F448626

General Info

Members Datasets Scaffolds Average Seq Length
460 215 920 248

Family's Representative Sequence

Representative Sequence 3300049584|Ga0501068_0007019|Ga0501068_0007019_5352_6119
Length 238
Sequence VIVRVGHLYPEYLNIYADRGNIAVLERRAAWRGHELAVTPIGLGDALEPGAHDLLYVGGGQDREQALIAPDLAAKGDAIAALGRGYRGRDGSTMPGAGLFPHETVAGERRMIGDVLLECELDPGERRTVAGFENHAGRTRLDPGAVPLGRVVAGFGNDGESGFEGCRVGTALGTYLHGPLLPRNPWLADWLLSRALAHATGEAPRPLEPLPDELERQAHAVSAGRARERGGRGLCGIS

Samples

Sample ID Description Type Environment
1 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
125 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
126 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
134 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
138 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
141 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
147 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
156 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 6.3
Rhizosphere 92.39
Stem 0
Stem Tuber 0
Unclassified 4.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501068_0007019 3300049584 Bacteria 6231
2 Ga0070683_100067996 3300005329 Bacteria 3319
3 Ga0070683_100096565 3300005329 Bacteria 2780
4 Ga0070690_100109295 3300005330 Bacteria 1843
5 Ga0070691_10012479 3300005341 Bacteria 3891
6 Ga0070691_10036046 3300005341 Bacteria 2330
7 Ga0070687_100062784 3300005343 Bacteria 1968
8 Ga0070692_10011357 3300005345 Bacteria 4085
9 Ga0070668_100009363 3300005347 Bacteria 7266
10 Ga0070674_100125068 3300005356 Bacteria 1908
11 Ga0070674_100359806 3300005356 Bacteria 1178
12 Ga0070659_100274265 3300005366 Bacteria 1402
13 Ga0070703_10020086 3300005406 Bacteria 1941
14 Ga0070714_100119901 3300005435 Bacteria 2339
15 Ga0070713_100115062 3300005436 Bacteria 2350
16 Ga0070710_10013927 3300005437 Bacteria 4037
17 Ga0070701_10125896 3300005438 Bacteria 1450
18 Ga0070701_10222566 3300005438 Bacteria 1126
19 Ga0070705_100045000 3300005440 Bacteria 2537
20 Ga0070700_100018858 3300005441 Bacteria 3973
21 Ga0070700_100094422 3300005441 Bacteria 1958
22 Ga0070681_10470834 3300005458 Bacteria 1169
23 Ga0068867_100304142 3300005459 Bacteria 1316
24 Ga0068867_100321084 3300005459 Unclassified 1283
25 Ga0070685_10270933 3300005466 Bacteria 1133
26 Ga0070706_100153861 3300005467 Bacteria 2147
27 Ga0070707_100093164 3300005468 Bacteria 2917
28 Ga0070698_100004043 3300005471 Bacteria 16137
29 Ga0070698_100006972 3300005471 Bacteria 12237
30 Ga0070698_100033852 3300005471 Bacteria 5293
31 Ga0070699_100014550 3300005518 Bacteria 6768
32 Ga0070699_100139917 3300005518 Unclassified 2137
33 Ga0070697_100270287 3300005536 Bacteria 1457
34 Ga0070672_100279917 3300005543 Bacteria 1410
35 Ga0070686_100132507 3300005544 Bacteria 1725
36 Ga0070686_100135967 3300005544 Bacteria 1706
37 Ga0070695_100084576 3300005545 Bacteria 2105
38 Ga0070693_100025509 3300005547 Bacteria 3183
39 Ga0070704_100058703 3300005549 Bacteria 2741
40 Ga0070704_100177899 3300005549 Bacteria 1699
41 Ga0068855_100142692 3300005563 Bacteria 2728
42 Ga0068855_100361295 3300005563 Bacteria 1598
43 Ga0068857_100116991 3300005577 Unclassified 2399
44 Ga0070702_100006382 3300005615 Bacteria 5578
45 Ga0070702_100049406 3300005615 Bacteria 2398
46 Ga0068859_100364110 3300005617 Unclassified 1541
47 Ga0068866_10272768 3300005718 Bacteria 1045
48 Ga0068866_10359357 3300005718 Bacteria 928
49 Ga0068861_100228827 3300005719 Bacteria 1576
50 Ga0068860_100296896 3300005843 Bacteria 1582
51 Ga0068860_100393907 3300005843 Bacteria 1369
52 Ga0081455_10017728 3300005937 Bacteria 6813
53 Ga0081455_10108018 3300005937 Bacteria 2217
54 Ga0081538_10000057 3300005981 Bacteria 102521
55 Ga0081539_10000041 3300005985 Bacteria 292660
56 Ga0081539_10020311 3300005985 Bacteria 4497
57 Ga0075365_10042218 3300006038 Bacteria 2981
58 Ga0075365_10171365 3300006038 Bacteria 1515
59 Ga0070712_100040160 3300006175 Bacteria 3206
60 Ga0075428_100032779 3300006844 Bacteria 5737
61 Ga0075428_100083770 3300006844 Bacteria 3479
62 Ga0075428_100268382 3300006844 Bacteria 1836
63 Ga0075428_101072793 3300006844 Unclassified 851
64 Ga0075430_100237238 3300006846 Bacteria 1511
65 Ga0075431_100611717 3300006847 Bacteria 1073
66 Ga0075434_100005176 3300006871 Bacteria 11840
67 Ga0075429_100016896 3300006880 Bacteria 6313
68 Ga0097620_100364127 3300006931 Unclassified 1541
69 Ga0105240_10434144 3300009093 Bacteria 1473
70 Ga0111539_10004593 3300009094 Bacteria 18043
