F448713

General Info

Members Datasets Scaffolds Average Seq Length
461 206 922 325

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100031336|Ga0075436_1000313363
Length 341
Sequence MTRVAVVGGGAWGTALADLLARKGAFETVTLWAREPEVIESVNREHVNRPFLPGATLAESLTAEGSIAAAVRGADVVVSAAPSHAVREVMTQASGAMDRRALVVSVSKGLEPERLGTLSCVLQDVLTKGTRIAVLSGPSFAQEVYARQPTAVVAAAREHSVAQEVQHVFSVSHFRVYSATDVIGVELGGALKNVIALAAGILEGLGMGYNTRAALVTRGLAEITRLGVALGAEAATFAGLAGMGDLILTATGPLSRNHTLGVELGRGKRLQDALSSRASVAEGVNTARSAVTLGERHGVELPIAREVAAVLFEGKSPQRALVDLMERELKPEQWGVGGGGS

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
174 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
175 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
176 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
177 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
178 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.87
Rhizosphere 98.48
Stem 0
Stem Tuber 0
Unclassified 8.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100031336 3300006914 Bacteria 3661
2 MBSR1b_contig_12265562 2162886012 Bacteria 1302
3 Ga0065712_10150755 3300005290 Bacteria 1372
4 Ga0070658_10133435 3300005327 Bacteria 2070
5 Ga0070676_10008846 3300005328 Bacteria 5437
6 Ga0070676_10222833 3300005328 Unclassified 1246
7 Ga0070683_100004536 3300005329 Bacteria 11464
8 Ga0070683_100026660 3300005329 Bacteria 5207
9 Ga0070683_100027586 3300005329 Bacteria 5122
10 Ga0070683_100028636 3300005329 Bacteria 5036
11 Ga0070683_100053305 3300005329 Bacteria 3748
12 Ga0070683_100064273 3300005329 Bacteria 3415
13 Ga0070683_100302806 3300005329 Bacteria 1521
14 Ga0070690_100158802 3300005330 Bacteria 1548
15 Ga0070670_100000545 3300005331 Bacteria 29977
16 Ga0070670_100033260 3300005331 Bacteria 4441
17 Ga0070670_100042814 3300005331 Bacteria 3894
18 Ga0070670_100080293 3300005331 Bacteria 2803
19 Ga0068869_100017488 3300005334 Unclassified 4861
20 Ga0070680_100000413 3300005336 Bacteria 29124
21 Ga0070680_100008389 3300005336 Bacteria 7911
22 Ga0070680_100039252 3300005336 Bacteria 3832
23 Ga0070680_100083685 3300005336 Bacteria 2635
24 Ga0070680_100122418 3300005336 Bacteria 2172
25 Ga0070682_100000655 3300005337 Bacteria 21015
26 Ga0070682_100001112 3300005337 Bacteria 15373
27 Ga0070682_100019671 3300005337 Unclassified 3963
28 Ga0068868_100019481 3300005338 Bacteria 5083
29 Ga0068868_100182700 3300005338 Bacteria 1741
30 Ga0070660_100008102 3300005339 Bacteria 7343
31 Ga0070660_100269649 3300005339 Bacteria 1391
32 Ga0070687_100002158 3300005343 Bacteria 7278
33 Ga0070687_100022011 3300005343 Bacteria 3007
34 Ga0070687_100027584 3300005343 Unclassified 2745
35 Ga0070661_100016674 3300005344 Bacteria 5197
36 Ga0070661_100052732 3300005344 Bacteria 2977
37 Ga0070692_10012466 3300005345 Bacteria 3936
38 Ga0070668_100021279 3300005347 Unclassified 4902
39 Ga0070669_100001234 3300005353 Bacteria 18557
40 Ga0070669_100015837 3300005353 Bacteria 5377
41 Ga0070675_100003108 3300005354 Bacteria 12551
42 Ga0070675_100064545 3300005354 Bacteria 3027
43 Ga0070675_100119186 3300005354 Bacteria 2241
44 Ga0070671_100037834 3300005355 Bacteria 4003
45 Ga0070671_100064183 3300005355 Bacteria 3059
46 Ga0070674_100072747 3300005356 Unclassified 2435
47 Ga0070674_100179179 3300005356 Bacteria 1622
48 Ga0070674_100180377 3300005356 Bacteria 1617
49 Ga0070673_100031553 3300005364 Bacteria 3977
50 Ga0070673_100065297 3300005364 Bacteria 2903
51 Ga0070673_100150447 3300005364 Bacteria 1971
52 Ga0070659_100023366 3300005366 Unclassified 4729
53 Ga0070659_100053184 3300005366 Bacteria 3186
54 Ga0070659_100073483 3300005366 Bacteria 2722
55 Ga0070659_100205129 3300005366 Bacteria 1624
56 Ga0070703_10000423 3300005406 Bacteria 17391
57 Ga0070714_100015828 3300005435 Bacteria 6079
58 Ga0070714_100042672 3300005435 Bacteria 3833
59 Ga0070710_10033292 3300005437 Bacteria 2798
60 Ga0070711_100000239 3300005439 Bacteria 28182
61 Ga0070711_100048333 3300005439 Bacteria 2908
62 Ga0070694_100035544 3300005444 Bacteria 3295
63 Ga0070694_100052421 3300005444 Bacteria 2757
64 Ga0070708_100000261 3300005445 Bacteria 39467
65 Ga0070662_100000290 3300005457 Bacteria 29689
66 Ga0070662_100009719 3300005457 Bacteria 6295
67 Ga0070662_100043098 3300005457 Bacteria 3227
68 Ga0070681_10001154 3300005458 Bacteria 22820
69 Ga0070681_10002136 3300005458 Bacteria 17963
70 Ga0070681_10004456 3300005458 Bacteria 13338
71 Ga0070681_10004971 3300005458 Bacteria 12789
72 Ga0068867_100038533 3300005459 Bacteria 3480
73 Ga0068867_100147731 3300005459 Bacteria 1844
74 Ga0068867_100202036 3300005459 Bacteria 1591
75 Ga0070685_10029681 3300005466 Bacteria 3041
76 Ga0070685_10037551 3300005466 Unclassified 2744
77 Ga0070706_100013324 3300005467 Bacteria 7603
78 Ga0070706_100056926 3300005467 Unclassified 3607
79 Ga0070706_100156596 3300005467 Bacteria 2127
80 Ga0070707_100000813 3300005468 Bacteria 30885
81 Ga0070707_100051348 3300005468 Bacteria 3954
