008343
553 Ga0105240_10000337
554 Ga0105240_10013290
555 Ga0105240_10016781
556 Ga0105240_10040561
557 Ga0105240_10147634
558 Ga0105240_10191489
559 Ga0105240_10337739
560 Ga0105240_10373901
561 Ga0111539_10075470
562 Ga0105245_10001470
563 Ga0105245_10164559
564 Ga0105245_10268203
565 Ga0105245_10424997
566 Ga0105243_10022810
567 Ga0105241_10008109
568 Ga0105241_10034712
569 Ga0105242_10110761
570 Ga0105242_10157887
571 Ga0105242_10388872
572 Ga0105242_10605848
573 Ga0105248_10003588
574 Ga0105237_10016271
575 Ga0105237_10038464
576 Ga0105237_10148227
577 Ga0105237_10323572
578 Ga0105237_10334319
579 Ga0105238_10006669
580 Ga0105238_10012835
581 Ga0105238_10288022
582 Ga0105249_10063956
583 Ga0105249_10220715
584 Ga0105239_10008245
585 Ga0105239_10070631
586 Ga0105239_10566870
587 Ga0105246_10227607
588 Ga0157371_10262844
589 Ga0157370_10023159
590 Ga0157369_10007677
591 Ga0157369_10016194
592 Ga0157374_10010399
593 Ga0157374_10446374
594 Ga0157378_10005261
595 Ga0157378_10212752
596 Ga0157378_10215164
597 Ga0163162_10179993
598 Ga0163162_10365216
599 Ga0157372_10003096
600 Ga0157372_10014528
601 Ga0157372_10040131
602 Ga0157372_10159446
603 Ga0157372_10179485
604 Ga0157372_10399977
605 Ga0157375_10238427
606 Ga0157375_10274347
607 Ga0157375_10390288
608 Ga0157375_10460866
609 Ga0163163_10016798
610 Ga0163163_10045503
611 Ga0163163_10080819
612 Ga0163163_10126757
613 Ga0157380_10075291
614 Ga0157379_10255103
615 Ga0157376_10015613
616 Ga0206355_1237293
617 Ga0206350_10559822
618 Ga0207699_10109544
619 Ga0207699_10111294
620 Ga0207705_10032154
621 Ga0207654_10006623
622 Ga0207654_10073380
623 Ga0207707_10006092
624 Ga0207707_10037159
625 Ga0207695_10000563
626 Ga0207695_10001289
627 Ga0207695_10060235
628 Ga0207695_10121969
629 Ga0207695_10162068
630 Ga0207671_10014083
631 Ga0207671_10022600
632 Ga0207671_10192339
633 Ga0207671_10325382
634 Ga0207663_10040943
635 Ga0207660_10008097
636 Ga0207660_10010910
637 Ga0207660_10146206
638 Ga0207652_10040699
639 Ga0207652_10170993
640 Ga0207694_10003536
641 Ga0207694_10133237
642 Ga0207694_10217234
643 Ga0207694_10340981
644 Ga0207659_10080789
645 Ga0207687_10000638
646 Ga0207687_10282250
647 Ga0207706_10000016
648 Ga0207706_10035533
649 Ga0207706_10253600
650 Ga0207686_10049975
651 Ga0207709_10016059
652 Ga0207709_10045911
653 Ga0207709_10169500
654 Ga0207670_10059665
655 Ga0207704_10018132
656 Ga0207665_10148911
657 Ga0207691_10052264
658 Ga0207711_10053278
659 Ga0207711_10186199
660 Ga0207689_10095903
661 Ga0207661_10000040
662 Ga0207661_10012018
663 Ga0207661_10012737
664 Ga0207661_10017810
665 Ga0207661_10024324
666 Ga0207661_10055838
667 Ga0207661_10433028
668 Ga0207679_10195299
669 Ga0207667_10001778
670 Ga0207667_10016431
671 Ga0207667_10067198
672 Ga0207651_10035542
673 Ga0207651_10258056
674 Ga0207658_10341948
675 Ga0207677_10139298
676 Ga0207703_10160520
677 Ga0207639_10067469
678 Ga0207639_10072060
679 Ga0207639_10288555
680 Ga0207702_10008198
681 Ga0207648_10029512
682 Ga0207648_10057295
683 Ga0207676_10122069
684 Ga0207676_10500814
685 Ga0207674_10001486
686 Ga0207674_10046021
687 Ga0207675_100130556
688 Ga0207698_10008360
689 Ga0207698_10182948
690 Ga0207698_10303664
691 Ga0265322_10000899
692 Ga0265338_10000139
693 Ga0265338_10242921
694 Ga0265330_10084002
695 Ga0265331_10051330
696 Ga0265316_10005883
697 Ga0265316_10022170
698 Ga0265316_10081799
699 Ga0265316_10092121
700 Ga0265316_10144957
701 Ga0265313_10006141
702 Ga0265314_10001753
703 Ga0265314_10024065
704 Ga0265342_10062615
705 Ga0265342_10153946
706 Ga0307406_10073990
707 Ga0307406_10078501
708 Ga0307407_10379685
709 Ga0307416_100003100
710 Ga0307415_100000999
711 Ga0373934_0009509
712 Ga0373945_0055103
713 Ga0373954_0008557
714 Ga0373954_0008698
715 Ga0373957_0131231
716 Ga0373946_0130709
717 Ga0373955_0038939
718 Ga0373955_0040624
719 Ga0373955_0192209
720 Ga0373935_0116149
721 Ga0373927_0003148
722 Ga0373927_0020427
723 Ga0373927_0118462
724 Ga0373933_0013186
725 Ga0373937_0004213
726 Ga0373937_0014646
727 Ga0373937_0062013
728 Ga0373937_0066284
729 Ga0373937_0076578
730 Ga0373937_0112222
731 Ga0316584_0196067
732 Ga0373925_0000641
733 Ga0373925_0124100
734 Ga0395899_0011149
735 Ga0395900_0013968
