F448677

General Info

Members Datasets Scaffolds Average Seq Length
461 233 455 219

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100068839|Ga0070670_1000688393
Length 260
Sequence MSQTYKVSRAASSVANLVGLVLTTFVLFKIYNSNIRLLTRKERFDFVIKYFQQHAPDAETELLYDNPFQLLVAVILSAQCTDKRVNMTTPAIFDKYPDAESLSKATFEELFPLVKSISYPNNKTKHLIGMAKMLVSDFKGQIPMTVEDLVKLPGVGRKTANVITSVIDEQPNMAVDTHVFRVAARIGLTVNAKTPLATEKQLIQLIPTELIHKAHHWLILHGRYICVARNPKCAQCGLKPVCKYYQKNILSRTLVSPINE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
4 2818991444 Filimonas endophytica 3197 Isolate Unclassified
5 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
6 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
7 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
158 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
159 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
160 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
161 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
162 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
163 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
164 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
165 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
166 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
167 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
223 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
224 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
225 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
226 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
227 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
228 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
229 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
230 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
231 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 0
Isolates 1.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.86
Nodule 0
Rhizoplane 2.17
Rhizosphere 89.37
Stem 0
Stem Tuber 0
Unclassified 2.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2847592 2162886007 Bacteria 1363
2 rootL2_10044612 3300003322 Bacteria 2494
3 rootL2_10199477 3300003322 Bacteria 2418
4 rootL2_10273467 3300003322 Bacteria 1891
5 rootH1_10066352 3300003323 Bacteria 3940
6 rootH1_10090583 3300003323 Bacteria 1145
7 Ga0065165_1011759 3300005262 Bacteria 3613
8 Ga0065704_10082877 3300005289 Bacteria 3540
9 Ga0065707_10174190 3300005295 Unclassified 1462
10 Ga0070658_10007651 3300005327 Bacteria 8711
11 Ga0070676_10005937 3300005328 Bacteria 6515
12 Ga0070676_10240526 3300005328 Bacteria 1204
13 Ga0070690_100013006 3300005330 Unclassified 4908
14 Ga0070670_100068839 3300005331 Bacteria 3038
15 Ga0070670_100114351 3300005331 Bacteria 2327
16 Ga0070677_10140414 3300005333 Unclassified 1113
17 Ga0068869_100061471 3300005334 Bacteria 2755
18 Ga0068869_100074242 3300005334 Unclassified 2524
19 Ga0068869_100127623 3300005334 Bacteria 1952
20 Ga0068869_100144482 3300005334 Unclassified 1840
21 Ga0068869_100209532 3300005334 Bacteria 1540
22 Ga0068869_100587806 3300005334 Bacteria 939
23 Ga0070666_10000072 3300005335 Bacteria 75356
24 Ga0070666_10008467 3300005335 Bacteria 6389
25 Ga0068868_100001449 3300005338 Bacteria 16363
26 Ga0068868_100016699 3300005338 Bacteria 5458
27 Ga0068868_100039206 3300005338 Bacteria 3680
28 Ga0068868_100079595 3300005338 Bacteria 2625
29 Ga0070660_100475713 3300005339 Bacteria 1038
30 Ga0070689_100093985 3300005340 Bacteria 2367
31 Ga0070689_100197402 3300005340 Unclassified 1641
32 Ga0070691_10025176 3300005341 Bacteria 2770
33 Ga0070661_100479198 3300005344 Bacteria 993
34 Ga0070668_100003854 3300005347 Bacteria 11069
35 Ga0070669_100241758 3300005353 Bacteria 1434
36 Ga0070675_100282146 3300005354 Bacteria 1460
37 Ga0070671_100043535 3300005355 Bacteria 3730
38 Ga0070671_100056934 3300005355 Bacteria 3253
39 Ga0070671_100122062 3300005355 Bacteria 2193
40 Ga0070671_100893274 3300005355 Bacteria 776
41 Ga0070674_100080251 3300005356 Unclassified 2329
42 Ga0070673_100004768 3300005364 Bacteria 8614
43 Ga0070673_100008243 3300005364 Bacteria 6918
44 Ga0070667_100000867 3300005367 Bacteria 28069
45 Ga0070667_100023752 3300005367 Bacteria 5089
46 Ga0070667_100048286 3300005367 Bacteria 3582
47 Ga0070667_100179831 3300005367 Unclassified 1870
48 Ga0070667_100467321 3300005367 Bacteria 1154
49 Ga0070714_100428979 3300005435 Bacteria 1253
50 Ga0070700_100466398 3300005441 Bacteria 964
51 Ga0070694_100284285 3300005444 Bacteria 1262
52 Ga0070678_100003213 3300005456 Bacteria 9070
53 Ga0070662_100001674 3300005457 Bacteria 13637
54 Ga0070662_100018997 3300005457 Bacteria 4659
55 Ga0070681_10207207 3300005458 Bacteria 1877
56 Ga0068867_100013731 3300005459 Bacteria 5736
57 Ga0068867_100075189 3300005459 Bacteria 2533
58 Ga0068867_100269568 3300005459 Bacteria 1391
59 Ga0068867_100546516 3300005459 Unclassified 1003
60 Ga0068867_100658664 3300005459 Bacteria 919
61 Ga0070685_10270097 3300005466 Bacteria 1134
62 Ga0070699_100839388 3300005518 Bacteria 841
63 Ga0070697_100415146 3300005536 Bacteria 1169
64 Ga0068853_100002148 3300005539 Bacteria 14676
65 Ga0068853_100039459 3300005539 Bacteria 4027
66 Ga0068853_100086389 3300005539 Bacteria 2751
67 Ga0068853_100130204 3300005539 Bacteria 2252
68 Ga0068853_100316086 3300005539 Bacteria 1447
69 Ga0068853_100351567 3300005539 Unclassified 1371
70 Ga0068853_100529033 3300005539 Bacteria 1115
71 Ga0070672_100220697 3300005543 Bacteria 1590
72 Ga0070695_100271599 3300005545 Bacteria 1242
73 Ga0070693_100021776 3300005547 Bacteria 3400
74 Ga0070665_100000318 3300005548 Bacteria 74326
75 Ga0070704_100635467 3300005549 Bacteria 941
76 Ga0068855_100011556 3300005563 Bacteria 10663
77 Ga0068855_100150691 3300005563 Bacteria 2645
78 Ga0068855_100310700 3300005563 Unclassified 1744
79 Ga0070664_100151480 3300005564 Unclassified 2048
80 Ga0068857_100084601 3300005577 Bacteria 2835
81 Ga0068857_100092087 3300005577 Bacteria 2714
82 Ga0068857_100216505 3300005577 Bacteria 1749
83 Ga0068854_100415318 3300005578 Unclassified 1116
84 Ga0068856_100050780 3300005614 Bacteria 4089
85 Ga0068856_100132089 3300005614 Bacteria 2502
86 Ga0068852_100001821 3300005616 Bacteria 14493
87 Ga0068852_100011011 3300005616 Bacteria 6786
88 Ga0068852_100016882 3300005616 Bacteria 5710
89 Ga0068852_100109976 3300005616 Bacteria 2503
90 Ga0068859_100000006 3300005617 Bacteria 421509
91 Ga0068859_100000639 3300005617 Bacteria 34980
92 Ga0068859_100029899 3300005617 Bacteria 5465
93 Ga0068859_100032162 3300005617 Bacteria 5270
94 Ga0068859_100459515 3300005617 Bacteria 1369
95 Ga0068859_100772708 3300005617 Unclassified 1049
96 Ga0068864_100003890 3300005618 Bacteria 12297
97 Ga0068864_100451284 3300005618 Bacteria 1230
98 Ga0068864_100676182 3300005618 Bacteria 1007
99 Ga0068866_10013183 3300005718 Bacteria 3619
100 Ga0068866_10050332 3300005718 Bacteria 2115
101 Ga0068851_10001667 3300005834 Bacteria 9732
102 Ga0068851_10099183 3300005834 Bacteria 1543
103 Ga0068870_10001518 3300005840 Bacteria 9418
104 Ga0068863_100006901 3300005841 Bacteria 11127
105 Ga0068863_100010664 3300005841 Bacteria 8921
106 Ga0068863_100036982 3300005841 Bacteria 4648
107 Ga0068858_100000978 3300005842 Bacteria 29516
108 Ga0068858_100006220 3300005842 Bacteria 11634
109 Ga0068858_101122241 3300005842 Bacteria 772
110 Ga0068860_100001713 3300005843 Bacteria 23427
111 Ga0068860_100001937 3300005843 Bacteria 21898
112 Ga0068860_100006239 3300005843 Bacteria 11978
113 Ga0068860_100013129 3300005843 Bacteria 8128
114 Ga0068860_100199227 3300005843 Bacteria 1940
115 Ga0068862_100005509 3300005844 Bacteria 10574
116 Ga0068862_100292532 3300005844 Bacteria 1496
117 Ga0068862_100364619 3300005844 Unclassified 1343
118 Ga0068862_100560531 3300005844 Bacteria 1092
119 Ga0075366_10003065 3300006195 Bacteria 8726
120 Ga0075366_10019693 3300006195 Bacteria 3909
121 Ga0075366_10051152 3300006195 Bacteria 2455
122 Ga0097621_100004096 3300006237 Bacteria 10111
123 Ga0097621_100009570 3300006237 Bacteria 7042
124 Ga0097621_100023550 3300006237 Bacteria 4795