82 Ga0070699_100022813 3300005518 Bacteria 5394
83 Ga0070699_100179193 3300005518 Bacteria 1880
84 Ga0070679_100000423 3300005530 Bacteria 35993
85 Ga0070679_100003067 3300005530 Bacteria 15270
86 Ga0070679_100006247 3300005530 Bacteria 11100
87 Ga0070679_100032685 3300005530 Bacteria 5149
88 Ga0070679_100054809 3300005530 Bacteria 3971
89 Ga0070679_100063129 3300005530 Bacteria 3693
90 Ga0070679_100384104 3300005530 Bacteria 1351
91 Ga0070684_100000729 3300005535 Bacteria 22781
92 Ga0070684_100042509 3300005535 Bacteria 3923
93 Ga0070684_100049517 3300005535 Bacteria 3647
94 Ga0070684_100084008 3300005535 Bacteria 2822
95 Ga0070684_100144265 3300005535 Bacteria 2155
96 Ga0070697_100017320 3300005536 Bacteria 5668
97 Ga0070697_100397837 3300005536 Bacteria 1195
98 Ga0068853_100017151 3300005539 Bacteria 5975
99 Ga0070672_100003250 3300005543 Bacteria 10520
100 Ga0070672_100015031 3300005543 Bacteria 5500
101 Ga0070672_100128031 3300005543 Bacteria 2084
102 Ga0070672_100174033 3300005543 Bacteria 1791
103 Ga0070686_100009706 3300005544 Bacteria 5410
104 Ga0070695_100002535 3300005545 Bacteria 10547
105 Ga0070696_100069315 3300005546 Bacteria 2478
106 Ga0070693_100002382 3300005547 Bacteria 8644
107 Ga0070665_100098109 3300005548 Bacteria 2935
108 Ga0068855_100039363 3300005563 Bacteria 5612
109 Ga0068855_100048407 3300005563 Bacteria 5017
110 Ga0068855_100048472 3300005563 Bacteria 5013
111 Ga0068855_100076007 3300005563 Bacteria 3899
112 Ga0068855_100456045 3300005563 Bacteria 1394
113 Ga0070664_100024103 3300005564 Bacteria 5030
114 Ga0070664_100038536 3300005564 Bacteria 4023
115 Ga0070664_100121186 3300005564 Unclassified 2290
116 Ga0070664_100194206 3300005564 Bacteria 1809
117 Ga0070664_100397682 3300005564 Bacteria 1260
118 Ga0068857_100013541 3300005577 Bacteria 7104
119 Ga0068857_100014727 3300005577 Bacteria 6823
120 Ga0068854_100125145 3300005578 Bacteria 1956
121 Ga0068854_100350396 3300005578 Bacteria 1208
122 Ga0068852_100002728 3300005616 Bacteria 12212
123 Ga0068852_100142817 3300005616 Bacteria 2217
124 Ga0068859_100048664 3300005617 Bacteria 4258
125 Ga0068859_100240263 3300005617 Unclassified 1900
126 Ga0068864_100013582 3300005618 Bacteria 6750
127 Ga0068866_10008808 3300005718 Bacteria 4263
128 Ga0068861_100000364 3300005719 Bacteria 26004
129 Ga0068863_100008379 3300005841 Bacteria 10095
130 Ga0068858_100011442 3300005842 Bacteria 8376
131 Ga0068858_100416807 3300005842 Bacteria 1291
132 Ga0068862_100000406 3300005844 Bacteria 46534
133 Ga0081455_10004264 3300005937 Bacteria 16111
134 Ga0081538_10002054 3300005981 Bacteria 20088
135 Ga0081540_1007563 3300005983 Bacteria 7723
136 Ga0081539_10026845 3300005985 Bacteria 3661
137 Ga0081539_10072556 3300005985 Bacteria 1839
138 Ga0070717_10084976 3300006028 Bacteria 2662
139 Ga0070716_100003220 3300006173 Bacteria 7659
140 Ga0097621_100225574 3300006237 Bacteria 1634
141 Ga0075428_100000932 3300006844 Bacteria 30930
142 Ga0075428_100054324 3300006844 Bacteria 4390
143 Ga0075428_100164836 3300006844 Bacteria 2404
144 Ga0075428_100339399 3300006844 Bacteria 1613
145 Ga0075430_100003406 3300006846 Bacteria 13282
146 Ga0075430_100117667 3300006846 Bacteria 2215
147 Ga0075431_100010366 3300006847 Bacteria 9364
148 Ga0075431_100097434 3300006847 Bacteria 3037
149 Ga0075431_100135488 3300006847 Bacteria 2539
150 Ga0075431_100295909 3300006847 Bacteria 1636
151 Ga0075433_10035911 3300006852 Unclassified 4266
152 Ga0075433_10044264 3300006852 Bacteria 3867
153 Ga0075433_10052902 3300006852 Bacteria 3539
154 Ga0075434_100015473 3300006871 Bacteria 7316
155 Ga0075434_100022522 3300006871 Bacteria 6135
156 Ga0075434_100059289 3300006871 Bacteria 3805
157 Ga0075434_100105229 3300006871 Bacteria 2832
158 Ga0075429_100066936 3300006880 Bacteria 3127
159 Ga0075429_100078705 3300006880 Bacteria 2873
160 Ga0075429_100121187 3300006880 Bacteria 2286
161 Ga0075429_100233498 3300006880 Bacteria 1611
162 Ga0075429_100268734 3300006880 Bacteria 1493
163 Ga0068865_100008660 3300006881 Bacteria 6294
164 Ga0068865_100024928 3300006881 Bacteria 3928
165 Ga0097620_100048664 3300006931 Bacteria 4258
166 Ga0097620_100240274 3300006931 Unclassified 1900
167 Ga0075435_100104454 3300007076 Bacteria 2350
168 Ga0075435_100147085 3300007076 Bacteria 1979
169 Ga0099795_10037605 3300007788 Bacteria 1704
170 Ga0105240_10026291 3300009093 Bacteria 7636
171 Ga0105240_10132012 3300009093 Bacteria 2995
172 Ga0105240_10368828 3300009093 Bacteria 1624
173 Ga0111539_10028853 3300009094 Bacteria 6767
174 Ga0111539_10092205 3300009094 Bacteria 3560
175 Ga0111539_10110814 3300009094 Bacteria 3221
176 Ga0111539_10364079 3300009094 Bacteria 1683
177 Ga0105245_10029694 3300009098 Bacteria 4833
178 Ga0105245_10116354 3300009098 Unclassified 2493
179 Ga0114129_10008250 3300009147 Bacteria 14855
180 Ga0114129_10011116 3300009147 Bacteria 12829
181 Ga0114129_10128835 3300009147 Bacteria 3478
182 Ga0114129_10444489 3300009147 Unclassified 1701