736 Ga0395900_0275565
737 Ga0395898_0008873
738 Ga0395898_0017283
739 Ga0395898_0052119
740 Ga0395905_0003280
741 Ga0395905_0160955
742 Ga0395901_0012860
743 Ga0395901_0015078
744 Ga0395901_0095315
745 Ga0451577_0071590
746 Ga0453684_0000184
747 Ga0451576_0165870
748 Ga0451576_0398905
749 Ga0466967_0236813
750 Ga0466967_0445554
751 Ga0495592_0054577
752 Ga0495641_0019721
753 Ga0495651_0105738
754 Ga0495651_0177090
755 Ga0495580_0004273
756 Ga0495580_0031934
757 Ga0495580_0054522
758 Ga0495580_0084429
759 Ga0495580_0208499
760 Ga0495582_0002022
761 Ga0495662_0016035
762 Ga0495662_0146244
763 Ga0495608_0036445
764 Ga0495628_0075111
765 Ga0495628_0158660
766 Ga0495628_0263134
767 Ga0495630_0359954
768 Ga0495652_0016592
769 Ga0495652_0110679
770 Ga0495640_0034995
771 Ga0495586_0024730
772 Ga0495587_0010342
773 Ga0495587_0145405
774 Ga0495645_0001477
775 Ga0495645_0117820
776 Ga0495667_0017247
777 Ga0495667_0084053
778 Ga0495634_0000013
779 Ga0495635_0013103
780 Ga0495635_0191357
781 Ga0495623_0027350
782 Ga0495646_0236836
783 Ga0495613_0062578
784 Ga0495613_0314899
785 Ga0495613_0357278
786 Ga0495624_0153007
787 Ga0495624_0198472
788 Ga0495600_0075137
789 Ga0495604_0045501
790 Ga0495674_0004177
791 Ga0495674_0016429
792 Ga0495674_0125730
793 Ga0495674_0139645
794 Ga0495676_0187356
795 Ga0495675_0045976
796 Ga0495675_0069678
797 Ga0495675_0096817
798 Ga0495675_0181452
799 Ga0495684_0000610
800 Ga0495684_0019830
801 Ga0495684_0231499
802 Ga0495602_0000669
803 Ga0495602_0003149
804 Ga0495602_0101777
805 Ga0495614_0055155
806 Ga0495614_0085114
807 Ga0496100_0000063
808 Ga0496101_0000012
809 Ga0496106_0000020
810 Ga0496107_0000014
811 Ga0496107_0237160
812 Ga0496108_0002731
813 Ga0496108_0299555
814 Ga0496109_0063035
815 Ga0496109_0115624
816 Ga0496109_0288891
817 Ga0496111_0154485
818 Ga0496113_0040911
819 Ga0496113_0289046
820 Ga0496126_0144814
821 Ga0501031_0004305
822 Ga0501031_0024603
823 Ga0501031_0116164
824 Ga0501032_0004786
825 Ga0501033_0052951
826 Ga0501033_0064225
827 Ga0501034_0025300
828 Ga0501034_0044612
829 Ga0501036_0030663
830 Ga0501036_0072301
831 Ga0501037_0059703
832 Ga0501037_0152651
833 Ga0501038_0246972
834 Ga0501038_0373555
835 Ga0501039_0002775
836 Ga0501039_0086228
837 Ga0501039_0182606
838 Ga0501040_0018413
839 Ga0501040_0084969
840 Ga0501041_0055904
841 Ga0501041_0168715
842 Ga0501042_0002200
843 Ga0501042_0047682
844 Ga0501043_0006228
845 Ga0501046_0001552
846 Ga0501046_0154520
847 Ga0501047_0092800
848 Ga0501047_0186337
849 Ga0501048_0004722
850 Ga0501067_0001264
851 Ga0501068_0002365
852 Ga0501069_0082895
853 Ga0501070_0020137
854 Ga0501070_0088156
855 Ga0501071_0010975
856 Ga0501071_0049825
857 Ga0501071_0050521
858 Ga0501072_0000733
859 Ga0501072_0002015
860 Ga0501072_0010896
861 Ga0501072_0081308
862 Ga0501072_0441690
863 Ga0501073_0003111
864 Ga0501073_0061077
865 Ga0501074_0003904
866 Ga0501074_0014977
867 Ga0501075_0018033
868 Ga0501075_0040977
869 Ga0501076_0002365
870 Ga0501076_0018130
871 Ga0501076_0097643
872 Ga0501076_0162351
873 Ga0501077_0004437
874 Ga0501077_0009528
875 Ga0501079_0003782
876 Ga0501079_0008093
877 Ga0501079_0008558
878 Ga0501079_0125873
879 Ga0501080_0000147
880 Ga0501080_0152533
881 Ga0501080_0238723
882 Ga0501081_0013427
883 Ga0501081_0045996
884 Ga0501083_0013897
885 Ga0501083_0106148
886 Ga0501035_0014192
887 Ga0501035_0089410
888 Ga0501044_0000597
889 Ga0501044_0014800
890 Ga0501044_0048110
891 Ga0501044_0063453
892 Ga0501044_0074402
893 Ga0501045_0021322
894 Ga0501045_0027426
895 Ga0501045_0123248
896 Ga0501045_0370491
897 nmdc:mga03n38_11211_c1
898 nmdc:mga03n38_21849_c1
899 nmdc:mga03n38_32035_c1
900 nmdc:mga00v17_156521_c1
901 nmdc:mga00v17_6630_c1
902 nmdc:mga0yw44_22628_c1
903 nmdc:mga0yw44_27336_c1
904 nmdc:mga0yw44_35017_c1
905 nmdc:mga0yw44_5717_c1
906 nmdc:mga09592_226887_c1
907 nmdc:mga08y16_101941_c1
908 nmdc:mga0rr50_125141_c1
909 nmdc:mga08x19_5182_c1
910 Ga0495612_0091494
911 Ga0495619_0001428
912 Ga0495619_0012998
913 Ga0500568_0000018
914 Ga0501084_0000404
915 Ga0501084_0042410
916 Ga0501084_0094135
917 Ga0501084_0114217
918 Ga0501082_0024148
919 Ga0501082_0058111
920 Ga0530510_0003831
921 Ga0530510_0008970
922 Ga0530510_0039247