125 Ga0097621_100071290 3300006237 Bacteria 2871
126 Ga0097621_100306998 3300006237 Unclassified 1403
127 Ga0068871_100019230 3300006358 Bacteria 5213
128 Ga0068871_100019320 3300006358 Bacteria 5201
129 Ga0068871_100039691 3300006358 Bacteria 3768
130 Ga0068871_100042294 3300006358 Bacteria 3657
131 Ga0068871_100051578 3300006358 Bacteria 3331
132 Ga0068871_100060808 3300006358 Bacteria 3082
133 Ga0068871_100163564 3300006358 Bacteria 1904
134 Ga0068871_100174141 3300006358 Bacteria 1846
135 Ga0075428_100027400 3300006844 Bacteria 6305
136 Ga0075430_100008093 3300006846 Bacteria 8885
137 Ga0075433_10525057 3300006852 Bacteria 1041
138 Ga0075429_100023176 3300006880 Bacteria 5384
139 Ga0068865_100027002 3300006881 Bacteria 3789
140 Ga0097620_100000006 3300006931 Bacteria 421509
141 Ga0097620_100000639 3300006931 Bacteria 34980
142 Ga0097620_100029900 3300006931 Bacteria 5465
143 Ga0097620_100032162 3300006931 Bacteria 5270
144 Ga0097620_100459476 3300006931 Bacteria 1369
145 Ga0097620_100772564 3300006931 Unclassified 1049
146 Ga0105240_10009898 3300009093 Bacteria 13445
147 Ga0105240_10012427 3300009093 Bacteria 11755
148 Ga0105240_10122293 3300009093 Bacteria 3132
149 Ga0105240_10280091 3300009093 Unclassified 1916
150 Ga0105240_10551128 3300009093 Bacteria 1276
151 Ga0111539_10002209 3300009094 Bacteria 25989
152 Ga0111539_11350976 3300009094 Unclassified 827
153 Ga0105245_10055008 3300009098 Bacteria 3574
154 Ga0105247_10018426 3300009101 Bacteria 4187
155 Ga0105247_10117808 3300009101 Unclassified 1717
156 Ga0105247_10280921 3300009101 Bacteria 1148
157 Ga0114129_10002294 3300009147 Bacteria 26500
158 Ga0105243_10052841 3300009148 Bacteria 3220
159 Ga0105243_10146175 3300009148 Bacteria 2023
160 Ga0105241_10070906 3300009174 Bacteria 2704
161 Ga0105241_10200256 3300009174 Unclassified 1667
162 Ga0105241_10241324 3300009174 Bacteria 1528
163 Ga0105242_10028526 3300009176 Bacteria 4446
164 Ga0105248_10052386 3300009177 Bacteria 4579
165 Ga0105237_10006111 3300009545 Bacteria 13458
166 Ga0105237_10079417 3300009545 Bacteria 3271
167 Ga0105237_10364019 3300009545 Bacteria 1450
168 Ga0105249_10002054 3300009553 Bacteria 17468
169 Ga0105249_10080242 3300009553 Bacteria 3030
170 Ga0105239_10011078 3300010375 Bacteria 10065
171 Ga0105239_10216708 3300010375 Bacteria 2146
172 Ga0105239_10490318 3300010375 Unclassified 1396
173 Ga0105246_10030336 3300011119 Bacteria 3570
174 Ga0105246_10109745 3300011119 Bacteria 2025
175 Ga0105246_10381805 3300011119 Bacteria 1164
176 Ga0157373_10230577 3300013100 Bacteria 1307
177 Ga0157370_10006044 3300013104 Bacteria 13457
178 Ga0157370_10314558 3300013104 Bacteria 1445
179 Ga0157370_10475564 3300013104 Bacteria 1148
180 Ga0157369_10077077 3300013105 Bacteria 3573
181 Ga0157369_10086180 3300013105 Bacteria 3355
182 Ga0157369_10169095 3300013105 Bacteria 2304
183 Ga0157374_10003691 3300013296 Bacteria 12871
184 Ga0157374_10031458 3300013296 Bacteria 4824
185 Ga0157374_10057888 3300013296 Bacteria 3621
186 Ga0157378_10002733 3300013297 Bacteria 15712
187 Ga0157378_10023109 3300013297 Bacteria 5472
188 Ga0157378_10108408 3300013297 Unclassified 2543
189 Ga0163162_10000112 3300013306 Bacteria 72032
190 Ga0163162_10001176 3300013306 Bacteria 24432
191 Ga0163162_10006924 3300013306 Bacteria 10993
192 Ga0163162_10052907 3300013306 Unclassified 4080
193 Ga0163162_10064335 3300013306 Bacteria 3713
194 Ga0163162_10224914 3300013306 Bacteria 2006
195 Ga0157372_10027137 3300013307 Bacteria 6233
196 Ga0157372_10092120 3300013307 Unclassified 3447
197 Ga0157372_10150748 3300013307 Bacteria 2684
198 Ga0157372_10317557 3300013307 Unclassified 1814
199 Ga0157372_10374573 3300013307 Unclassified 1659
200 Ga0157375_10016783 3300013308 Bacteria 6591
201 Ga0157375_10022627 3300013308 Bacteria 5787
202 Ga0157375_10024940 3300013308 Bacteria 5544
203 Ga0163163_10012397 3300014325 Bacteria 7765
204 Ga0163163_10034704 3300014325 Bacteria 4888
205 Ga0163163_10054751 3300014325 Bacteria 3942
206 Ga0163163_10182292 3300014325 Unclassified 2147
207 Ga0157380_10000895 3300014326 Bacteria 18734
208 Ga0157380_10205753 3300014326 Bacteria 1750
209 Ga0157377_10000392 3300014745 Bacteria 18955
210 Ga0157379_10011542 3300014968 Bacteria 7709
211 Ga0157379_10068244 3300014968 Bacteria 3179
212 Ga0157376_10027800 3300014969 Bacteria 4489
213 Ga0157376_10068212 3300014969 Bacteria 3011
214 Ga0157376_10104272 3300014969 Bacteria 2485
215 Ga0157376_10633102 3300014969 Bacteria 1068
216 Ga0157376_11572797 3300014969 Bacteria 691
217 Ga0163161_10021837 3300017792 Bacteria 4501
218 Ga0209436_101389 3300025208 Bacteria 8545
219 Ga0207426_1016646 3300025302 Bacteria 2633
220 Ga0207697_10044047 3300025315 Bacteria 1835
221 Ga0207697_10050852 3300025315 Unclassified 1711
222 Ga0207656_10012972 3300025321 Bacteria 3174
223 Ga0207656_10211308 3300025321 Unclassified 940
224 Ga0207682_10104654 3300025893 Unclassified 1240
225 Ga0207642_10093585 3300025899 Bacteria 1491
226 Ga0207710_10017476 3300025900 Bacteria 3042
227 Ga0207680_10000137 3300025903 Bacteria 34668
228 Ga0207680_10076489 3300025903 Bacteria 2090
229 Ga0207647_10000292 3300025904 Bacteria 41200
230 Ga0207645_10002213 3300025907 Bacteria 15508
231 Ga0207645_10022793 3300025907 Bacteria 4071
232 Ga0207705_10005337 3300025909 Bacteria 9612
233 Ga0207654_10001678 3300025911 Bacteria 11582
234 Ga0207654_10253655 3300025911 Unclassified 1180
235 Ga0207707_10075212 3300025912 Bacteria 2946
236 Ga0207695_10041263 3300025913 Bacteria 4940
237 Ga0207695_10097479 3300025913 Bacteria 2941
238 Ga0207671_10000453 3300025914 Bacteria 56447
239 Ga0207671_10047265 3300025914 Bacteria 3185
240 Ga0207660_10043753 3300025917 Bacteria 3147
241 Ga0207657_10382549 3300025919 Bacteria 1108
242 Ga0207652_10278741 3300025921 Bacteria 1508
243 Ga0207681_10009948 3300025923 Bacteria 5821
244 Ga0207681_10472369 3300025923 Unclassified 1023
245 Ga0207650_10017905 3300025925 Bacteria 4964
246 Ga0207659_10004664 3300025926 Bacteria 8302
247 Ga0207659_10791914 3300025926 Bacteria 814
248 Ga0207659_10874914 3300025926 Bacteria 772
249 Ga0207644_10189247 3300025931 Unclassified 1617
250 Ga0207644_10936691 3300025931 Bacteria 726
251 Ga0207706_10013778 3300025933 Bacteria 7337
252 Ga0207706_10058717 3300025933 Unclassified 3388
253 Ga0207686_10025611 3300025934 Unclassified 3433
254 Ga0207686_10033836 3300025934 Bacteria 3053
255 Ga0207686_10068888 3300025934 Bacteria 2268
256 Ga0207670_10014373 3300025936 Bacteria 4698
257 Ga0207670_10165436 3300025936 Unclassified 1655
258 Ga0207670_10413209 3300025936 Bacteria 1081
259 Ga0207669_10013463 3300025937 Bacteria 4064
260 Ga0207704_10040934 3300025938 Bacteria 2713
261 Ga0207704_10051857 3300025938 Bacteria 2484
262 Ga0207704_10127302 3300025938 Unclassified 1756
263 Ga0207691_10122715 3300025940 Bacteria 2300
264 Ga0207691_10387973 3300025940 Bacteria 1192
265 Ga0207711_10095673 3300025941 Unclassified 2620
266 Ga0207689_10002434 3300025942 Bacteria 17330
267 Ga0207689_10024280 3300025942 Bacteria 5087
268 Ga0207689_10048070 3300025942 Bacteria 3520
269 Ga0207689_10099362 3300025942 Unclassified 2391
270 Ga0207689_10179598 3300025942 Unclassified 1745
271 Ga0207689_10433694 3300025942 Bacteria 1097
272 Ga0207679_10194158 3300025945 Unclassified 1690
273 Ga0207667_10004455 3300025949 Bacteria 17147
274 Ga0207651_10016139 3300025960 Bacteria 4364
275 Ga0207651_10590714 3300025960 Bacteria 970
276 Ga0207712_10023039 3300025961 Bacteria 4106
277 Ga0207712_10025776 3300025961 Unclassified 3910
278 Ga0207712_10032445 3300025961 Bacteria 3526
279 Ga0207668_10001230 3300025972 Bacteria 15234
280 Ga0207668_10105393 3300025972 Bacteria 2104
281 Ga0207668_10536713 3300025972 Bacteria 1011
282 Ga0207640_10023604 3300025981 Bacteria 3698
283 Ga0207640_10791883 3300025981 Bacteria 820
284 Ga0207658_10003547 3300025986 Bacteria 11014
285 Ga0207658_10069300 3300025986 Bacteria 2664
286 Ga0207658_10530590 3300025986 Bacteria 1051
287 Ga0207677_10061867 3300026023 Bacteria 2594
288 Ga0207677_10393736 3300026023 Bacteria 1173