183 Ga0114129_10461663 3300009147 Bacteria 1664
184 Ga0105242_10245142 3300009176 Bacteria 1612
185 Ga0105248_10370784 3300009177 Bacteria 1612
186 Ga0105248_10448117 3300009177 Bacteria 1454
187 Ga0105237_10153048 3300009545 Unclassified 2303
188 Ga0105238_10050827 3300009551 Bacteria 4172
189 Ga0105249_10000083 3300009553 Bacteria 135844
190 Ga0105239_10017496 3300010375 Bacteria 7928
191 Ga0157371_10008971 3300013102 Bacteria 7909
192 Ga0157371_10051670 3300013102 Bacteria 2920
193 Ga0157370_10022984 3300013104 Bacteria 6196
194 Ga0157370_10097794 3300013104 Bacteria 2753
195 Ga0157369_10041000 3300013105 Bacteria 5053
196 Ga0157369_10115377 3300013105 Bacteria 2852
197 Ga0157374_10069562 3300013296 Unclassified 3314
198 Ga0157374_10201795 3300013296 Bacteria 1947
199 Ga0157378_10006972 3300013297 Bacteria 9855
200 Ga0157378_10027319 3300013297 Bacteria 5036
201 Ga0163162_10158887 3300013306 Bacteria 2381
202 Ga0157372_10009203 3300013307 Bacteria 10500
203 Ga0157372_10026323 3300013307 Bacteria 6329
204 Ga0157372_10030873 3300013307 Bacteria 5864
205 Ga0157372_10079616 3300013307 Bacteria 3706
206 Ga0157375_10113631 3300013308 Bacteria 2809
207 Ga0163163_10021610 3300014325 Bacteria 6076
208 Ga0157380_10001393 3300014326 Bacteria 15781
209 Ga0157380_10062321 3300014326 Unclassified 2987
210 Ga0157380_10098992 3300014326 Bacteria 2424
211 Ga0182008_10003787 3300014497 Bacteria 8992
212 Ga0157377_10013623 3300014745 Bacteria 4120
213 Ga0157377_10038138 3300014745 Unclassified 2651
214 Ga0157377_10160681 3300014745 Viruses 1397
215 Ga0157379_10025524 3300014968 Bacteria 5250
216 Ga0206354_10837383 3300020081 Bacteria 2292
217 Ga0213876_10016566 3300021384 Bacteria 3895
218 Ga0213876_10084022 3300021384 Unclassified 1684
219 Ga0207697_10004118 3300025315 Bacteria 7020
220 Ga0207653_10000053 3300025885 Bacteria 87641
221 Ga0207642_10012643 3300025899 Bacteria 3055
222 Ga0207647_10050260 3300025904 Unclassified 2582
223 Ga0207699_10003925 3300025906 Bacteria 7108
224 Ga0207645_10000052 3300025907 Bacteria 83428
225 Ga0207643_10001974 3300025908 Bacteria 11324
226 Ga0207643_10018563 3300025908 Bacteria 3808
227 Ga0207705_10030528 3300025909 Bacteria 3846
228 Ga0207705_10034211 3300025909 Bacteria 3633
229 Ga0207684_10007456 3300025910 Bacteria 9845
230 Ga0207684_10117027 3300025910 Bacteria 2284
231 Ga0207654_10200365 3300025911 Bacteria 1314
232 Ga0207707_10001107 3300025912 Bacteria 25619
233 Ga0207707_10004933 3300025912 Bacteria 11736
234 Ga0207707_10005921 3300025912 Bacteria 10696
235 Ga0207707_10134283 3300025912 Bacteria 2164
236 Ga0207707_10171253 3300025912 Bacteria 1897
237 Ga0207695_10007320 3300025913 Bacteria 14094
238 Ga0207695_10018641 3300025913 Bacteria 8019
239 Ga0207695_10134504 3300025913 Bacteria 2427
240 Ga0207671_10114139 3300025914 Bacteria 2059
241 Ga0207663_10000256 3300025916 Bacteria 23155
242 Ga0207660_10002968 3300025917 Bacteria 11094
243 Ga0207660_10033171 3300025917 Bacteria 3569
244 Ga0207660_10041527 3300025917 Bacteria 3223
245 Ga0207660_10043865 3300025917 Bacteria 3144
246 Ga0207660_10065041 3300025917 Bacteria 2634
247 Ga0207660_10071599 3300025917 Bacteria 2523
248 Ga0207660_10382415 3300025917 Bacteria 1132
249 Ga0207662_10003325 3300025918 Bacteria 8249
250 Ga0207662_10009112 3300025918 Bacteria 5455
251 Ga0207662_10022065 3300025918 Bacteria 3644
252 Ga0207657_10003617 3300025919 Bacteria 16476
253 Ga0207657_10263272 3300025919 Bacteria 1372
254 Ga0207657_10376135 3300025919 Bacteria 1119
255 Ga0207649_10027031 3300025920 Unclassified 3363
256 Ga0207649_10034788 3300025920 Bacteria 3021
257 Ga0207649_10056217 3300025920 Bacteria 2456
258 Ga0207649_10056551 3300025920 Bacteria 2450
259 Ga0207649_10082290 3300025920 Bacteria 2087
260 Ga0207649_10324427 3300025920 Bacteria 1132
261 Ga0207652_10004328 3300025921 Bacteria 11570
262 Ga0207652_10004463 3300025921 Bacteria 11395
263 Ga0207652_10005147 3300025921 Bacteria 10607
264 Ga0207652_10058004 3300025921 Bacteria 3335
265 Ga0207652_10086126 3300025921 Bacteria 2754
266 Ga0207652_10100691 3300025921 Bacteria 2551
267 Ga0207652_10442984 3300025921 Bacteria 1171
268 Ga0207646_10002922 3300025922 Bacteria 19815
269 Ga0207681_10001627 3300025923 Bacteria 14487
270 Ga0207694_10014098 3300025924 Bacteria 6026
271 Ga0207650_10007944 3300025925 Bacteria 7231
272 Ga0207650_10048110 3300025925 Bacteria 3144
273 Ga0207650_10111323 3300025925 Bacteria 2120
274 Ga0207650_10195905 3300025925 Bacteria 1616
275 Ga0207659_10006142 3300025926 Bacteria 7341
276 Ga0207687_10026705 3300025927 Bacteria 3868
277 Ga0207687_10059964 3300025927 Unclassified 2682
278 Ga0207644_10048104 3300025931 Bacteria 3047
279 Ga0207690_10010964 3300025932 Bacteria 5404
280 Ga0207690_10022913 3300025932 Bacteria 3890
281 Ga0207690_10061101 3300025932 Unclassified 2560
282 Ga0207706_10000217 3300025933 Bacteria 63442
283 Ga0207706_10027208 3300025933 Bacteria 5115