71 Ga0111539_10007332 3300009094 Bacteria 14124
72 Ga0111539_10017628 3300009094 Bacteria 8840
73 Ga0111539_10302749 3300009094 Bacteria 1860
74 Ga0111539_10940458 3300009094 Bacteria 1005
75 Ga0111539_11247330 3300009094 Bacteria 863
76 Ga0105245_10059581 3300009098 Bacteria 3438
77 Ga0105245_10155361 3300009098 Bacteria 2166
78 Ga0105245_10230602 3300009098 Bacteria 1791
79 Ga0105245_10309239 3300009098 Bacteria 1553
80 Ga0105245_10316992 3300009098 Bacteria 1535
81 Ga0105245_10376241 3300009098 Bacteria 1413
82 Ga0114129_10010978 3300009147 Bacteria 12905
83 Ga0114129_10017065 3300009147 Bacteria 10335
84 Ga0114129_10180333 3300009147 Bacteria 2874
85 Ga0114129_11345026 3300009147 Bacteria 883
86 Ga0105243_10135815 3300009148 Bacteria 2092
87 Ga0105243_10243663 3300009148 Bacteria 1601
88 Ga0105243_10674276 3300009148 Bacteria 1005
89 Ga0105242_10495810 3300009176 Bacteria 1161
90 Ga0105248_10024828 3300009177 Bacteria 6664
91 Ga0105237_10114600 3300009545 Unclassified 2688
92 Ga0105238_10732183 3300009551 Bacteria 1002
93 Ga0105249_10010851 3300009553 Bacteria 8006
94 Ga0105249_10036826 3300009553 Bacteria 4439
95 Ga0105249_10099670 3300009553 Bacteria 2731
96 Ga0105249_10217612 3300009553 Bacteria 1878
97 Ga0105249_10331437 3300009553 Bacteria 1536
98 Ga0105249_10648983 3300009553 Bacteria 1113
99 Ga0105239_10038088 3300010375 Bacteria 5268
100 Ga0105239_10071415 3300010375 Bacteria 3814
101 Ga0105246_10038708 3300011119 Bacteria 3208
102 Ga0105246_10042765 3300011119 Bacteria 3069
103 Ga0105246_10137451 3300011119 Bacteria 1833
104 Ga0157371_10173040 3300013102 Bacteria 1543
105 Ga0157378_10096259 3300013297 Bacteria 2697
106 Ga0163162_10021629 3300013306 Bacteria 6336
107 Ga0157372_10506307 3300013307 Bacteria 1408
108 Ga0157375_10598480 3300013308 Bacteria 1262
109 Ga0163163_10121714 3300014325 Bacteria 2643
110 Ga0157377_10004169 3300014745 Bacteria 6605
111 Ga0157379_10367281 3300014968 Bacteria 1319
112 Ga0157376_10001321 3300014969 Bacteria 16360
113 Ga0157376_10006667 3300014969 Bacteria 8175
114 Ga0157376_10153912 3300014969 Bacteria 2077
115 Ga0163161_10333347 3300017792 Bacteria 1202
116 Ga0207688_10090435 3300025901 Bacteria 1757
117 Ga0207699_10063470 3300025906 Bacteria 2231
118 Ga0207645_10152386 3300025907 Bacteria 1509
119 Ga0207643_10047908 3300025908 Bacteria 2420
120 Ga0207707_10488020 3300025912 Bacteria 1052
121 Ga0207693_10006295 3300025915 Bacteria 9849
122 Ga0207693_10009157 3300025915 Bacteria 8083
123 Ga0207662_10122143 3300025918 Bacteria 1634
124 Ga0207657_10058167 3300025919 Bacteria 3328
125 Ga0207652_10497717 3300025921 Bacteria 1097
126 Ga0207646_10022680 3300025922 Bacteria 5779
127 Ga0207659_10055915 3300025926 Bacteria 2824
128 Ga0207687_10043101 3300025927 Bacteria 3108
129 Ga0207687_10134510 3300025927 Bacteria 1868
130 Ga0207700_10046069 3300025928 Bacteria 3223
131 Ga0207700_10229957 3300025928 Bacteria 1576
132 Ga0207690_10061569 3300025932 Bacteria 2552
133 Ga0207690_10398266 3300025932 Bacteria 1097
134 Ga0207706_10008758 3300025933 Bacteria 9313
135 Ga0207706_10042968 3300025933 Bacteria 4005
136 Ga0207706_10052165 3300025933 Bacteria 3611
137 Ga0207669_10073460 3300025937 Bacteria 2158
138 Ga0207704_10653708 3300025938 Bacteria 866
139 Ga0207665_10144486 3300025939 Bacteria 1699
140 Ga0207691_10305008 3300025940 Bacteria 1367
141 Ga0207661_10019751 3300025944 Bacteria 5029
142 Ga0207667_10413289 3300025949 Bacteria 1373
143 Ga0207712_10042305 3300025961 Bacteria 3136
144 Ga0207712_10220788 3300025961 Bacteria 1515
145 Ga0207668_10036930 3300025972 Bacteria 3266
146 Ga0207640_10130749 3300025981 Bacteria 1814
147 Ga0207640_10185645 3300025981 Bacteria 1563
148 Ga0207677_10149773 3300026023 Bacteria 1798
149 Ga0207677_10231675 3300026023 Bacteria 1488
150 Ga0207703_10131085 3300026035 Unclassified 2165
151 Ga0207639_10097922 3300026041 Bacteria 2363
152 Ga0207708_10009212 3300026075 Bacteria 7307
153 Ga0207708_10038461 3300026075 Bacteria 3644
154 Ga0207702_10023418 3300026078 Bacteria 5121
155 Ga0207641_10890209 3300026088 Bacteria 884
156 Ga0207648_10031354 3300026089 Bacteria 4700
157 Ga0207648_10041718 3300026089 Bacteria 4030
158 Ga0207648_10178107 3300026089 Bacteria 1881
159 Ga0207674_10006223 3300026116 Bacteria 14068
160 Ga0207674_10026768 3300026116 Bacteria 6117
161 Ga0207675_100007556 3300026118 Bacteria 10270
162 Ga0207675_100092754 3300026118 Bacteria 2840
163 Ga0207683_10162696 3300026121 Bacteria 2018