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

6

244

0.9

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

7

307

0.85

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

7

238

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4m55-assembly1.cif.gz_D crystal structure of human udp-xylose synthase r236h substitution 0.9778 2 308
4lk3-assembly1.cif.gz_E crystal structure of human udp-xylose synthase r236a substitution 0.9765 2 311
2b69-assembly1.cif.gz_A crystal structure of human udp-glucoronic acid decarboxylase 0.9723 2 311
4lk3-assembly1.cif.gz_D crystal structure of human udp-xylose synthase r236a substitution 0.9718 2 311
4lk3-assembly1.cif.gz_C crystal structure of human udp-xylose synthase r236a substitution 0.9715 2 311
ID Description Score Start End Superfamily
af_Q4E0S3_8_323_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.985 1 310 3.40.50.720
af_A0A0R0KMW5_231_418_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9826 123 309 3.40.50.720
af_A0A1D6N7M5_279_504_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9798 87 310 3.40.50.720
4lk3E00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9765 2 311 3.40.50.720
af_Q4E0S3_8_323_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9757 1 310 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2H9PBU5-F1-model_v4 UDP-glucuronate decarboxylase (EC 4.1.1.35) 0.9935 1 307 GO:0005737
GO:0016020
GO:0033320
GO:0042732
GO:0048040
GO:0070403
AF-A0A2H0LD34-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9933 2 306 GO:0005737
GO:0033320
GO:0042732
GO:0048040
GO:0070403
AF-A0A4Q3VVI0-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9929 145 307 GO:0005737
GO:0033320
GO:0042732
GO:0048040
GO:0070403
AF-A0A7R8L840-F1-model_v4 NAD-dependent dehydratase 0.9921 2 307 GO:0005737
GO:0033320
GO:0042732
GO:0048040
GO:0070403
AF-A0A2D7MAS5-F1-model_v4 UDP-glucuronate decarboxylase (EC 4.1.1.35) 0.9919 1 307 GO:0005737
GO:0016020
GO:0033320
GO:0042732
GO:0048040
GO:0070403

Map