284 Ga0207670_10057353 3300025936 Bacteria 2641
285 Ga0207669_10055353 3300025937 Bacteria 2402
286 Ga0207669_10161297 3300025937 Unclassified 1584
287 Ga0207669_10215861 3300025937 Bacteria 1404
288 Ga0207669_10278438 3300025937 Bacteria 1260
289 Ga0207704_10020819 3300025938 Bacteria 3479
290 Ga0207704_10116358 3300025938 Unclassified 1819
291 Ga0207665_10019134 3300025939 Bacteria 4500
292 Ga0207665_10069886 3300025939 Bacteria 2395
293 Ga0207691_10000474 3300025940 Bacteria 39819
294 Ga0207691_10007594 3300025940 Bacteria 10436
295 Ga0207691_10010708 3300025940 Bacteria 8804
296 Ga0207691_10020828 3300025940 Bacteria 6196
297 Ga0207691_10102628 3300025940 Bacteria 2551
298 Ga0207691_10174066 3300025940 Bacteria 1883
299 Ga0207711_10217237 3300025941 Unclassified 1747
300 Ga0207689_10001625 3300025942 Bacteria 21286
301 Ga0207689_10031812 3300025942 Bacteria 4389
302 Ga0207689_10237952 3300025942 Bacteria 1505
303 Ga0207661_10003185 3300025944 Bacteria 11383
304 Ga0207661_10008342 3300025944 Bacteria 7398
305 Ga0207661_10054501 3300025944 Bacteria 3204
306 Ga0207661_10085403 3300025944 Bacteria 2616
307 Ga0207679_10005301 3300025945 Bacteria 8089
308 Ga0207679_10014453 3300025945 Bacteria 5193
309 Ga0207679_10025901 3300025945 Bacteria 4039
310 Ga0207679_10061088 3300025945 Bacteria 2804
311 Ga0207679_10089296 3300025945 Bacteria 2379
312 Ga0207679_10145572 3300025945 Bacteria 1921
313 Ga0207667_10115766 3300025949 Bacteria 2763
314 Ga0207667_10244312 3300025949 Unclassified 1837
315 Ga0207651_10056700 3300025960 Unclassified 2698
316 Ga0207651_10188819 3300025960 Bacteria 1642
317 Ga0207712_10002947 3300025961 Bacteria 10868
318 Ga0207712_10076547 3300025961 Unclassified 2423
319 Ga0207668_10284130 3300025972 Bacteria 1358
320 Ga0207640_10078170 3300025981 Bacteria 2251
321 Ga0207640_10119160 3300025981 Bacteria 1887
322 Ga0207640_10170144 3300025981 Bacteria 1623
323 Ga0207640_10180679 3300025981 Unclassified 1581
324 Ga0207640_10248596 3300025981 Bacteria 1379
325 Ga0207658_10159421 3300025986 Unclassified 1848
326 Ga0207677_10030067 3300026023 Bacteria 3462
327 Ga0207639_10485622 3300026041 Bacteria 1126
328 Ga0207678_10001306 3300026067 Bacteria 23107
329 Ga0207678_10079114 3300026067 Bacteria 2815
330 Ga0207708_10007482 3300026075 Bacteria 8072
331 Ga0207708_10052494 3300026075 Unclassified 3105
332 Ga0207708_10101881 3300026075 Bacteria 2223
333 Ga0207702_10432744 3300026078 Bacteria 1274
334 Ga0207641_10126368 3300026088 Bacteria 2290
335 Ga0207648_10003278 3300026089 Bacteria 17025
336 Ga0207648_10084499 3300026089 Bacteria 2769
337 Ga0207648_10161455 3300026089 Bacteria 1979
338 Ga0207648_10274364 3300026089 Bacteria 1507
339 Ga0207676_10017723 3300026095 Bacteria 5166
340 Ga0207674_10000677 3300026116 Bacteria 44223
341 Ga0207674_10001464 3300026116 Bacteria 30508
342 Ga0207674_10019869 3300026116 Bacteria 7269
343 Ga0207674_10033488 3300026116 Bacteria 5379
344 Ga0207674_10108584 3300026116 Bacteria 2751
345 Ga0207674_10245316 3300026116 Bacteria 1738
346 Ga0207675_100000102 3300026118 Bacteria 67767
347 Ga0207675_100169053 3300026118 Bacteria 2089
348 Ga0207683_10274535 3300026121 Bacteria 1540
349 Ga0207698_10041769 3300026142 Bacteria 3421
350 Ga0207698_10124737 3300026142 Bacteria 2187
351 Ga0207698_10128692 3300026142 Unclassified 2159
352 Ga0209981_1006412 3300027378 Bacteria 1574
353 Ga0209996_1009871 3300027395 Bacteria 1262
354 Ga0207428_10071721 3300027907 Bacteria 2720
355 Ga0207428_10144153 3300027907 Bacteria 1816
356 Ga0268266_10014920 3300028379 Bacteria 6672
357 Ga0268265_10003698 3300028380 Bacteria 10897
358 Ga0307408_100009986 3300031548 Bacteria 6255
359 Ga0307408_100027808 3300031548 Bacteria 3901
360 Ga0307408_100128353 3300031548 Bacteria 1975
361 Ga0307408_100352512 3300031548 Bacteria 1249
362 Ga0307405_10000062 3300031731 Bacteria 51691
363 Ga0307405_10001601 3300031731 Bacteria 9616
364 Ga0307405_10001880 3300031731 Bacteria 9017
365 Ga0307405_10051674 3300031731 Bacteria 2551
366 Ga0307413_10003220 3300031824 Bacteria 6830
367 Ga0307413_10007509 3300031824 Bacteria 5070
368 Ga0307413_10008858 3300031824 Bacteria 4779
369 Ga0307413_10019451 3300031824 Bacteria 3589
370 Ga0307410_10000793 3300031852 Bacteria 13351
371 Ga0307410_10000973 3300031852 Bacteria 12322
372 Ga0307410_10131561 3300031852 Bacteria 1838
373 Ga0307406_10002343 3300031901 Bacteria 10295
374 Ga0307406_10017138 3300031901 Bacteria 4217
375 Ga0307406_10028824 3300031901 Bacteria 3356
376 Ga0307407_10001168 3300031903 Bacteria 9239
377 Ga0307407_10015763 3300031903 Bacteria 3746
378 Ga0307407_10022192 3300031903 Bacteria 3288
379 Ga0307407_10057284 3300031903 Bacteria 2260
380 Ga0307412_10003741 3300031911 Bacteria 8451
381 Ga0307412_10010704 3300031911 Bacteria 5288
382 Ga0307412_10095237 3300031911 Bacteria 2093
383 Ga0307409_100001690 3300031995 Bacteria 11120
384 Ga0307409_100002521 3300031995 Bacteria 9595