289 Ga0207703_10002783 3300026035 Bacteria 14957
290 Ga0207703_10122590 3300026035 Unclassified 2234
291 Ga0207703_10132068 3300026035 Bacteria 2157
292 Ga0207639_10082263 3300026041 Bacteria 2552
293 Ga0207639_10176362 3300026041 Bacteria 1815
294 Ga0207639_10244773 3300026041 Unclassified 1561
295 Ga0207708_10317982 3300026075 Bacteria 1270
296 Ga0207702_10060154 3300026078 Bacteria 3238
297 Ga0207702_11133671 3300026078 Bacteria 776
298 Ga0207641_10000058 3300026088 Bacteria 166385
299 Ga0207641_10013907 3300026088 Bacteria 6601
300 Ga0207641_10024874 3300026088 Bacteria 4936
301 Ga0207648_10000739 3300026089 Bacteria 36659
302 Ga0207648_10002407 3300026089 Bacteria 20149
303 Ga0207648_10003048 3300026089 Bacteria 17709
304 Ga0207648_10066202 3300026089 Bacteria 3151
305 Ga0207676_10003311 3300026095 Bacteria 11435
306 Ga0207676_10023151 3300026095 Bacteria 4577
307 Ga0207676_10311516 3300026095 Bacteria 1441
308 Ga0207674_10011355 3300026116 Bacteria 10012
309 Ga0207674_10079189 3300026116 Bacteria 3291
310 Ga0207674_10292027 3300026116 Unclassified 1579
311 Ga0207674_10901469 3300026116 Bacteria 852
312 Ga0207675_100000610 3300026118 Bacteria 34895
313 Ga0207675_100320235 3300026118 Bacteria 1514
314 Ga0207675_100485277 3300026118 Unclassified 1229
315 Ga0207675_100539587 3300026118 Bacteria 1164
316 Ga0207683_10000651 3300026121 Bacteria 31796
317 Ga0207683_10002030 3300026121 Bacteria 17898
318 Ga0207698_10007968 3300026142 Bacteria 6673
319 Ga0207698_10406739 3300026142 Unclassified 1302
320 Ga0207698_10669540 3300026142 Bacteria 1030
321 Ga0207698_10839355 3300026142 Bacteria 923
322 Ga0207428_10018651 3300027907 Bacteria 5923
323 Ga0268265_10229837 3300028380 Bacteria 1629
324 Ga0268265_10988218 3300028380 Bacteria 831
325 Ga0268264_10000726 3300028381 Bacteria 37807
326 Ga0268264_10001477 3300028381 Bacteria 21934
327 Ga0268264_10010303 3300028381 Bacteria 7735
328 Ga0265327_10023703 3300031251 Bacteria 3626
329 Ga0265327_10043418 3300031251 Bacteria 2405
330 Ga0307513_10114277 3300031456 Bacteria 2685
331 Ga0307407_10162662 3300031903 Unclassified 1462
332 Ga0373933_0246559 3300035724 Unclassified 1150
333 Ga0395900_0935494 3300037418 Bacteria 789
334 Ga0395905_0017395 3300037471 Bacteria 6826
335 Ga0395905_0024815 3300037471 Bacteria 5658
336 Ga0395905_0112692 3300037471 Bacteria 2555
337 Ga0439436_0029013 3300041404 Bacteria 1612
338 Ga0439438_079272 3300041405 Bacteria 807
339 Ga0439439_0004082 3300041406 Bacteria 3263
340 Ga0439439_0009935 3300041406 Bacteria 2269
341 Ga0439439_0016946 3300041406 Bacteria 1788
342 Ga0439439_0051558 3300041406 Bacteria 1079
343 Ga0451791_1704220 3300041451 Bacteria 712
344 Ga0451795_0067844 3300041456 Bacteria 952
345 Ga0451795_0212506 3300041456 Bacteria 1795
346 Ga0451795_1544795 3300041456 Bacteria 995
347 Ga0451802_0344273 3300041460 Bacteria 1558
348 Ga0439442_008229 3300042002 Bacteria 2105
349 Ga0439449_0059056 3300042007 Bacteria 1416
350 Ga0439449_0127764 3300042007 Unclassified 944
351 Ga0439457_074467 3300042014 Bacteria 776
352 Ga0439462_0000682 3300042015 Bacteria 6905
353 Ga0439462_0036986 3300042015 Bacteria 1300
354 Ga0439434_0024776 3300042435 Bacteria 1810
355 Ga0451577_0007475 3300042876 Bacteria 10732
356 Ga0451577_0049539 3300042876 Bacteria 3751
357 Ga0466969_0000730 3300044656 Bacteria 17779
358 Ga0466972_0000082 3300044658 Bacteria 88592
359 Ga0466966_0000501 3300044684 Bacteria 25083
360 Ga0453684_1089952 3300044712 Bacteria 844
361 Ga0466968_0025213 3300044735 Bacteria 2434
362 Ga0466957_0049955 3300044842 Bacteria 2544
363 Ga0466959_0000035 3300045049 Bacteria 108669
364 Ga0451576_0170624 3300045051 Unclassified 2271
365 Ga0466967_0986196 3300045976 Bacteria 839
366 Ga0495638_0061196 3300046460 Unclassified 2327
367 Ga0495582_0033711 3300046473 Bacteria 2816
368 Ga0495645_0114279 3300046543 Bacteria 1908
369 Ga0495667_0277135 3300046559 Unclassified 1065
370 Ga0495668_0003738 3300046616 Bacteria 11178
371 Ga0495658_0086863 3300046683 Unclassified 1846
372 Ga0495670_0355451 3300046691 Bacteria 789
373 Ga0495604_0172278 3300047317 Unclassified 1521
374 Ga0495674_0223893 3300047319 Bacteria 1554
375 Ga0495674_0365214 3300047319 Bacteria 1170
376 Ga0495672_0006400 3300047320 Bacteria 9140
377 Ga0495672_0091934 3300047320 Bacteria 1664
378 Ga0495672_0131251 3300047320 Bacteria 1318
379 Ga0495686_0000005 3300047472 Bacteria 827143
380 Ga0495686_0067420 3300047472 Bacteria 2209
381 Ga0495602_0441782 3300048088 Bacteria 920
382 Ga0496104_0525068 3300048907 Bacteria 1095
383 Ga0496109_0115912 3300048912 Unclassified 2493
384 Ga0496114_0189905 3300048917 Unclassified 1797
385 Ga0496114_0472262 3300048917 Bacteria 1110
386 Ga0496115_0427116 3300048918 Bacteria 1073
387 Ga0496121_0000051 3300048924 Bacteria 315378
388 Ga0501032_0003107 3300049569 Bacteria 12808
389 Ga0501032_0416569 3300049569 Bacteria 862
390 Ga0501033_0066289 3300049570 Bacteria 2655
391 Ga0501034_0001878 3300049571 Bacteria 26626
392 Ga0501034_0007610 3300049571 Bacteria 11525
393 Ga0501034_0343109 3300049571 Bacteria 1423
394 Ga0501034_0686230 3300049571 Bacteria 923
395 Ga0501036_0017507 3300049572 Bacteria 5991
396 Ga0501037_0365516 3300049573 Bacteria 993
397 Ga0501039_0074510 3300049575 Bacteria 2638
398 Ga0501046_0004991 3300049580 Bacteria 11916
399 Ga0501046_0226922 3300049580 Unclassified 1381
400 Ga0501047_0103047 3300049581 Bacteria 2733
401 Ga0501047_0195330 3300049581 Bacteria 1886
402 Ga0501047_0211710 3300049581 Bacteria 1796
403 Ga0501048_0058861 3300049582 Bacteria 2723
404 Ga0501067_0411598 3300049583 Unclassified 754
405 Ga0501069_0346400 3300049585 Bacteria 875
406 Ga0501070_0082346 3300049586 Bacteria 2664
407 Ga0501070_0316636 3300049586 Bacteria 1269
408 Ga0501070_0364563 3300049586 Bacteria 1172
409 Ga0501073_0001997 3300049589 Bacteria 15220
410 Ga0501073_0018164 3300049589 Bacteria 5083
411 Ga0501073_0427359 3300049589 Bacteria 915
412 Ga0501074_0159581 3300049590 Bacteria 1610
413 Ga0501077_0514662 3300049593 Bacteria 768
414 Ga0501219_000084 3300049703 Bacteria 16050
415 Ga0501080_0043755 3300049742 Bacteria 4169
416 Ga0501080_0056266 3300049742 Bacteria 3663
417 Ga0501080_0119080 3300049742 Bacteria 2448
418 Ga0501080_0197815 3300049742 Bacteria 1846
419 Ga0501080_0751624 3300049742 Bacteria 857
420 Ga0501083_0139534 3300049744 Bacteria 1587
421 Ga0501241_002587 3300049758 Bacteria 3485
422 Ga0501044_0064780 3300049823 Bacteria 3729
423 Ga0501044_0260244 3300049823 Bacteria 1673
424 Ga0501044_0399853 3300049823 Bacteria 1286
425 Ga0501284_00017 3300050005 Bacteria 96362
426 nmdc:mga0k408_145079_c1 3300050493 Bacteria 1413
427 nmdc:mga0k408_234817_c1 3300050493 Bacteria 1095
428 nmdc:mga0k408_296440_c1 3300050493 Bacteria 965
429 nmdc:mga0k408_466928_c1 3300050493 Bacteria 749
430 nmdc:mga05p37_30260_c1 3300050507 Bacteria 6605
431 nmdc:mga0qj67_66795_c1 3300050509 Bacteria 2865
432 nmdc:mga06r32_29203_c1 3300050510 Bacteria 5166
433 nmdc:mga08y16_274593_c1 3300050511 Unclassified 1739
434 nmdc:mga08y16_38826_c1 3300050511 Bacteria 4997
435 nmdc:mga0a205_510771_c1 3300050515 Bacteria 1058
436 Ga0500646_0002966 3300053090 Bacteria 4352
437 Ga0500646_0035759 3300053090 Bacteria 1382
438 Ga0500583_0000003 3300053092 Bacteria 229587
439 Ga0500583_0001287 3300053092 Bacteria 7160
440 Ga0500583_0102591 3300053092 Bacteria 1403
441 Ga0500641_0004752 3300053096 Bacteria 4807
442 Ga0500568_0008570 3300053139 Unclassified 4918
443 Ga0500568_0068664 3300053139 Unclassified 1360
444 Ga0500589_007963 3300053147 Bacteria 4378
445 Ga0500604_0011689 3300053151 Bacteria 2362
446 Ga0500604_0120764 3300053151 Bacteria 876
447 Ga0500616_0094598 3300053153 Bacteria 1472
448 Ga0500622_0000340 3300053156 Bacteria 45986
449 Ga0500622_0048090 3300053156 Bacteria 2201
450 Ga0500611_000008 3300053727 Bacteria 198346
451 Ga0500645_012907 3300053730 Bacteria 2692
452 Ga0500645_013380 3300053730 Bacteria 2633
453 Ga0501084_0041221 3300054114 Bacteria 3862
454 Ga0501084_0231815 3300054114 Unclassified 1558
455 Ga0501082_0300674 3300060353 Unclassified 1397