164 Ga0207428_10009220 3300027907 Bacteria 8864
165 Ga0207428_10009605 3300027907 Bacteria 8666
166 Ga0268265_10051134 3300028380 Bacteria 3118
167 Ga0268264_10530423 3300028381 Bacteria 1152
168 Ga0307408_100025364 3300031548 Bacteria 4061
169 Ga0307408_100298735 3300031548 Bacteria 1348
170 Ga0307413_10003425 3300031824 Bacteria 6671
171 Ga0307410_10090673 3300031852 Bacteria 2168
172 Ga0307406_10030824 3300031901 Bacteria 3260
173 Ga0307406_10106086 3300031901 Bacteria 1924
174 Ga0307412_10097390 3300031911 Unclassified 2073
175 Ga0307409_100011218 3300031995 Bacteria 5633
176 Ga0307409_100035980 3300031995 Bacteria 3634
177 Ga0307409_100207906 3300031995 Bacteria 1756
178 Ga0307416_100001425 3300032002 Bacteria 12993
179 Ga0307416_100012791 3300032002 Bacteria 5674
180 Ga0307416_100380294 3300032002 Bacteria 1442
181 Ga0307416_101009881 3300032002 Bacteria 935
182 Ga0307414_10178078 3300032004 Bacteria 1707
183 Ga0307415_100000286 3300032126 Bacteria 21920
184 Ga0307415_100014075 3300032126 Bacteria 4690
185 Ga0373952_0029053 3300035092 Bacteria 1217
186 Ga0395899_0003283 3300037312 Bacteria 12824
187 Ga0395899_0050094 3300037312 Bacteria 3102
188 Ga0395899_0066100 3300037312 Bacteria 2655
189 Ga0395899_0077036 3300037312 Bacteria 2433
190 Ga0395900_0005323 3300037418 Bacteria 13489
191 Ga0395900_0016923 3300037418 Bacteria 7442
192 Ga0395900_0039832 3300037418 Bacteria 4842
193 Ga0395900_0044318 3300037418 Bacteria 4584
194 Ga0395900_0066125 3300037418 Bacteria 3715
195 Ga0395900_0568422 3300037418 Bacteria 1077
196 Ga0395898_0002616 3300037466 Bacteria 20962
197 Ga0395898_0005906 3300037466 Bacteria 13162
198 Ga0395898_0007257 3300037466 Bacteria 11761
199 Ga0395898_0025937 3300037466 Bacteria 5902
200 Ga0395898_0064923 3300037466 Bacteria 3540
201 Ga0395898_0083514 3300037466 Bacteria 3078
202 Ga0395898_0533117 3300037466 Bacteria 1116
203 Ga0395905_0007137 3300037471 Bacteria 11170
204 Ga0395905_0014937 3300037471 Bacteria 7407
205 Ga0395905_0018631 3300037471 Bacteria 6584
206 Ga0395905_0147780 3300037471 Unclassified 2211
207 Ga0395901_0001394 3300038443 Bacteria 25270
208 Ga0395901_0002239 3300038443 Bacteria 19733
209 Ga0395901_0014181 3300038443 Bacteria 8114
210 Ga0395901_0024380 3300038443 Bacteria 6207
211 Ga0395901_0150080 3300038443 Bacteria 2449
212 Ga0395901_0400119 3300038443 Unclassified 1411
213 Ga0451839_0176762 3300041496 Bacteria 1772
214 Ga0451853_0176963 3300041512 Bacteria 1499
215 Ga0451853_0445709 3300041512 Bacteria 6578
216 Ga0439448_0004097 3300042005 Bacteria 4101
217 Ga0450920_015127 3300042122 Bacteria 1465
218 Ga0439458_0009648 3300042157 Bacteria 2150
219 Ga0466963_0441874 3300044694 Bacteria 918
220 Ga0466964_0001299 3300044706 Bacteria 8521
221 Ga0466964_0136606 3300044706 Bacteria 1122
222 Ga0451576_0009834 3300045051 Bacteria 11052
223 Ga0495603_0009829 3300046455 Bacteria 5789
224 Ga0495641_0141132 3300046461 Unclassified 1076
225 Ga0495653_0042394 3300046463 Bacteria 3545
226 Ga0495605_0026177 3300046474 Bacteria 3033
227 Ga0495584_0096775 3300046491 Bacteria 1491
228 Ga0495584_0230953 3300046491 Bacteria 940
229 Ga0495584_0291072 3300046491 Bacteria 830
230 Ga0495585_0064516 3300046492 Bacteria 2008
231 Ga0495594_0293189 3300046499 Bacteria 927
232 Ga0495618_0068013 3300046514 Bacteria 2265
233 Ga0495620_0072700 3300046515 Bacteria 1404
234 Ga0495620_0127157 3300046515 Bacteria 1002
235 Ga0495630_0084869 3300046517 Bacteria 2390
236 Ga0495665_0135366 3300046531 Unclassified 1289
237 Ga0495597_0136554 3300046542 Bacteria 1014
238 Ga0495667_0067798 3300046559 Bacteria 2331
239 Ga0495667_0082408 3300046559 Bacteria 2090
240 Ga0495667_0280785 3300046559 Bacteria 1057
241 Ga0495656_0062599 3300046615 Bacteria 1628
242 Ga0495656_0239385 3300046615 Bacteria 913
243 Ga0495634_0087165 3300046642 Bacteria 2032
244 Ga0495635_0066610 3300046663 Bacteria 2470
245 Ga0495635_0135861 3300046663 Bacteria 1676
246 Ga0495659_0002767 3300046664 Bacteria 5644
247 Ga0495646_0099408 3300046680 Bacteria 1670
248 Ga0495613_0282770 3300046689 Unclassified 1152
249 Ga0495670_0068348 3300046691 Unclassified 1795
250 Ga0495581_0014097 3300047315 Unclassified 4632
251 Ga0495581_0017173 3300047315 Bacteria 4206
252 Ga0495674_0037621 3300047319 Bacteria 4348
253 Ga0495674_0191341 3300047319 Bacteria 1700
254 Ga0495676_0068930 3300047321 Bacteria 2731
255 Ga0495680_0017808 3300047322 Bacteria 6048
256 Ga0495684_0023816 3300047471 Bacteria 4708