385 Ga0307409_100019420 3300031995 Bacteria 4601
386 Ga0307409_100036222 3300031995 Bacteria 3625
387 Ga0307409_100070624 3300031995 Bacteria 2773
388 Ga0307409_100086140 3300031995 Bacteria 2556
389 Ga0307409_100166113 3300031995 Bacteria 1937
390 Ga0307416_100009255 3300032002 Bacteria 6432
391 Ga0307416_100009443 3300032002 Bacteria 6385
392 Ga0307416_100031332 3300032002 Bacteria 4001
393 Ga0307416_100220322 3300032002 Bacteria 1819
394 Ga0307416_100325687 3300032002 Bacteria 1541
395 Ga0307414_10034573 3300032004 Bacteria 3353
396 Ga0307414_10094497 3300032004 Bacteria 2232
397 Ga0307411_10000346 3300032005 Bacteria 15638
398 Ga0307411_10001106 3300032005 Bacteria 10495
399 Ga0307411_10006393 3300032005 Bacteria 5892
400 Ga0307411_10073449 3300032005 Bacteria 2327
401 Ga0307415_100002393 3300032126 Bacteria 9352
402 Ga0307415_100004596 3300032126 Bacteria 7198
403 Ga0307415_100042323 3300032126 Bacteria 3030
404 Ga0307415_100180126 3300032126 Bacteria 1657
405 Ga0373959_0024107 3300034820 Bacteria 1187
406 Ga0373940_0053625 3300035088 Bacteria 1138
407 Ga0373944_0008191 3300035089 Bacteria 2820
408 Ga0373939_0039636 3300035114 Bacteria 1411
409 Ga0373941_0021109 3300035115 Bacteria 1833
410 Ga0373960_0006746 3300035121 Bacteria 2702
411 Ga0373943_0075715 3300035170 Bacteria 1715
412 Ga0373942_0010818 3300035207 Bacteria 2152
413 Ga0373935_0117424 3300035692 Bacteria 1773
414 Ga0395899_0007032 3300037312 Bacteria 8706
415 Ga0395900_0014419 3300037418 Bacteria 8067
416 Ga0395898_0122306 3300037466 Bacteria 2494
417 Ga0395905_0058437 3300037471 Bacteria 3606
418 Ga0395901_0001422 3300038443 Bacteria 24965
419 Ga0436365_1090454 3300039437 Bacteria 4077
420 Ga0451577_0059428 3300042876 Bacteria 3408
421 Ga0451577_0223972 3300042876 Bacteria 1700
422 Ga0451576_0025189 3300045051 Bacteria 6413
423 Ga0495629_0012974 3300046459 Bacteria 6026
424 Ga0495582_0011559 3300046473 Bacteria 4864
425 Ga0495582_0117220 3300046473 Unclassified 1498
426 Ga0495665_0095289 3300046531 Bacteria 1563
427 Ga0495647_0074815 3300046681 Bacteria 1362
428 Ga0495669_0036722 3300046684 Bacteria 2167
429 Ga0496108_0063131 3300048911 Bacteria 3119
430 Ga0496109_0064222 3300048912 Bacteria 3359
431 Ga0496112_0010076 3300048915 Bacteria 8558
432 Ga0496112_0073657 3300048915 Bacteria 3376
433 nmdc:mga05p37_206076_c1 3300050507 Bacteria 2379
434 nmdc:mga05p37_383108_c1 3300050507 Bacteria 1647
435 nmdc:mga05p37_405153_c1 3300050507 Bacteria 1591
436 nmdc:mga09592_360218_c1 3300050508 Bacteria 1259
437 nmdc:mga09592_379506_c1 3300050508 Bacteria 1222
438 nmdc:mga09592_55349_c1 3300050508 Bacteria 3352
439 nmdc:mga0qj67_201912_c1 3300050509 Unclassified 1615
440 nmdc:mga0qj67_5159_c1 3300050509 Bacteria 9523
441 nmdc:mga06r32_18511_c1 3300050510 Bacteria 6378
442 nmdc:mga06r32_32635_c1 3300050510 Bacteria 4900
443 nmdc:mga06r32_411602_c1 3300050510 Unclassified 1334
444 nmdc:mga06r32_427908_c1 3300050510 Bacteria 1305
445 nmdc:mga06r32_66587_c1 3300050510 Bacteria 3476
446 nmdc:mga08y16_119157_c1 3300050511 Bacteria 2747
447 nmdc:mga08y16_240601_c1 3300050511 Bacteria 1871
448 nmdc:mga08y16_326926_c1 3300050511 Bacteria 1578
449 nmdc:mga08y16_41886_c1 3300050511 Unclassified 4796
450 nmdc:mga0n895_18218_c1 3300050512 Bacteria 6493
451 nmdc:mga0n895_227607_c1 3300050512 Bacteria 1893
452 nmdc:mga0rr50_235384_c1 3300050513 Bacteria 1516
453 nmdc:mga08x19_11551_c1 3300050514 Bacteria 5315
454 nmdc:mga08x19_17336_c1 3300050514 Bacteria 4405
455 nmdc:mga08x19_52993_c1 3300050514 Bacteria 2610
456 nmdc:mga08x19_7632_c1 3300050514 Bacteria 6426
457 nmdc:mga0a205_19133_c1 3300050515 Bacteria 6454
458 nmdc:mga0a205_235020_c1 3300050515 Bacteria 1715
459 nmdc:mga0a205_294110_c1 3300050515 Unclassified 1498
460 nmdc:mga0a205_30321_c1 3300050515 Bacteria 5177
461 nmdc:mga0a205_30897_c1 3300050515 Bacteria 5130
462 Ga0075436_100031336
463 MBSR1b_contig_12265562
464 Ga0065712_10150755
465 Ga0070658_10133435
466 Ga0070676_10008846
467 Ga0070676_10222833
468 Ga0070683_100004536
469 Ga0070683_100026660
470 Ga0070683_100027586
471 Ga0070683_100028636
472 Ga0070683_100053305
473 Ga0070683_100064273
474 Ga0070683_100302806
475 Ga0070690_100158802
476 Ga0070670_100000545
477 Ga0070670_100033260
478 Ga0070670_100042814
479 Ga0070670_100080293
480 Ga0068869_100017488
481 Ga0070680_100000413
482 Ga0070680_100008389
483 Ga0070680_100039252
484 Ga0070680_100083685
485 Ga0070680_100122418
486 Ga0070682_100000655
487 Ga0070682_100001112
488 Ga0070682_100019671
489 Ga0068868_100019481
490 Ga0068868_100182700
491 Ga0070660_100008102
492 Ga0070660_100269649
493 Ga0070687_100002158
494 Ga0070687_100022011
495 Ga0070687_100027584
496 Ga0070661_100016674
497 Ga0070661_100052732
498 Ga0070692_10012466
499 Ga0070668_100021279
500 Ga0070669_100001234
501 Ga0070669_100015837
502 Ga0070675_100003108
503 Ga0070675_100064545
504 Ga0070675_100119186
505 Ga0070671_100037834
506 Ga0070671_100064183
507 Ga0070674_100072747