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0986196 Ga0466967_0986196_196_777 189
2 3300045051 Ga0451576_0170624 Ga0451576_0170624_1616_2254 195
3 3300041456 Ga0451795_1544795 Ga0451795_1544795_390_983 196
4 3300031251 Ga0265327_10043418 Ga0265327_100434184 210
5 iso_pu_bacteria 2738541278 2738725659 210
6 iso_pu_bacteria 2818991442 2819577318 210
7 iso_pu_bacteria 2818991444 2819585529 210
8 iso_pu_bacteria 2821136567 2821140621 210
9 iso_pu_bacteria 2896109856 2896115302 210
10 iso_pu_bacteria 2904467357 2904473040 210
11 3300005367 Ga0070667_100179831 Ga0070667_1001798311 212
12 3300005617 Ga0068859_100000639 Ga0068859_1000006399 212
13 3300006195 Ga0075366_10019693 Ga0075366_100196933 212
14 3300006931 Ga0097620_100000639 Ga0097620_1000006399 212
15 3300014969 Ga0157376_11572797 Ga0157376_115727971 212
16 3300041404 Ga0439436_0029013 Ga0439436_0029013_883_1527 212
17 3300041406 Ga0439439_0051558 Ga0439439_0051558_360_1004 212
18 3300042014 Ga0439457_074467 Ga0439457_074467_45_689 212
19 3300042015 Ga0439462_0000682 Ga0439462_0000682_1435_2079 212
20 3300046691 Ga0495670_0355451 Ga0495670_0355451_16_654 212
21 3300050493 nmdc:mga0k408_296440_c1 nmdc:mga0k408_296440_c1_172_813 212
22 3300053096 Ga0500641_0004752 Ga0500641_0004752_2968_3609 212
23 3300003322 rootL2_10199477 rootL2_101994772 213
24 3300005327 Ga0070658_10007651 Ga0070658_100076513 213
25 3300005328 Ga0070676_10005937 Ga0070676_100059371 213
26 3300005334 Ga0068869_100144482 Ga0068869_1001444822 213
27 3300005338 Ga0068868_100001449 Ga0068868_1000014497 213
28 3300005340 Ga0070689_100197402 Ga0070689_1001974022 213
29 3300005344 Ga0070661_100479198 Ga0070661_1004791982 213
30 3300005347 Ga0070668_100003854 Ga0070668_1000038545 213
31 3300005355 Ga0070671_100122062 Ga0070671_1001220621 213
32 3300005364 Ga0070673_100008243 Ga0070673_1000082437 213
33 3300005367 Ga0070667_100000867 Ga0070667_1000008672 213
34 3300005367 Ga0070667_100467321 Ga0070667_1004673211 213
35 3300005457 Ga0070662_100001674 Ga0070662_1000016746 213
36 3300005459 Ga0068867_100075189 Ga0068867_1000751891 213
37 3300005548 Ga0070665_100000318 Ga0070665_10000031865 213
38 3300005563 Ga0068855_100150691 Ga0068855_1001506913 213
39 3300005616 Ga0068852_100011011 Ga0068852_1000110113 213
40 3300005618 Ga0068864_100003890 Ga0068864_1000038906 213
41 3300005834 Ga0068851_10001667 Ga0068851_100016675 213
42 3300005841 Ga0068863_100036982 Ga0068863_1000369822 213
43 3300005842 Ga0068858_100006220 Ga0068858_10000622010 213
44 3300005843 Ga0068860_100001937 Ga0068860_10000193715 213
45 3300005843 Ga0068860_100006239 Ga0068860_1000062397 213
46 3300006237 Ga0097621_100071290 Ga0097621_1000712902 213
47 3300006237 Ga0097621_100306998 Ga0097621_1003069983 213
48 3300006358 Ga0068871_100019230 Ga0068871_1000192306 213
49 3300006358 Ga0068871_100042294 Ga0068871_1000422942 213
50 3300006358 Ga0068871_100174141 Ga0068871_1001741413 213
51 3300006881 Ga0068865_100027002 Ga0068865_1000270022 213
52 3300009093 Ga0105240_10122293 Ga0105240_101222934 213
53 3300009098 Ga0105245_10055008 Ga0105245_100550082 213
54 3300009101 Ga0105247_10117808 Ga0105247_101178082 213
55 3300009148 Ga0105243_10146175 Ga0105243_101461754 213
56 3300009174 Ga0105241_10200256 Ga0105241_102002562 213
57 3300009177 Ga0105248_10052386 Ga0105248_100523862 213
58 3300009545 Ga0105237_10364019 Ga0105237_103640191 213
59 3300010375 Ga0105239_10216708 Ga0105239_102167084 213
60 3300011119 Ga0105246_10381805 Ga0105246_103818051 213
61 3300013104 Ga0157370_10314558 Ga0157370_103145582 213
62 3300013105 Ga0157369_10169095 Ga0157369_101690951 213
63 3300013296 Ga0157374_10057888 Ga0157374_100578882 213
64 3300013297 Ga0157378_10023109 Ga0157378_100231092 213
65 3300013306 Ga0163162_10001176 Ga0163162_100011765 213
66 3300013306 Ga0163162_10006924 Ga0163162_1000692412 213
67 3300013306 Ga0163162_10064335 Ga0163162_100643352 213
68 3300013306 Ga0163162_10224914 Ga0163162_102249141 213
69 3300013307 Ga0157372_10150748 Ga0157372_101507484 213
70 3300013308 Ga0157375_10016783 Ga0157375_100167835 213
71 3300013308 Ga0157375_10024940 Ga0157375_100249402 213
72 3300014325 Ga0163163_10054751 Ga0163163_100547514 213
73 3300014968 Ga0157379_10011542 Ga0157379_100115422 213
74 3300014968 Ga0157379_10068244 Ga0157379_100682441 213
75 3300014969 Ga0157376_10068212 Ga0157376_100682125 213
76 3300014969 Ga0157376_10104272 Ga0157376_101042721 213
77 3300014969 Ga0157376_10633102 Ga0157376_106331022 213
78 3300017792 Ga0163161_10021837 Ga0163161_100218372 213
79 3300025321 Ga0207656_10012972 Ga0207656_100129725 213
80 3300025903 Ga0207680_10076489 Ga0207680_100764892 213
81 3300025907 Ga0207645_10002213 Ga0207645_1000221312 213
82 3300025909 Ga0207705_10005337 Ga0207705_100053374 213
83 3300025911 Ga0207654_10253655 Ga0207654_102536552 213
84 3300025913 Ga0207695_10097479 Ga0207695_100974792 213
85 3300025921 Ga0207652_10278741 Ga0207652_102787413 213
86 3300025926 Ga0207659_10791914 Ga0207659_107919141 213
87 3300025931 Ga0207644_10936691 Ga0207644_109366911 213
88 3300025933 Ga0207706_10013778 Ga0207706_100137784 213
89 3300025936 Ga0207670_10165436 Ga0207670_101654362 213
90 3300025938 Ga0207704_10051857 Ga0207704_100518574 213
91 3300025941 Ga0207711_10095673 Ga0207711_100956732 213
92 3300025960 Ga0207651_10016139 Ga0207651_100161392 213
93 3300025972 Ga0207668_10001230 Ga0207668_100012306 213
94 3300025986 Ga0207658_10003547 Ga0207658_100035474 213
95 3300026023 Ga0207677_10061867 Ga0207677_100618671 213
96 3300026035 Ga0207703_10002783 Ga0207703_100027838 213
97 3300026088 Ga0207641_10024874 Ga0207641_100248742 213
98 3300026089 Ga0207648_10003048 Ga0207648_1000304811 213
99 3300026095 Ga0207676_10023151 Ga0207676_100231515 213
100 3300026118 Ga0207675_100485277 Ga0207675_1004852771 213
101 3300028381 Ga0268264_10001477 Ga0268264_1000147714 213
102 3300028381 Ga0268264_10010303 Ga0268264_100103032 213
103 3300035724 Ga0373933_0246559 Ga0373933_0246559_79_726 213
104 3300041451 Ga0451791_1704220 Ga0451791_1704220_19_663 213
105 3300041456 Ga0451795_0067844 Ga0451795_0067844_204_851 213
106 3300041456 Ga0451795_0212506 Ga0451795_0212506_1126_1770 213
107 3300046473 Ga0495582_0033711 Ga0495582_0033711_676_1323 213
108 3300046543 Ga0495645_0114279 Ga0495645_0114279_517_1164 213
109 3300046559 Ga0495667_0277135 Ga0495667_0277135_123_770 213
110 3300046616 Ga0495668_0003738 Ga0495668_0003738_6111_6764 213
111 3300046683 Ga0495658_0086863 Ga0495658_0086863_785_1432 213
112 3300047317 Ga0495604_0172278 Ga0495604_0172278_58_705 213
113 3300047319 Ga0495674_0223893 Ga0495674_0223893_84_731 213
114 3300048088 Ga0495602_0441782 Ga0495602_0441782_42_689 213
115 3300048912 Ga0496109_0115912 Ga0496109_0115912_43_690 213
116 3300048917 Ga0496114_0472262 Ga0496114_0472262_204_857 213
117 3300053090 Ga0500646_0035759 Ga0500646_0035759_318_971 213
118 3300053092 Ga0500583_0102591 Ga0500583_0102591_529_1182 213