257 Ga0495684_0029206 3300047471 Bacteria 4232
258 Ga0495684_0044458 3300047471 Bacteria 3401
259 Ga0495614_0074549 3300048089 Bacteria 1466
260 Ga0495626_0028167 3300048091 Bacteria 2726
261 Ga0496101_0186795 3300048904 Bacteria 1598
262 Ga0496102_0073132 3300048905 Bacteria 3151
263 Ga0496103_0052054 3300048906 Bacteria 2536
264 Ga0496104_0000772 3300048907 Bacteria 27396
265 Ga0496104_0010424 3300048907 Bacteria 8302
266 Ga0496104_0053971 3300048907 Unclassified 3798
267 Ga0496105_0000542 3300048908 Bacteria 24896
268 Ga0496105_0060951 3300048908 Bacteria 3113
269 Ga0496106_0052710 3300048909 Bacteria 3070
270 Ga0496106_0209375 3300048909 Bacteria 1553
271 Ga0496108_0002080 3300048911 Bacteria 16011
272 Ga0496108_0004739 3300048911 Bacteria 10967
273 Ga0496109_0001642 3300048912 Bacteria 18684
274 Ga0496109_0013491 3300048912 Bacteria 7089
275 Ga0496109_0087585 3300048912 Unclassified 2876
276 Ga0496110_0000787 3300048913 Bacteria 22120
277 Ga0496110_0002026 3300048913 Bacteria 15085
278 Ga0496110_0008121 3300048913 Bacteria 8432
279 Ga0496110_0012389 3300048913 Bacteria 7011
280 Ga0496110_0465020 3300048913 Bacteria 1153
281 Ga0496111_0000234 3300048914 Bacteria 26582
282 Ga0496111_0001318 3300048914 Bacteria 13940
283 Ga0496112_0034001 3300048915 Bacteria 4959
284 Ga0496112_0585730 3300048915 Bacteria 1048
285 Ga0496113_0021005 3300048916 Bacteria 4600
286 Ga0496113_0215746 3300048916 Unclassified 1528
287 Ga0496113_0293846 3300048916 Bacteria 1300
288 Ga0496114_0361936 3300048917 Bacteria 1283
289 Ga0496115_0007169 3300048918 Bacteria 8187
290 Ga0501031_0000640 3300049568 Bacteria 20732
291 Ga0501031_0000679 3300049568 Bacteria 20283
292 Ga0501031_0004457 3300049568 Bacteria 9082
293 Ga0501031_0015927 3300049568 Bacteria 4881
294 Ga0501032_0006634 3300049569 Bacteria 8496
295 Ga0501032_0013463 3300049569 Bacteria 5816
296 Ga0501032_0016637 3300049569 Bacteria 5170
297 Ga0501032_0051185 3300049569 Bacteria 2785
298 Ga0501033_0001257 3300049570 Bacteria 22689
299 Ga0501033_0004461 3300049570 Bacteria 11198
300 Ga0501033_0007690 3300049570 Bacteria 8363
301 Ga0501033_0084620 3300049570 Bacteria 2324
302 Ga0501034_0046112 3300049571 Bacteria 4404
303 Ga0501036_0000260 3300049572 Bacteria 35885
304 Ga0501036_0000438 3300049572 Bacteria 29594
305 Ga0501036_0002733 3300049572 Bacteria 13950
306 Ga0501036_0325210 3300049572 Bacteria 1285
307 Ga0501037_0000275 3300049573 Bacteria 43921
308 Ga0501037_0120338 3300049573 Bacteria 1888
309 Ga0501037_0283196 3300049573 Bacteria 1154
310 Ga0501038_0000230 3300049574 Bacteria 47516
311 Ga0501038_0001135 3300049574 Bacteria 24147
312 Ga0501038_0008509 3300049574 Bacteria 9430
313 Ga0501038_0015611 3300049574 Bacteria 6903
314 Ga0501039_0000406 3300049575 Bacteria 30991
315 Ga0501039_0006769 3300049575 Bacteria 8720
316 Ga0501039_0180404 3300049575 Bacteria 1660
317 Ga0501039_0468547 3300049575 Bacteria 989
318 Ga0501040_0000592 3300049576 Bacteria 22114
319 Ga0501040_0008421 3300049576 Bacteria 6700
320 Ga0501040_0016289 3300049576 Bacteria 4917
321 Ga0501040_0359390 3300049576 Bacteria 1043
322 Ga0501040_0382239 3300049576 Bacteria 1010
323 Ga0501040_0484686 3300049576 Bacteria 891
324 Ga0501041_0000272 3300049577 Bacteria 24566
325 Ga0501041_0000911 3300049577 Bacteria 16004
326 Ga0501041_0003737 3300049577 Bacteria 8754
327 Ga0501041_0037419 3300049577 Bacteria 2940
328 Ga0501042_0000997 3300049578 Bacteria 16053
329 Ga0501042_0003497 3300049578 Bacteria 9870
330 Ga0501042_0014020 3300049578 Bacteria 5463
331 Ga0501042_0014994 3300049578 Bacteria 5299
332 Ga0501042_0033130 3300049578 Bacteria 3662
333 Ga0501043_0003228 3300049579 Bacteria 13458
334 Ga0501043_0004614 3300049579 Bacteria 11177
335 Ga0501043_0204607 3300049579 Bacteria 1531
336 Ga0501046_0001734 3300049580 Bacteria 20803
337 Ga0501046_0004112 3300049580 Bacteria 13259
338 Ga0501046_0009300 3300049580 Bacteria 8508
339 Ga0501046_0011277 3300049580 Bacteria 7648
340 Ga0501046_0056539 3300049580 Bacteria 3080
341 Ga0501046_0073540 3300049580 Bacteria 2652
342 Ga0501046_0353005 3300049580 Bacteria 1067
343 Ga0501047_0026326 3300049581 Bacteria 5596
344 Ga0501048_0001139 3300049582 Bacteria 19959
345 Ga0501048_0001500 3300049582 Bacteria 17671
346 Ga0501048_0008742 3300049582 Bacteria 7631
347 Ga0501048_0028556 3300049582 Bacteria 4049
348 Ga0501048_0318873 3300049582 Bacteria 1107
349 Ga0501067_0000516 3300049583 Bacteria 21125
350 Ga0501067_0026821 3300049583 Bacteria 3190