508 Ga0070674_100179179
509 Ga0070674_100180377
510 Ga0070673_100031553
511 Ga0070673_100065297
512 Ga0070673_100150447
513 Ga0070659_100023366
514 Ga0070659_100053184
515 Ga0070659_100073483
516 Ga0070659_100205129
517 Ga0070703_10000423
518 Ga0070714_100015828
519 Ga0070714_100042672
520 Ga0070710_10033292
521 Ga0070711_100000239
522 Ga0070711_100048333
523 Ga0070694_100035544
524 Ga0070694_100052421
525 Ga0070708_100000261
526 Ga0070662_100000290
527 Ga0070662_100009719
528 Ga0070662_100043098
529 Ga0070681_10001154
530 Ga0070681_10002136
531 Ga0070681_10004456
532 Ga0070681_10004971
533 Ga0068867_100038533
534 Ga0068867_100147731
535 Ga0068867_100202036
536 Ga0070685_10029681
537 Ga0070685_10037551
538 Ga0070706_100013324
539 Ga0070706_100056926
540 Ga0070706_100156596
541 Ga0070707_100000813
542 Ga0070707_100051348
543 Ga0070699_100022813
544 Ga0070699_100179193
545 Ga0070679_100000423
546 Ga0070679_100003067
547 Ga0070679_100006247
548 Ga0070679_100032685
549 Ga0070679_100054809
550 Ga0070679_100063129
551 Ga0070679_100384104
552 Ga0070684_100000729
553 Ga0070684_100042509
554 Ga0070684_100049517
555 Ga0070684_100084008
556 Ga0070684_100144265
557 Ga0070697_100017320
558 Ga0070697_100397837
559 Ga0068853_100017151
560 Ga0070672_100003250
561 Ga0070672_100015031
562 Ga0070672_100128031
563 Ga0070672_100174033
564 Ga0070686_100009706
565 Ga0070695_100002535
566 Ga0070696_100069315
567 Ga0070693_100002382
568 Ga0070665_100098109
569 Ga0068855_100039363
570 Ga0068855_100048407
571 Ga0068855_100048472
572 Ga0068855_100076007
573 Ga0068855_100456045
574 Ga0070664_100024103
575 Ga0070664_100038536
576 Ga0070664_100121186
577 Ga0070664_100194206
578 Ga0070664_100397682
579 Ga0068857_100013541
580 Ga0068857_100014727
581 Ga0068854_100125145
582 Ga0068854_100350396
583 Ga0068852_100002728
584 Ga0068852_100142817
585 Ga0068859_100048664
586 Ga0068859_100240263
587 Ga0068864_100013582
588 Ga0068866_10008808
589 Ga0068861_100000364
590 Ga0068863_100008379
591 Ga0068858_100011442
592 Ga0068858_100416807
593 Ga0068862_100000406
594 Ga0081455_10004264
595 Ga0081538_10002054
596 Ga0081540_1007563
597 Ga0081539_10026845
598 Ga0081539_10072556
599 Ga0070717_10084976
600 Ga0070716_100003220
601 Ga0097621_100225574
602 Ga0075428_100000932
603 Ga0075428_100054324
604 Ga0075428_100164836
605 Ga0075428_100339399
606 Ga0075430_100003406
607 Ga0075430_100117667
608 Ga0075431_100010366
609 Ga0075431_100097434
610 Ga0075431_100135488
611 Ga0075431_100295909
612 Ga0075433_10035911
613 Ga0075433_10044264
614 Ga0075433_10052902
615 Ga0075434_100015473
616 Ga0075434_100022522
617 Ga0075434_100059289
618 Ga0075434_100105229
619 Ga0075429_100066936
620 Ga0075429_100078705
621 Ga0075429_100121187
622 Ga0075429_100233498
623 Ga0075429_100268734
624 Ga0068865_100008660
625 Ga0068865_100024928
626 Ga0097620_100048664
627 Ga0097620_100240274
628 Ga0075435_100104454
629 Ga0075435_100147085
630 Ga0099795_10037605
631 Ga0105240_10026291
632 Ga0105240_10132012
633 Ga0105240_10368828
634 Ga0111539_10028853
635 Ga0111539_10092205
636 Ga0111539_10110814
637 Ga0111539_10364079
638 Ga0105245_10029694
639 Ga0105245_10116354
640 Ga0114129_10008250
641 Ga0114129_10011116
642 Ga0114129_10128835
643 Ga0114129_10444489
644 Ga0114129_10461663
645 Ga0105242_10245142
646 Ga0105248_10370784
647 Ga0105248_10448117
648 Ga0105237_10153048
649 Ga0105238_10050827
650 Ga0105249_10000083
651 Ga0105239_10017496
652 Ga0157371_10008971
653 Ga0157371_10051670
654 Ga0157370_10022984
655 Ga0157370_10097794
656 Ga0157369_10041000
657 Ga0157369_10115377
658 Ga0157374_10069562
659 Ga0157374_10201795
660 Ga0157378_10006972
661 Ga0157378_10027319
662 Ga0163162_10158887
663 Ga0157372_10009203
664 Ga0157372_10026323
665 Ga0157372_10030873
666 Ga0157372_10079616
667 Ga0157375_10113631
668 Ga0163163_10021610
669 Ga0157380_10001393
670 Ga0157380_10062321
671 Ga0157380_10098992
672 Ga0182008_10003787
673 Ga0157377_10013623
674 Ga0157377_10038138
675 Ga0157377_10160681
676 Ga0157379_10025524
677 Ga0206354_10837383
678 Ga0213876_10016566
679 Ga0213876_10084022
680 Ga0207697_10004118
681 Ga0207653_10000053
682 Ga0207642_10012643
683 Ga0207647_10050260
684 Ga0207699_10003925
685 Ga0207645_10000052
686 Ga0207643_10001974
687 Ga0207643_10018563
688 Ga0207705_10030528
689 Ga0207705_10034211
690 Ga0207684_10007456
691 Ga0207684_10117027
692 Ga0207654_10200365
693 Ga0207707_10001107
694 Ga0207707_10004933
695 Ga0207707_10005921
696 Ga0207707_10134283
697 Ga0207707_10171253
698 Ga0207695_10007320
699 Ga0207695_10018641
700 Ga0207695_10134504
701 Ga0207671_10114139
702 Ga0207663_10000256
703 Ga0207660_10002968
704 Ga0207660_10033171
705 Ga0207660_10041527
706 Ga0207660_10043865
707 Ga0207660_10065041
708 Ga0207660_10071599
709 Ga0207660_10382415
710 Ga0207662_10003325
711 Ga0207662_10009112
712 Ga0207662_10022065
713 Ga0207657_10003617
714 Ga0207657_10263272
715 Ga0207657_10376135
716 Ga0207649_10027031