119 3300053151 Ga0500604_0011689 Ga0500604_0011689_531_1184 213
120 3300053730 Ga0500645_012907 Ga0500645_012907_716_1369 213
121 3300003322 rootL2_10044612 rootL2_100446123 214
122 3300003322 rootL2_10273467 rootL2_102734672 214
123 3300003323 rootH1_10090583 rootH1_100905831 214
124 3300005262 Ga0065165_1011759 Ga0065165_10117594 214
125 3300005289 Ga0065704_10082877 Ga0065704_100828772 214
126 3300005295 Ga0065707_10174190 Ga0065707_101741901 214
127 3300005330 Ga0070690_100013006 Ga0070690_1000130063 214
128 3300005331 Ga0070670_100114351 Ga0070670_1001143512 214
129 3300005333 Ga0070677_10140414 Ga0070677_101404141 214
130 3300005334 Ga0068869_100061471 Ga0068869_1000614713 214
131 3300005334 Ga0068869_100127623 Ga0068869_1001276233 214
132 3300005334 Ga0068869_100209532 Ga0068869_1002095321 214
133 3300005334 Ga0068869_100587806 Ga0068869_1005878062 214
134 3300005335 Ga0070666_10000072 Ga0070666_1000007250 214
135 3300005335 Ga0070666_10008467 Ga0070666_100084672 214
136 3300005338 Ga0068868_100016699 Ga0068868_1000166992 214
137 3300005338 Ga0068868_100039206 Ga0068868_1000392065 214
138 3300005338 Ga0068868_100079595 Ga0068868_1000795952 214
139 3300005339 Ga0070660_100475713 Ga0070660_1004757131 214
140 3300005340 Ga0070689_100093985 Ga0070689_1000939853 214
141 3300005341 Ga0070691_10025176 Ga0070691_100251762 214
142 3300005353 Ga0070669_100241758 Ga0070669_1002417583 214
143 3300005354 Ga0070675_100282146 Ga0070675_1002821463 214
144 3300005355 Ga0070671_100043535 Ga0070671_1000435352 214
145 3300005355 Ga0070671_100056934 Ga0070671_1000569343 214
146 3300005355 Ga0070671_100893274 Ga0070671_1008932741 214
147 3300005356 Ga0070674_100080251 Ga0070674_1000802512 214
148 3300005364 Ga0070673_100004768 Ga0070673_1000047683 214
149 3300005367 Ga0070667_100023752 Ga0070667_1000237525 214
150 3300005367 Ga0070667_100048286 Ga0070667_1000482862 214
151 3300005435 Ga0070714_100428979 Ga0070714_1004289792 214
152 3300005444 Ga0070694_100284285 Ga0070694_1002842851 214
153 3300005456 Ga0070678_100003213 Ga0070678_1000032139 214
154 3300005457 Ga0070662_100018997 Ga0070662_1000189975 214
155 3300005458 Ga0070681_10207207 Ga0070681_102072072 214
156 3300005459 Ga0068867_100269568 Ga0068867_1002695682 214
157 3300005459 Ga0068867_100546516 Ga0068867_1005465162 214
158 3300005459 Ga0068867_100658664 Ga0068867_1006586642 214
159 3300005466 Ga0070685_10270097 Ga0070685_102700971 214
160 3300005518 Ga0070699_100839388 Ga0070699_1008393881 214
161 3300005536 Ga0070697_100415146 Ga0070697_1004151462 214
162 3300005539 Ga0068853_100002148 Ga0068853_10000214811 214
163 3300005539 Ga0068853_100039459 Ga0068853_1000394594 214
164 3300005539 Ga0068853_100086389 Ga0068853_1000863893 214
165 3300005539 Ga0068853_100130204 Ga0068853_1001302042 214
166 3300005539 Ga0068853_100316086 Ga0068853_1003160861 214
167 3300005539 Ga0068853_100351567 Ga0068853_1003515673 214
168 3300005539 Ga0068853_100529033 Ga0068853_1005290332 214
169 3300005543 Ga0070672_100220697 Ga0070672_1002206971 214
170 3300005545 Ga0070695_100271599 Ga0070695_1002715992 214
171 3300005547 Ga0070693_100021776 Ga0070693_1000217762 214
172 3300005549 Ga0070704_100635467 Ga0070704_1006354671 214
173 3300005563 Ga0068855_100011556 Ga0068855_10001155612 214
174 3300005563 Ga0068855_100310700 Ga0068855_1003107002 214
175 3300005564 Ga0070664_100151480 Ga0070664_1001514802 214
176 3300005577 Ga0068857_100084601 Ga0068857_1000846014 214
177 3300005577 Ga0068857_100216505 Ga0068857_1002165052 214
178 3300005578 Ga0068854_100415318 Ga0068854_1004153181 214
179 3300005614 Ga0068856_100050780 Ga0068856_1000507807 214
180 3300005614 Ga0068856_100132089 Ga0068856_1001320894 214
181 3300005616 Ga0068852_100001821 Ga0068852_1000018214 214
182 3300005616 Ga0068852_100016882 Ga0068852_1000168826 214
183 3300005616 Ga0068852_100109976 Ga0068852_1001099761 214
184 3300005617 Ga0068859_100000006 Ga0068859_10000000649 214
185 3300005617 Ga0068859_100029899 Ga0068859_1000298994 214
186 3300005617 Ga0068859_100032162 Ga0068859_1000321623 214
187 3300005617 Ga0068859_100459515 Ga0068859_1004595152 214
188 3300005617 Ga0068859_100772708 Ga0068859_1007727081 214
189 3300005618 Ga0068864_100451284 Ga0068864_1004512842 214
190 3300005618 Ga0068864_100676182 Ga0068864_1006761822 214
191 3300005718 Ga0068866_10013183 Ga0068866_100131831 214
192 3300005834 Ga0068851_10099183 Ga0068851_100991832 214
193 3300005840 Ga0068870_10001518 Ga0068870_100015182 214
194 3300005841 Ga0068863_100006901 Ga0068863_10000690110 214
195 3300005841 Ga0068863_100010664 Ga0068863_1000106642 214
196 3300005842 Ga0068858_100000978 Ga0068858_1000009789 214
197 3300005842 Ga0068858_101122241 Ga0068858_1011222411 214
198 3300005843 Ga0068860_100001713 Ga0068860_10000171313 214
199 3300005843 Ga0068860_100013129 Ga0068860_1000131295 214
200 3300005843 Ga0068860_100199227 Ga0068860_1001992272 214
201 3300005844 Ga0068862_100005509 Ga0068862_1000055094 214
202 3300005844 Ga0068862_100560531 Ga0068862_1005605312 214
203 3300006195 Ga0075366_10051152 Ga0075366_100511522 214
204 3300006237 Ga0097621_100004096 Ga0097621_1000040962 214
205 3300006237 Ga0097621_100009570 Ga0097621_1000095709 214
206 3300006237 Ga0097621_100023550 Ga0097621_1000235502 214
207 3300006358 Ga0068871_100019320 Ga0068871_1000193204 214
208 3300006358 Ga0068871_100039691 Ga0068871_1000396912 214
209 3300006358 Ga0068871_100051578 Ga0068871_1000515782 214
210 3300006358 Ga0068871_100060808 Ga0068871_1000608082 214
211 3300006358 Ga0068871_100163564 Ga0068871_1001635642 214
212 3300006844 Ga0075428_100027400 Ga0075428_1000274002 214
213 3300006846 Ga0075430_100008093 Ga0075430_1000080932 214
214 3300006852 Ga0075433_10525057 Ga0075433_105250571 214
215 3300006880 Ga0075429_100023176 Ga0075429_1000231763 214
216 3300006931 Ga0097620_100000006 Ga0097620_10000000649 214
217 3300006931 Ga0097620_100029900 Ga0097620_1000299003 214
218 3300006931 Ga0097620_100032162 Ga0097620_1000321623 214
219 3300006931 Ga0097620_100459476 Ga0097620_1004594762 214
220 3300006931 Ga0097620_100772564 Ga0097620_1007725642 214
221 3300009093 Ga0105240_10009898 Ga0105240_100098983 214
222 3300009093 Ga0105240_10012427 Ga0105240_1001242710 214
223 3300009093 Ga0105240_10280091 Ga0105240_102800912 214
224 3300009093 Ga0105240_10551128 Ga0105240_105511282 214
225 3300009094 Ga0111539_10002209 Ga0111539_100022097 214
226 3300009094 Ga0111539_11350976 Ga0111539_113509761 214
227 3300009101 Ga0105247_10018426 Ga0105247_100184264 214
228 3300009101 Ga0105247_10280921 Ga0105247_102809211 214
229 3300009147 Ga0114129_10002294 Ga0114129_100022946 214
230 3300009148 Ga0105243_10052841 Ga0105243_100528411 214
231 3300009174 Ga0105241_10070906 Ga0105241_100709063 214
232 3300009174 Ga0105241_10241324 Ga0105241_102413241 214
233 3300009545 Ga0105237_10006111 Ga0105237_100061113 214
234 3300009545 Ga0105237_10079417 Ga0105237_100794173 214
235 3300009553 Ga0105249_10002054 Ga0105249_1000205417 214