351 Ga0501068_0000011 3300049584 Bacteria 65947
352 Ga0501069_0000320 3300049585 Bacteria 21738
353 Ga0501069_0000482 3300049585 Bacteria 18238
354 Ga0501069_0002134 3300049585 Bacteria 9961
355 Ga0501069_0004504 3300049585 Bacteria 7200
356 Ga0501069_0005912 3300049585 Bacteria 6378
357 Ga0501069_0075950 3300049585 Bacteria 1888
358 Ga0501070_0003288 3300049586 Bacteria 14025
359 Ga0501070_0004186 3300049586 Bacteria 12422
360 Ga0501070_0010643 3300049586 Bacteria 7776
361 Ga0501070_0012724 3300049586 Bacteria 7096
362 Ga0501071_0004198 3300049587 Bacteria 9119
363 Ga0501071_0006394 3300049587 Bacteria 7647
364 Ga0501071_0007457 3300049587 Bacteria 7185
365 Ga0501071_0060487 3300049587 Bacteria 2742
366 Ga0501071_0136118 3300049587 Bacteria 1828
367 Ga0501072_0000354 3300049588 Bacteria 32671
368 Ga0501072_0002880 3300049588 Bacteria 12937
369 Ga0501072_0006422 3300049588 Bacteria 8957
370 Ga0501073_0018753 3300049589 Bacteria 5002
371 Ga0501073_0032970 3300049589 Bacteria 3691
372 Ga0501073_0051970 3300049589 Bacteria 2870
373 Ga0501074_0000438 3300049590 Bacteria 24855
374 Ga0501074_0004727 3300049590 Bacteria 9759
375 Ga0501074_0046401 3300049590 Bacteria 3141
376 Ga0501074_0080284 3300049590 Bacteria 2340
377 Ga0501075_0000040 3300049591 Bacteria 52221
378 Ga0501075_0028861 3300049591 Bacteria 4098
379 Ga0501075_0030741 3300049591 Bacteria 3979
380 Ga0501075_0106731 3300049591 Bacteria 2128
381 Ga0501076_0000089 3300049592 Bacteria 48333
382 Ga0501076_0008506 3300049592 Bacteria 7521
383 Ga0501076_0041762 3300049592 Bacteria 3609
384 Ga0501076_0126808 3300049592 Bacteria 2068
385 Ga0501076_0218325 3300049592 Unclassified 1558
386 Ga0501076_0317113 3300049592 Bacteria 1279
387 Ga0501077_0000172 3300049593 Bacteria 37130
388 Ga0501077_0005913 3300049593 Bacteria 7462
389 Ga0501077_0020179 3300049593 Bacteria 4218
390 Ga0501077_0025000 3300049593 Bacteria 3792
391 Ga0501077_0064592 3300049593 Bacteria 2322
392 Ga0501077_0156551 3300049593 Bacteria 1446
393 Ga0501079_0002976 3300049741 Bacteria 12392
394 Ga0501079_0004229 3300049741 Bacteria 10649
395 Ga0501079_0092544 3300049741 Bacteria 2342
396 Ga0501079_0135589 3300049741 Bacteria 1916
397 Ga0501079_0197489 3300049741 Bacteria 1570
398 Ga0501079_0276470 3300049741 Bacteria 1313
399 Ga0501080_0000142 3300049742 Bacteria 50372
400 Ga0501080_0018136 3300049742 Bacteria 6515
401 Ga0501080_0044217 3300049742 Bacteria 4146
402 Ga0501080_0055738 3300049742 Bacteria 3681
403 Ga0501081_0006516 3300049743 Bacteria 7581
404 Ga0501081_0008909 3300049743 Bacteria 6518
405 Ga0501081_0010258 3300049743 Bacteria 6116
406 Ga0501081_0014393 3300049743 Bacteria 5218
407 Ga0501081_0030509 3300049743 Bacteria 3649
408 Ga0501081_0147943 3300049743 Bacteria 1686
409 Ga0501081_0322341 3300049743 Bacteria 1136
410 Ga0501083_0001393 3300049744 Bacteria 16434
411 Ga0501083_0001626 3300049744 Bacteria 15377
412 Ga0501083_0070369 3300049744 Bacteria 2327
413 Ga0501083_0188900 3300049744 Unclassified 1344
414 Ga0501083_0203833 3300049744 Bacteria 1290
415 Ga0501035_0005187 3300049822 Bacteria 12324
416 Ga0501035_0008094 3300049822 Bacteria 9798
417 Ga0501035_0144670 3300049822 Bacteria 2065
418 Ga0501044_0019579 3300049823 Bacteria 7236
419 Ga0501044_0057962 3300049823 Bacteria 3973
420 Ga0501044_0070013 3300049823 Bacteria 3570
421 Ga0501045_0000357 3300049824 Bacteria 27239
422 Ga0501045_0007804 3300049824 Bacteria 7443
423 Ga0501045_0008579 3300049824 Bacteria 7123
424 Ga0501045_0021415 3300049824 Bacteria 4624
425 Ga0501045_0602341 3300049824 Bacteria 813
426 nmdc:mga0yw44_53407_c1 3300050492 Bacteria 2454
427 nmdc:mga05p37_4680_c1 3300050507 Bacteria 15983
428 nmdc:mga05p37_498140_c1 3300050507 Bacteria 1399
429 nmdc:mga05p37_831558_c1 3300050507 Bacteria 1005
430 nmdc:mga09592_14491_c1 3300050508 Bacteria 6435
431 nmdc:mga09592_394182_c1 3300050508 Bacteria 1197
432 nmdc:mga09592_522363_c1 3300050508 Bacteria 1021
433 nmdc:mga0qj67_42072_c1 3300050509 Bacteria 3596
434 nmdc:mga06r32_311110_c1 3300050510 Bacteria 1561
435 nmdc:mga06r32_672918_c1 3300050510 Bacteria 1002
436 nmdc:mga08y16_16896_c1 3300050511 Bacteria 7684
437 nmdc:mga08y16_17863_c1 3300050511 Bacteria 7472
438 nmdc:mga0n895_18537_c1 3300050512 Bacteria 6444
439 nmdc:mga0a205_321354_c1 3300050515 Unclassified 1419
440 Ga0495601_0049162 3300053077 Bacteria 2658
441 Ga0495601_0098779 3300053077 Bacteria 1884
442 Ga0495595_0061985 3300053084 Bacteria 1753