717 Ga0207649_10034788
718 Ga0207649_10056217
719 Ga0207649_10056551
720 Ga0207649_10082290
721 Ga0207649_10324427
722 Ga0207652_10004328
723 Ga0207652_10004463
724 Ga0207652_10005147
725 Ga0207652_10058004
726 Ga0207652_10086126
727 Ga0207652_10100691
728 Ga0207652_10442984
729 Ga0207646_10002922
730 Ga0207681_10001627
731 Ga0207694_10014098
732 Ga0207650_10007944
733 Ga0207650_10048110
734 Ga0207650_10111323
735 Ga0207650_10195905
736 Ga0207659_10006142
737 Ga0207687_10026705
738 Ga0207687_10059964
739 Ga0207644_10048104
740 Ga0207690_10010964
741 Ga0207690_10022913
742 Ga0207690_10061101
743 Ga0207706_10000217
744 Ga0207706_10027208
745 Ga0207670_10057353
746 Ga0207669_10055353
747 Ga0207669_10161297
748 Ga0207669_10215861
749 Ga0207669_10278438
750 Ga0207704_10020819
751 Ga0207704_10116358
752 Ga0207665_10019134
753 Ga0207665_10069886
754 Ga0207691_10000474
755 Ga0207691_10007594
756 Ga0207691_10010708
757 Ga0207691_10020828
758 Ga0207691_10102628
759 Ga0207691_10174066
760 Ga0207711_10217237
761 Ga0207689_10001625
762 Ga0207689_10031812
763 Ga0207689_10237952
764 Ga0207661_10003185
765 Ga0207661_10008342
766 Ga0207661_10054501
767 Ga0207661_10085403
768 Ga0207679_10005301
769 Ga0207679_10014453
770 Ga0207679_10025901
771 Ga0207679_10061088
772 Ga0207679_10089296
773 Ga0207679_10145572
774 Ga0207667_10115766
775 Ga0207667_10244312
776 Ga0207651_10056700
777 Ga0207651_10188819
778 Ga0207712_10002947
779 Ga0207712_10076547
780 Ga0207668_10284130
781 Ga0207640_10078170
782 Ga0207640_10119160
783 Ga0207640_10170144
784 Ga0207640_10180679
785 Ga0207640_10248596
786 Ga0207658_10159421
787 Ga0207677_10030067
788 Ga0207639_10485622
789 Ga0207678_10001306
790 Ga0207678_10079114
791 Ga0207708_10007482
792 Ga0207708_10052494
793 Ga0207708_10101881
794 Ga0207702_10432744
795 Ga0207641_10126368
796 Ga0207648_10003278
797 Ga0207648_10084499
798 Ga0207648_10161455
799 Ga0207648_10274364
800 Ga0207676_10017723
801 Ga0207674_10000677
802 Ga0207674_10001464
803 Ga0207674_10019869
804 Ga0207674_10033488
805 Ga0207674_10108584
806 Ga0207674_10245316
807 Ga0207675_100000102
808 Ga0207675_100169053
809 Ga0207683_10274535
810 Ga0207698_10041769
811 Ga0207698_10124737
812 Ga0207698_10128692
813 Ga0209981_1006412
814 Ga0209996_1009871
815 Ga0207428_10071721
816 Ga0207428_10144153
817 Ga0268266_10014920
818 Ga0268265_10003698
819 Ga0307408_100009986
820 Ga0307408_100027808
821 Ga0307408_100128353
822 Ga0307408_100352512
823 Ga0307405_10000062
824 Ga0307405_10001601
825 Ga0307405_10001880
826 Ga0307405_10051674
827 Ga0307413_10003220
828 Ga0307413_10007509
829 Ga0307413_10008858
830 Ga0307413_10019451
831 Ga0307410_10000793
832 Ga0307410_10000973
833 Ga0307410_10131561
834 Ga0307406_10002343
835 Ga0307406_10017138
836 Ga0307406_10028824
837 Ga0307407_10001168
838 Ga0307407_10015763
839 Ga0307407_10022192
840 Ga0307407_10057284
841 Ga0307412_10003741
842 Ga0307412_10010704
843 Ga0307412_10095237
844 Ga0307409_100001690
845 Ga0307409_100002521
846 Ga0307409_100019420
847 Ga0307409_100036222
848 Ga0307409_100070624
849 Ga0307409_100086140
850 Ga0307409_100166113
851 Ga0307416_100009255
852 Ga0307416_100009443
853 Ga0307416_100031332
854 Ga0307416_100220322
855 Ga0307416_100325687
856 Ga0307414_10034573
857 Ga0307414_10094497
858 Ga0307411_10000346
859 Ga0307411_10001106
860 Ga0307411_10006393
861 Ga0307411_10073449
862 Ga0307415_100002393
863 Ga0307415_100004596
864 Ga0307415_100042323
865 Ga0307415_100180126
866 Ga0373959_0024107
867 Ga0373940_0053625
868 Ga0373944_0008191
869 Ga0373939_0039636
870 Ga0373941_0021109
871 Ga0373960_0006746
872 Ga0373943_0075715
873 Ga0373942_0010818
874 Ga0373935_0117424
875 Ga0395899_0007032
876 Ga0395900_0014419
877 Ga0395898_0122306
878 Ga0395905_0058437
879 Ga0395901_0001422
880 Ga0436365_1090454
881 Ga0451577_0059428
882 Ga0451577_0223972
883 Ga0451576_0025189
884 Ga0495629_0012974
885 Ga0495582_0011559
886 Ga0495582_0117220
887 Ga0495665_0095289
888 Ga0495647_0074815
889 Ga0495669_0036722
890 Ga0496108_0063131
891 Ga0496109_0064222
892 Ga0496112_0010076
893 Ga0496112_0073657
894 nmdc:mga05p37_206076_c1
895 nmdc:mga05p37_383108_c1
896 nmdc:mga05p37_405153_c1
897 nmdc:mga09592_360218_c1
898 nmdc:mga09592_379506_c1
899 nmdc:mga09592_55349_c1
900 nmdc:mga0qj67_201912_c1
901 nmdc:mga0qj67_5159_c1
902 nmdc:mga06r32_18511_c1
903 nmdc:mga06r32_32635_c1
904 nmdc:mga06r32_411602_c1
905 nmdc:mga06r32_427908_c1
906 nmdc:mga06r32_66587_c1
907 nmdc:mga08y16_119157_c1
908 nmdc:mga08y16_240601_c1
909 nmdc:mga08y16_326926_c1
910 nmdc:mga08y16_41886_c1
911 nmdc:mga0n895_18218_c1
912 nmdc:mga0n895_227607_c1
913 nmdc:mga0rr50_235384_c1
914 nmdc:mga08x19_11551_c1
915 nmdc:mga08x19_17336_c1
916 nmdc:mga08x19_52993_c1
917 nmdc:mga08x19_7632_c1
918 nmdc:mga0a205_19133_c1
919 nmdc:mga0a205_235020_c1
920 nmdc:mga0a205_294110_c1
921 nmdc:mga0a205_30321_c1
922 nmdc:mga0a205_30897_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07479