236 3300009553 Ga0105249_10080242 Ga0105249_100802425 214
237 3300010375 Ga0105239_10011078 Ga0105239_100110786 214
238 3300010375 Ga0105239_10490318 Ga0105239_104903182 214
239 3300011119 Ga0105246_10030336 Ga0105246_100303363 214
240 3300011119 Ga0105246_10109745 Ga0105246_101097452 214
241 3300013104 Ga0157370_10006044 Ga0157370_100060448 214
242 3300013104 Ga0157370_10475564 Ga0157370_104755642 214
243 3300013105 Ga0157369_10077077 Ga0157369_100770776 214
244 3300013105 Ga0157369_10086180 Ga0157369_100861803 214
245 3300013296 Ga0157374_10003691 Ga0157374_100036918 214
246 3300013296 Ga0157374_10031458 Ga0157374_100314582 214
247 3300013297 Ga0157378_10108408 Ga0157378_101084082 214
248 3300013306 Ga0163162_10000112 Ga0163162_1000011257 214
249 3300013306 Ga0163162_10052907 Ga0163162_100529072 214
250 3300013307 Ga0157372_10027137 Ga0157372_100271372 214
251 3300013307 Ga0157372_10092120 Ga0157372_100921203 214
252 3300013307 Ga0157372_10317557 Ga0157372_103175572 214
253 3300013307 Ga0157372_10374573 Ga0157372_103745731 214
254 3300013308 Ga0157375_10022627 Ga0157375_100226275 214
255 3300014325 Ga0163163_10012397 Ga0163163_100123979 214
256 3300014325 Ga0163163_10034704 Ga0163163_100347045 214
257 3300014325 Ga0163163_10182292 Ga0163163_101822922 214
258 3300014326 Ga0157380_10000895 Ga0157380_100008952 214
259 3300014326 Ga0157380_10205753 Ga0157380_102057532 214
260 3300014745 Ga0157377_10000392 Ga0157377_1000039216 214
261 3300014969 Ga0157376_10027800 Ga0157376_100278005 214
262 3300025208 Ga0209436_101389 Ga0209436_1013895 214
263 3300025302 Ga0207426_1016646 Ga0207426_10166464 214
264 3300025315 Ga0207697_10044047 Ga0207697_100440472 214
265 3300025315 Ga0207697_10050852 Ga0207697_100508522 214
266 3300025321 Ga0207656_10211308 Ga0207656_102113081 214
267 3300025893 Ga0207682_10104654 Ga0207682_101046541 214
268 3300025900 Ga0207710_10017476 Ga0207710_100174762 214
269 3300025903 Ga0207680_10000137 Ga0207680_1000013724 214
270 3300025904 Ga0207647_10000292 Ga0207647_1000029234 214
271 3300025911 Ga0207654_10001678 Ga0207654_100016787 214
272 3300025912 Ga0207707_10075212 Ga0207707_100752123 214
273 3300025913 Ga0207695_10041263 Ga0207695_100412632 214
274 3300025914 Ga0207671_10000453 Ga0207671_1000045321 214
275 3300025914 Ga0207671_10047265 Ga0207671_100472653 214
276 3300025917 Ga0207660_10043753 Ga0207660_100437534 214
277 3300025919 Ga0207657_10382549 Ga0207657_103825491 214
278 3300025923 Ga0207681_10009948 Ga0207681_100099487 214
279 3300025923 Ga0207681_10472369 Ga0207681_104723691 214
280 3300025926 Ga0207659_10004664 Ga0207659_100046642 214
281 3300025926 Ga0207659_10874914 Ga0207659_108749141 214
282 3300025931 Ga0207644_10189247 Ga0207644_101892472 214
283 3300025933 Ga0207706_10058717 Ga0207706_100587172 214
284 3300025934 Ga0207686_10025611 Ga0207686_100256112 214
285 3300025934 Ga0207686_10033836 Ga0207686_100338361 214
286 3300025936 Ga0207670_10014373 Ga0207670_100143733 214
287 3300025936 Ga0207670_10413209 Ga0207670_104132092 214
288 3300025937 Ga0207669_10013463 Ga0207669_100134635 214
289 3300025938 Ga0207704_10040934 Ga0207704_100409343 214
290 3300025938 Ga0207704_10127302 Ga0207704_101273021 214
291 3300025940 Ga0207691_10122715 Ga0207691_101227154 214
292 3300025940 Ga0207691_10387973 Ga0207691_103879731 214
293 3300025942 Ga0207689_10002434 Ga0207689_1000243412 214
294 3300025942 Ga0207689_10024280 Ga0207689_100242801 214
295 3300025942 Ga0207689_10048070 Ga0207689_100480703 214
296 3300025942 Ga0207689_10099362 Ga0207689_100993622 214
297 3300025942 Ga0207689_10433694 Ga0207689_104336942 214
298 3300025945 Ga0207679_10194158 Ga0207679_101941583 214
299 3300025949 Ga0207667_10004455 Ga0207667_100044557 214
300 3300025960 Ga0207651_10590714 Ga0207651_105907142 214
301 3300025961 Ga0207712_10023039 Ga0207712_100230392 214
302 3300025961 Ga0207712_10025776 Ga0207712_100257762 214
303 3300025961 Ga0207712_10032445 Ga0207712_100324451 214
304 3300025972 Ga0207668_10536713 Ga0207668_105367132 214
305 3300025981 Ga0207640_10023604 Ga0207640_100236042 214
306 3300025986 Ga0207658_10069300 Ga0207658_100693001 214
307 3300025986 Ga0207658_10530590 Ga0207658_105305901 214
308 3300026023 Ga0207677_10393736 Ga0207677_103937362 214
309 3300026035 Ga0207703_10122590 Ga0207703_101225902 214
310 3300026035 Ga0207703_10132068 Ga0207703_101320682 214
311 3300026041 Ga0207639_10082263 Ga0207639_100822632 214
312 3300026041 Ga0207639_10176362 Ga0207639_101763623 214
313 3300026041 Ga0207639_10244773 Ga0207639_102447733 214
314 3300026075 Ga0207708_10317982 Ga0207708_103179822 214
315 3300026078 Ga0207702_10060154 Ga0207702_100601543 214
316 3300026078 Ga0207702_11133671 Ga0207702_111336711 214
317 3300026088 Ga0207641_10000058 Ga0207641_1000005825 214
318 3300026088 Ga0207641_10013907 Ga0207641_100139071 214
319 3300026089 Ga0207648_10002407 Ga0207648_1000240711 214
320 3300026089 Ga0207648_10066202 Ga0207648_100662022 214
321 3300026095 Ga0207676_10003311 Ga0207676_100033115 214
322 3300026095 Ga0207676_10311516 Ga0207676_103115161 214
323 3300026116 Ga0207674_10011355 Ga0207674_100113556 214
324 3300026116 Ga0207674_10079189 Ga0207674_100791892 214
325 3300026116 Ga0207674_10292027 Ga0207674_102920272 214
326 3300026116 Ga0207674_10901469 Ga0207674_109014691 214
327 3300026118 Ga0207675_100000610 Ga0207675_10000061015 214
328 3300026118 Ga0207675_100539587 Ga0207675_1005395872 214
329 3300026121 Ga0207683_10000651 Ga0207683_1000065111 214
330 3300026121 Ga0207683_10002030 Ga0207683_100020302 214
331 3300026142 Ga0207698_10007968 Ga0207698_100079685 214
332 3300026142 Ga0207698_10406739 Ga0207698_104067391 214
333 3300026142 Ga0207698_10669540 Ga0207698_106695401 214
334 3300026142 Ga0207698_10839355 Ga0207698_108393552 214
335 3300027907 Ga0207428_10018651 Ga0207428_100186513 214
336 3300028380 Ga0268265_10229837 Ga0268265_102298371 214
337 3300028380 Ga0268265_10988218 Ga0268265_109882181 214
338 3300028381 Ga0268264_10000726 Ga0268264_1000072615 214
339 3300031251 Ga0265327_10023703 Ga0265327_100237032 214
340 3300031456 Ga0307513_10114277 Ga0307513_101142771 214
341 3300031903 Ga0307407_10162662 Ga0307407_101626622 214
342 3300037418 Ga0395900_0935494 Ga0395900_0935494_22_684 214
343 3300037471 Ga0395905_0017395 Ga0395905_0017395_5494_6159 214
344 3300037471 Ga0395905_0024815 Ga0395905_0024815_4280_4945 214
345 3300037471 Ga0395905_0112692 Ga0395905_0112692_462_1133 214
346 3300041405 Ga0439438_079272 Ga0439438_079272_43_693 214
347 3300041406 Ga0439439_0004082 Ga0439439_0004082_571_1221 214
348 3300041406 Ga0439439_0009935 Ga0439439_0009935_146_799 214
349 3300041406 Ga0439439_0016946 Ga0439439_0016946_461_1114 214
350 3300041460 Ga0451802_0344273 Ga0451802_0344273_71_724 214
351 3300042002 Ga0439442_008229 Ga0439442_008229_221_871 214
352 3300042007 Ga0439449_0059056 Ga0439449_0059056_317_967 214
353 3300042007 Ga0439449_0127764 Ga0439449_0127764_235_885 214