443 Ga0501084_0000144 3300054114 Bacteria 54020
444 Ga0501084_0013228 3300054114 Bacteria 6828
445 Ga0501084_0019269 3300054114 Bacteria 5682
446 Ga0501084_0039678 3300054114 Bacteria 3937
447 Ga0501084_0127428 3300054114 Bacteria 2142
448 Ga0501084_0202722 3300054114 Bacteria 1674
449 Ga0501084_0426765 3300054114 Bacteria 1121
450 Ga0501082_0000730 3300060353 Bacteria 28954
451 Ga0501082_0001289 3300060353 Bacteria 21965
452 Ga0501082_0015705 3300060353 Bacteria 6513
453 Ga0501082_0052277 3300060353 Bacteria 3521
454 Ga0501082_0055411 3300060353 Bacteria 3416
455 Ga0501082_0121746 3300060353 Bacteria 2261
456 Ga0501082_0489429 3300060353 Bacteria 1075
457 Ga0530510_0000612 3300061734 Bacteria 23017
458 Ga0530510_0002207 3300061734 Bacteria 13362
459 Ga0530510_0102748 3300061734 Bacteria 2090
460 Ga0530510_0296545 3300061734 Bacteria 1209
461 Ga0501068_0007019
462 Ga0070683_100067996
463 Ga0070683_100096565
464 Ga0070690_100109295
465 Ga0070691_10012479
466 Ga0070691_10036046
467 Ga0070687_100062784
468 Ga0070692_10011357
469 Ga0070668_100009363
470 Ga0070674_100125068
471 Ga0070674_100359806
472 Ga0070659_100274265
473 Ga0070703_10020086
474 Ga0070714_100119901
475 Ga0070713_100115062
476 Ga0070710_10013927
477 Ga0070701_10125896
478 Ga0070701_10222566
479 Ga0070705_100045000
480 Ga0070700_100018858
481 Ga0070700_100094422
482 Ga0070681_10470834
483 Ga0068867_100304142
484 Ga0068867_100321084
485 Ga0070685_10270933
486 Ga0070706_100153861
487 Ga0070707_100093164
488 Ga0070698_100004043
489 Ga0070698_100006972
490 Ga0070698_100033852
491 Ga0070699_100014550
492 Ga0070699_100139917
493 Ga0070697_100270287
494 Ga0070672_100279917
495 Ga0070686_100132507
496 Ga0070686_100135967
497 Ga0070695_100084576
498 Ga0070693_100025509
499 Ga0070704_100058703
500 Ga0070704_100177899
501 Ga0068855_100142692
502 Ga0068855_100361295
503 Ga0068857_100116991
504 Ga0070702_100006382
505 Ga0070702_100049406
506 Ga0068859_100364110
507 Ga0068866_10272768
508 Ga0068866_10359357
509 Ga0068861_100228827
510 Ga0068860_100296896
511 Ga0068860_100393907
512 Ga0081455_10017728
513 Ga0081455_10108018
514 Ga0081538_10000057
515 Ga0081539_10000041
516 Ga0081539_10020311
517 Ga0075365_10042218
518 Ga0075365_10171365
519 Ga0070712_100040160
520 Ga0075428_100032779
521 Ga0075428_100083770
522 Ga0075428_100268382
523 Ga0075428_101072793
524 Ga0075430_100237238
525 Ga0075431_100611717
526 Ga0075434_100005176
527 Ga0075429_100016896
528 Ga0097620_100364127
529 Ga0105240_10434144
530 Ga0111539_10004593
531 Ga0111539_10007332
532 Ga0111539_10017628
533 Ga0111539_10302749
534 Ga0111539_10940458
535 Ga0111539_11247330
536 Ga0105245_10059581
537 Ga0105245_10155361
538 Ga0105245_10230602
539 Ga0105245_10309239
540 Ga0105245_10316992
541 Ga0105245_10376241
542 Ga0114129_10010978
543 Ga0114129_10017065
544 Ga0114129_10180333
545 Ga0114129_11345026
546 Ga0105243_10135815
547 Ga0105243_10243663
548 Ga0105243_10674276
549 Ga0105242_10495810
550 Ga0105248_10024828
551 Ga0105237_10114600
552 Ga0105238_10732183
553 Ga0105249_10010851
554 Ga0105249_10036826
555 Ga0105249_10099670
556 Ga0105249_10217612
557 Ga0105249_10331437
558 Ga0105249_10648983
559 Ga0105239_10038088
560 Ga0105239_10071415
561 Ga0105246_10038708
562 Ga0105246_10042765
563 Ga0105246_10137451
564 Ga0157371_10173040
565 Ga0157378_10096259
566 Ga0163162_10021629
567 Ga0157372_10506307
568 Ga0157375_10598480
569 Ga0163163_10121714
570 Ga0157377_10004169
571 Ga0157379_10367281
572 Ga0157376_10001321
573 Ga0157376_10006667
574 Ga0157376_10153912
575 Ga0163161_10333347
576 Ga0207688_10090435
577 Ga0207699_10063470
578 Ga0207645_10152386
579 Ga0207643_10047908
580 Ga0207707_10488020
581 Ga0207693_10006295
582 Ga0207693_10009157
583 Ga0207662_10122143
584 Ga0207657_10058167
585 Ga0207652_10497717
586 Ga0207646_10022680
587 Ga0207659_10055915
588 Ga0207687_10043101
589 Ga0207687_10134510
590 Ga0207700_10046069
591 Ga0207700_10229957
592 Ga0207690_10061569
593 Ga0207690_10398266
594 Ga0207706_10008758
595 Ga0207706_10042968
596 Ga0207706_10052165
597 Ga0207669_10073460
598 Ga0207704_10653708
599 Ga0207665_10144486
600 Ga0207691_10305008
601 Ga0207661_10019751
602 Ga0207667_10413289
603 Ga0207712_10042305
604 Ga0207712_10220788
605 Ga0207668_10036930
606 Ga0207640_10130749
607 Ga0207640_10185645
608 Ga0207677_10149773
609 Ga0207677_10231675
610 Ga0207703_10131085
611 Ga0207639_10097922
612 Ga0207708_10009212
613 Ga0207708_10038461