NAD_Gly3P_dh_C

NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus

181

322

0.99

PF01210

NAD_Gly3P_dh_N

NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus

3

162

0.98

PF02558

ApbA

Ketopantoate reductase PanE/ApbA

4

138

0.89

PF20618

GPD_NAD_C_bact

Bacterial GPD, NAD-dependent C-terminal

241

307

0.89

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

3

109

0.88

PF03435

Sacchrp_dh_NADP

Saccharopine dehydrogenase NADP binding domain

4

115

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3if9-assembly2.cif.gz_D-3 crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate 0.9921 3 31
7bkd-assembly1.cif.gz_a formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (heterodislfide reductase core and mobile arm in conformational state 1, composite structure) 0.978 2 33
3k96-assembly1.cif.gz_B 2.1 angstrom resolution crystal structure of glycerol-3-phosphate dehydrogenase (gpsa) from coxiella burnetii 0.9743 2 323
2qcu-assembly1.cif.gz_A crystal structure of glycerol-3-phosphate dehydrogenase from escherichia coli 0.9742 2 32
3dme-assembly1.cif.gz_B crystal structure of conserved exported protein from bordetella pertussis. northeast structural genomics target ber141 0.9741 1 29
ID Description Score Start End Superfamily
3k96B02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9824 186 323 1.10.1040.10
af_Q2FYG1_190_332_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9789 186 328 1.10.1040.10
af_P9WN75_188_329_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9787 182 322 1.10.1040.10
af_A4HUG3_209_357_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9763 186 328 1.10.1040.10
3k96B02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9755 186 323 1.10.1040.10
ID Description Score Start End GO Terms
AF-A0A532EH12-F1-model_v4 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase (EC 1.1.1.94) 0.9953 175 321 GO:0005829
GO:0005975
GO:0006072
GO:0006116
GO:0008654
GO:0047952
AF-A0A2V7KKN8-F1-model_v4 Glycerol-3-phosphate dehydrogenase 0.9951 175 321 GO:0005829
GO:0005975
GO:0006072
GO:0008654
GO:0047952
AF-A0A524KHI2-F1-model_v4 Glycerol-3-phosphate dehydrogenase (EC 1.1.1.94) 0.9922 3 276 GO:0005829
GO:0005975
GO:0008654
GO:0046168
GO:0047952
GO:0051287
AF-A0A2V7UGC2-F1-model_v4 Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94) (NAD(P)(+)-dependent glycerol-3-phosphate dehydrogenase) (NAD(P)H-dependent dihydroxyacetone-phosphate reductase) 0.9921 1 328 GO:0005829
GO:0005975
GO:0006650
GO:0008654
GO:0046167
GO:0046168
GO:0047952
GO:0051287
AF-A0A2V9MQT2-F1-model_v4 Glycerol-3-phosphate dehydrogenase (EC 1.1.1.94) 0.9907 101 328 GO:0005829
GO:0005975
GO:0008654
GO:0046168
GO:0047952
GO:0051287

Map