354 3300042015 Ga0439462_0036986 Ga0439462_0036986_305_958 214
355 3300042435 Ga0439434_0024776 Ga0439434_0024776_539_1189 214
356 3300042876 Ga0451577_0007475 Ga0451577_0007475_2056_2709 214
357 3300044656 Ga0466969_0000730 Ga0466969_0000730_4799_5449 214
358 3300044658 Ga0466972_0000082 Ga0466972_0000082_21034_21684 214
359 3300044684 Ga0466966_0000501 Ga0466966_0000501_4250_4900 214
360 3300044712 Ga0453684_1089952 Ga0453684_1089952_71_724 214
361 3300044735 Ga0466968_0025213 Ga0466968_0025213_1012_1662 214
362 3300044842 Ga0466957_0049955 Ga0466957_0049955_1140_1796 214
363 3300045049 Ga0466959_0000035 Ga0466959_0000035_2998_3648 214
364 3300046460 Ga0495638_0061196 Ga0495638_0061196_1165_1818 214
365 3300047319 Ga0495674_0365214 Ga0495674_0365214_391_1071 214
366 3300047320 Ga0495672_0006400 Ga0495672_0006400_1870_2535 214
367 3300047320 Ga0495672_0091934 Ga0495672_0091934_505_1161 214
368 3300047320 Ga0495672_0131251 Ga0495672_0131251_186_860 214
369 3300047472 Ga0495686_0000005 Ga0495686_0000005_502137_502802 214
370 3300048907 Ga0496104_0525068 Ga0496104_0525068_10_672 214
371 3300048917 Ga0496114_0189905 Ga0496114_0189905_99_761 214
372 3300048918 Ga0496115_0427116 Ga0496115_0427116_26_673 214
373 3300048924 Ga0496121_0000051 Ga0496121_0000051_10113_10760 214
374 3300049569 Ga0501032_0003107 Ga0501032_0003107_8192_8851 214
375 3300049570 Ga0501033_0066289 Ga0501033_0066289_212_865 214
376 3300049571 Ga0501034_0001878 Ga0501034_0001878_8574_9227 214
377 3300049571 Ga0501034_0007610 Ga0501034_0007610_5603_6256 214
378 3300049571 Ga0501034_0343109 Ga0501034_0343109_214_867 214
379 3300049571 Ga0501034_0686230 Ga0501034_0686230_79_738 214
380 3300049572 Ga0501036_0017507 Ga0501036_0017507_190_849 214
381 3300049573 Ga0501037_0365516 Ga0501037_0365516_226_885 214
382 3300049580 Ga0501046_0004991 Ga0501046_0004991_9315_9974 214
383 3300049580 Ga0501046_0226922 Ga0501046_0226922_562_1221 214
384 3300049581 Ga0501047_0103047 Ga0501047_0103047_1912_2571 214
385 3300049581 Ga0501047_0195330 Ga0501047_0195330_1073_1720 214
386 3300049583 Ga0501067_0411598 Ga0501067_0411598_41_700 214
387 3300049585 Ga0501069_0346400 Ga0501069_0346400_101_760 214
388 3300049586 Ga0501070_0082346 Ga0501070_0082346_1936_2598 214
389 3300049586 Ga0501070_0364563 Ga0501070_0364563_88_741 214
390 3300049589 Ga0501073_0001997 Ga0501073_0001997_2823_3482 214
391 3300049589 Ga0501073_0018164 Ga0501073_0018164_3327_3986 214
392 3300049590 Ga0501074_0159581 Ga0501074_0159581_860_1519 214
393 3300049703 Ga0501219_000084 Ga0501219_000084_2901_3605 214
394 3300049742 Ga0501080_0056266 Ga0501080_0056266_182_841 214
395 3300049742 Ga0501080_0119080 Ga0501080_0119080_463_1110 214
396 3300049742 Ga0501080_0197815 Ga0501080_0197815_507_1166 214
397 3300049742 Ga0501080_0751624 Ga0501080_0751624_81_743 214
398 3300049744 Ga0501083_0139534 Ga0501083_0139534_108_770 214
399 3300049758 Ga0501241_002587 Ga0501241_002587_2679_3383 214
400 3300049823 Ga0501044_0064780 Ga0501044_0064780_180_833 214
401 3300049823 Ga0501044_0260244 Ga0501044_0260244_959_1612 214
402 3300049823 Ga0501044_0399853 Ga0501044_0399853_354_1013 214
403 3300050005 Ga0501284_00017 Ga0501284_00017_84028_84732 214
404 3300050493 nmdc:mga0k408_145079_c1 nmdc:mga0k408_145079_c1_628_1278 214
405 3300050493 nmdc:mga0k408_234817_c1 nmdc:mga0k408_234817_c1_348_1001 214
406 3300050507 nmdc:mga05p37_30260_c1 nmdc:mga05p37_30260_c1_1488_2138 214
407 3300050509 nmdc:mga0qj67_66795_c1 nmdc:mga0qj67_66795_c1_1980_2642 214
408 3300050510 nmdc:mga06r32_29203_c1 nmdc:mga06r32_29203_c1_2325_2987 214
409 3300050511 nmdc:mga08y16_274593_c1 nmdc:mga08y16_274593_c1_833_1477 214
410 3300050511 nmdc:mga08y16_38826_c1 nmdc:mga08y16_38826_c1_1541_2200 214
411 3300050515 nmdc:mga0a205_510771_c1 nmdc:mga0a205_510771_c1_54_713 214
412 3300053090 Ga0500646_0002966 Ga0500646_0002966_1940_2587 214
413 3300053092 Ga0500583_0000003 Ga0500583_0000003_214903_215556 214
414 3300053092 Ga0500583_0001287 Ga0500583_0001287_383_1045 214
415 3300053139 Ga0500568_0008570 Ga0500568_0008570_4164_4814 214
416 3300053139 Ga0500568_0068664 Ga0500568_0068664_524_1168 214
417 3300053147 Ga0500589_007963 Ga0500589_007963_896_1549 214
418 3300053151 Ga0500604_0120764 Ga0500604_0120764_47_700 214
419 3300053153 Ga0500616_0094598 Ga0500616_0094598_401_1054 214
420 3300053156 Ga0500622_0000340 Ga0500622_0000340_10871_11524 214
421 3300053156 Ga0500622_0048090 Ga0500622_0048090_351_1004 214
422 3300053727 Ga0500611_000008 Ga0500611_000008_112271_112924 214
423 3300053730 Ga0500645_013380 Ga0500645_013380_696_1355 214
424 3300054114 Ga0501084_0231815 Ga0501084_0231815_537_1196 214
425 3300060353 Ga0501082_0300674 Ga0501082_0300674_298_957 214
426 3300003323 rootH1_10066352 rootH1_100663523 215
427 3300042876 Ga0451577_0049539 Ga0451577_0049539_1547_2200 215
428 3300005328 Ga0070676_10240526 Ga0070676_102405262 216
429 3300005334 Ga0068869_100074242 Ga0068869_1000742424 216
430 3300005441 Ga0070700_100466398 Ga0070700_1004663981 216
431 3300005459 Ga0068867_100013731 Ga0068867_1000137312 216
432 3300005577 Ga0068857_100092087 Ga0068857_1000920872 216
433 3300005718 Ga0068866_10050332 Ga0068866_100503323 216
434 3300005844 Ga0068862_100292532 Ga0068862_1002925322 216
435 3300006195 Ga0075366_10003065 Ga0075366_100030652 216
436 3300013100 Ga0157373_10230577 Ga0157373_102305772 216
437 3300025899 Ga0207642_10093585 Ga0207642_100935852 216
438 3300025907 Ga0207645_10022793 Ga0207645_100227936 216
439 3300025934 Ga0207686_10068888 Ga0207686_100688884 216
440 3300025942 Ga0207689_10179598 Ga0207689_101795982 216
441 3300025972 Ga0207668_10105393 Ga0207668_101053932 216
442 3300026089 Ga0207648_10000739 Ga0207648_1000073914 216
443 3300026118 Ga0207675_100320235 Ga0207675_1003202352 216
444 3300047472 Ga0495686_0067420 Ga0495686_0067420_33_725 216
445 3300050493 nmdc:mga0k408_466928_c1 nmdc:mga0k408_466928_c1_51_719 216
446 3300009176 Ga0105242_10028526 Ga0105242_100285266 217
447 3300025981 Ga0207640_10791883 Ga0207640_107918831 217
448 2162886007 SwRhRL2b_contig_2847592 SwRhRL2b_0314.00002220 219
449 3300005331 Ga0070670_100068839 Ga0070670_1000688393 219
450 3300005844 Ga0068862_100364619 Ga0068862_1003646192 219
451 3300013297 Ga0157378_10002733 Ga0157378_100027333 219
452 3300025925 Ga0207650_10017905 Ga0207650_100179053 219
453 3300049569 Ga0501032_0416569 Ga0501032_0416569_98_808 219
454 3300049575 Ga0501039_0074510 Ga0501039_0074510_1471_2181 219
455 3300049581 Ga0501047_0211710 Ga0501047_0211710_30_740 219
456 3300049582 Ga0501048_0058861 Ga0501048_0058861_1992_2702 219
457 3300049586 Ga0501070_0316636 Ga0501070_0316636_16_726 219
458 3300049589 Ga0501073_0427359 Ga0501073_0427359_80_790 219
459 3300049593 Ga0501077_0514662 Ga0501077_0514662_29_739 219
460 3300049742 Ga0501080_0043755 Ga0501080_0043755_23_733 219
461 3300054114 Ga0501084_0041221 Ga0501084_0041221_2110_2820 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