614 Ga0207702_10023418
615 Ga0207641_10890209
616 Ga0207648_10031354
617 Ga0207648_10041718
618 Ga0207648_10178107
619 Ga0207674_10006223
620 Ga0207674_10026768
621 Ga0207675_100007556
622 Ga0207675_100092754
623 Ga0207683_10162696
624 Ga0207428_10009220
625 Ga0207428_10009605
626 Ga0268265_10051134
627 Ga0268264_10530423
628 Ga0307408_100025364
629 Ga0307408_100298735
630 Ga0307413_10003425
631 Ga0307410_10090673
632 Ga0307406_10030824
633 Ga0307406_10106086
634 Ga0307412_10097390
635 Ga0307409_100011218
636 Ga0307409_100035980
637 Ga0307409_100207906
638 Ga0307416_100001425
639 Ga0307416_100012791
640 Ga0307416_100380294
641 Ga0307416_101009881
642 Ga0307414_10178078
643 Ga0307415_100000286
644 Ga0307415_100014075
645 Ga0373952_0029053
646 Ga0395899_0003283
647 Ga0395899_0050094
648 Ga0395899_0066100
649 Ga0395899_0077036
650 Ga0395900_0005323
651 Ga0395900_0016923
652 Ga0395900_0039832
653 Ga0395900_0044318
654 Ga0395900_0066125
655 Ga0395900_0568422
656 Ga0395898_0002616
657 Ga0395898_0005906
658 Ga0395898_0007257
659 Ga0395898_0025937
660 Ga0395898_0064923
661 Ga0395898_0083514
662 Ga0395898_0533117
663 Ga0395905_0007137
664 Ga0395905_0014937
665 Ga0395905_0018631
666 Ga0395905_0147780
667 Ga0395901_0001394
668 Ga0395901_0002239
669 Ga0395901_0014181
670 Ga0395901_0024380
671 Ga0395901_0150080
672 Ga0395901_0400119
673 Ga0451839_0176762
674 Ga0451853_0176963
675 Ga0451853_0445709
676 Ga0439448_0004097
677 Ga0450920_015127
678 Ga0439458_0009648
679 Ga0466963_0441874
680 Ga0466964_0001299
681 Ga0466964_0136606
682 Ga0451576_0009834
683 Ga0495603_0009829
684 Ga0495641_0141132
685 Ga0495653_0042394
686 Ga0495605_0026177
687 Ga0495584_0096775
688 Ga0495584_0230953
689 Ga0495584_0291072
690 Ga0495585_0064516
691 Ga0495594_0293189
692 Ga0495618_0068013
693 Ga0495620_0072700
694 Ga0495620_0127157
695 Ga0495630_0084869
696 Ga0495665_0135366
697 Ga0495597_0136554
698 Ga0495667_0067798
699 Ga0495667_0082408
700 Ga0495667_0280785
701 Ga0495656_0062599
702 Ga0495656_0239385
703 Ga0495634_0087165
704 Ga0495635_0066610
705 Ga0495635_0135861
706 Ga0495659_0002767
707 Ga0495646_0099408
708 Ga0495613_0282770
709 Ga0495670_0068348
710 Ga0495581_0014097
711 Ga0495581_0017173
712 Ga0495674_0037621
713 Ga0495674_0191341
714 Ga0495676_0068930
715 Ga0495680_0017808
716 Ga0495684_0023816
717 Ga0495684_0029206
718 Ga0495684_0044458
719 Ga0495614_0074549
720 Ga0495626_0028167
721 Ga0496101_0186795
722 Ga0496102_0073132
723 Ga0496103_0052054
724 Ga0496104_0000772
725 Ga0496104_0010424
726 Ga0496104_0053971
727 Ga0496105_0000542
728 Ga0496105_0060951
729 Ga0496106_0052710
730 Ga0496106_0209375
731 Ga0496108_0002080
732 Ga0496108_0004739
733 Ga0496109_0001642
734 Ga0496109_0013491
735 Ga0496109_0087585
736 Ga0496110_0000787
737 Ga0496110_0002026
738 Ga0496110_0008121
739 Ga0496110_0012389
740 Ga0496110_0465020
741 Ga0496111_0000234
742 Ga0496111_0001318
743 Ga0496112_0034001
744 Ga0496112_0585730
745 Ga0496113_0021005
746 Ga0496113_0215746
747 Ga0496113_0293846
748 Ga0496114_0361936
749 Ga0496115_0007169
750 Ga0501031_0000640
751 Ga0501031_0000679
752 Ga0501031_0004457
753 Ga0501031_0015927
754 Ga0501032_0006634
755 Ga0501032_0013463
756 Ga0501032_0016637
757 Ga0501032_0051185
758 Ga0501033_0001257
759 Ga0501033_0004461
760 Ga0501033_0007690
761 Ga0501033_0084620
762 Ga0501034_0046112
763 Ga0501036_0000260
764 Ga0501036_0000438
765 Ga0501036_0002733
766 Ga0501036_0325210
767 Ga0501037_0000275
768 Ga0501037_0120338
769 Ga0501037_0283196
770 Ga0501038_0000230
771 Ga0501038_0001135
772 Ga0501038_0008509
773 Ga0501038_0015611
774 Ga0501039_0000406
775 Ga0501039_0006769
776 Ga0501039_0180404
777 Ga0501039_0468547
778 Ga0501040_0000592
779 Ga0501040_0008421
780 Ga0501040_0016289
781 Ga0501040_0359390
782 Ga0501040_0382239
783 Ga0501040_0484686
784 Ga0501041_0000272
785 Ga0501041_0000911
786 Ga0501041_0003737
787 Ga0501041_0037419
788 Ga0501042_0000997
789 Ga0501042_0003497
790 Ga0501042_0014020
791 Ga0501042_0014994
792 Ga0501042_0033130
793 Ga0501043_0003228
794 Ga0501043_0004614
795 Ga0501043_0204607
796 Ga0501046_0001734
797 Ga0501046_0004112
798 Ga0501046_0009300
799 Ga0501046_0011277
800 Ga0501046_0056539
801 Ga0501046_0073540
802 Ga0501046_0353005
803 Ga0501047_0026326
804 Ga0501048_0001139
805 Ga0501048_0001500
806 Ga0501048_0008742
807 Ga0501048_0028556
808 Ga0501048_0318873
809 Ga0501067_0000516
810 Ga0501067_0026821
811 Ga0501068_0000011
812 Ga0501069_0000320
813 Ga0501069_0000482