72

208

0.96

PF00633

HHH

Helix-hairpin-helix motif

137

166

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1orp-assembly1.cif.gz_A structure of a trapped endonuclease iii-dna covalent intermediate: estranged-adenine complex 0.9304 6 217
1p59-assembly1.cif.gz_A structure of a non-covalent endonuclease iii-dna complex 0.9285 6 219
1p59-assembly1.cif.gz_A structure of a non-covalent endonuclease iii-dna complex 0.9244 6 219
1orp-assembly1.cif.gz_A structure of a trapped endonuclease iii-dna covalent intermediate: estranged-adenine complex 0.9221 6 217
2abk-assembly1.cif.gz_A refinement of the native structure of endonuclease iii to a resolution of 1.85 angstrom 0.9073 6 212
ID Description Score Start End Superfamily
af_P9WQ11_33_143_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9443 29 137 1.10.340.30
af_P0AB83_21_132_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9396 28 137 1.10.340.30
af_Q58030_26_127_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9267 36 134 1.10.340.30
af_P9WQ11_33_143_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9198 29 137 1.10.340.30
af_Q09907_40_150_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9193 35 134 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A256WKV6-F1-model_v4 Endonuclease III 0.9706 6 196 GO:0003677
GO:0003906
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
AF-A0A1F1EFG2-F1-model_v4 Endonuclease III (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase) 0.9682 6 215 GO:0003677
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
GO:0140078
AF-R6F186-F1-model_v4 Endonuclease III (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase) 0.9678 6 213 GO:0003677
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
GO:0140078
AF-G6B0A2-F1-model_v4 Endonuclease III (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase) 0.9671 6 213 GO:0003677
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
GO:0140078
AF-A0A256WKV6-F1-model_v4 Endonuclease III 0.9656 6 196 GO:0003677
GO:0003906
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539

Feature Viewer

pLDDT pTM Quality
90.65 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map