814 Ga0501069_0002134
815 Ga0501069_0004504
816 Ga0501069_0005912
817 Ga0501069_0075950
818 Ga0501070_0003288
819 Ga0501070_0004186
820 Ga0501070_0010643
821 Ga0501070_0012724
822 Ga0501071_0004198
823 Ga0501071_0006394
824 Ga0501071_0007457
825 Ga0501071_0060487
826 Ga0501071_0136118
827 Ga0501072_0000354
828 Ga0501072_0002880
829 Ga0501072_0006422
830 Ga0501073_0018753
831 Ga0501073_0032970
832 Ga0501073_0051970
833 Ga0501074_0000438
834 Ga0501074_0004727
835 Ga0501074_0046401
836 Ga0501074_0080284
837 Ga0501075_0000040
838 Ga0501075_0028861
839 Ga0501075_0030741
840 Ga0501075_0106731
841 Ga0501076_0000089
842 Ga0501076_0008506
843 Ga0501076_0041762
844 Ga0501076_0126808
845 Ga0501076_0218325
846 Ga0501076_0317113
847 Ga0501077_0000172
848 Ga0501077_0005913
849 Ga0501077_0020179
850 Ga0501077_0025000
851 Ga0501077_0064592
852 Ga0501077_0156551
853 Ga0501079_0002976
854 Ga0501079_0004229
855 Ga0501079_0092544
856 Ga0501079_0135589
857 Ga0501079_0197489
858 Ga0501079_0276470
859 Ga0501080_0000142
860 Ga0501080_0018136
861 Ga0501080_0044217
862 Ga0501080_0055738
863 Ga0501081_0006516
864 Ga0501081_0008909
865 Ga0501081_0010258
866 Ga0501081_0014393
867 Ga0501081_0030509
868 Ga0501081_0147943
869 Ga0501081_0322341
870 Ga0501083_0001393
871 Ga0501083_0001626
872 Ga0501083_0070369
873 Ga0501083_0188900
874 Ga0501083_0203833
875 Ga0501035_0005187
876 Ga0501035_0008094
877 Ga0501035_0144670
878 Ga0501044_0019579
879 Ga0501044_0057962
880 Ga0501044_0070013
881 Ga0501045_0000357
882 Ga0501045_0007804
883 Ga0501045_0008579
884 Ga0501045_0021415
885 Ga0501045_0602341
886 nmdc:mga0yw44_53407_c1
887 nmdc:mga05p37_4680_c1
888 nmdc:mga05p37_498140_c1
889 nmdc:mga05p37_831558_c1
890 nmdc:mga09592_14491_c1
891 nmdc:mga09592_394182_c1
892 nmdc:mga09592_522363_c1
893 nmdc:mga0qj67_42072_c1
894 nmdc:mga06r32_311110_c1
895 nmdc:mga06r32_672918_c1
896 nmdc:mga08y16_16896_c1
897 nmdc:mga08y16_17863_c1
898 nmdc:mga0n895_18537_c1
899 nmdc:mga0a205_321354_c1
900 Ga0495601_0049162
901 Ga0495601_0098779
902 Ga0495595_0061985
903 Ga0501084_0000144
904 Ga0501084_0013228
905 Ga0501084_0019269
906 Ga0501084_0039678
907 Ga0501084_0127428
908 Ga0501084_0202722
909 Ga0501084_0426765
910 Ga0501082_0000730
911 Ga0501082_0001289
912 Ga0501082_0015705
913 Ga0501082_0052277
914 Ga0501082_0055411
915 Ga0501082_0121746
916 Ga0501082_0489429
917 Ga0530510_0000612
918 Ga0530510_0002207
919 Ga0530510_0102748
920 Ga0530510_0296545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

79

185

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5n9m-assembly2.cif.gz_B crystal structure of gatd - a glutamine amidotransferase from staphylococcus aureus involved in peptidoglycan amidation 0.9267 2 242
6fqb-assembly4.cif.gz_H murt/gatd peptidoglycan amidotransferase complex from streptococcus pneumoniae r6 0.9151 2 235
5n9m-assembly2.cif.gz_B crystal structure of gatd - a glutamine amidotransferase from staphylococcus aureus involved in peptidoglycan amidation 0.9046 2 242
6fqb-assembly4.cif.gz_H murt/gatd peptidoglycan amidotransferase complex from streptococcus pneumoniae r6 0.8514 2 235
5f9y-assembly3.cif.gz_B crystal structure of prolyl-trna synthetase from cryptosporidium parvum complexed with l-proline and amp 0.7601 1 39
ID Description Score Start End Superfamily
af_Q2FX00_16_208_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9478 15 212 3.40.50.880
af_Q2FX00_16_208_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9384 15 212 3.40.50.880
af_I6XI14_15_209_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9291 16 212 3.40.50.880
af_I6XI14_15_209_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9201 16 212 3.40.50.880
af_Q54VK0_115_197_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.8579 2 42 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A538G3M5-F1-model_v4 Glutamine amidotransferase 0.9953 2 182 GO:0006541
GO:0016740
AF-A0A838FFP9-F1-model_v4 Glutamine amidotransferase 0.9837 1 95 GO:0016740
AF-A0A7W0SYC4-F1-model_v4 Glutamine amidotransferase 0.9825 86 249 GO:0006541
GO:0016740
AF-A0A7W1IKL4-F1-model_v4 Glutamine amidotransferase 0.9817 2 194 GO:0004359
GO:0006541
GO:0009236
GO:0016740
GO:0071555
AF-A0A2E7MPV6-F1-model_v4 Lipid II isoglutaminyl synthase (glutamine-hydrolyzing) subunit GatD (EC 6.3.5.13) (Lipid II isoglutaminyl synthase glutaminase subunit) (EC 3.5.1.2) 0.9776 1 243 GO:0004359
GO:0006541
GO:0008360
GO:0009236
GO:0009252
GO:0016740
GO:0071555
GO:0140282

Map