F448624

General Info

Members Datasets Scaffolds Average Seq Length
460 272 920 271

Family's Representative Sequence

Representative Sequence 3300049578|Ga0501042_0023961|Ga0501042_0023961_1105_1986
Length 293
Sequence VNARRPAGEGGERVRTRRAAVLGSPIAHSLSPVLHRTAYAELGLDDWRYDRFQVDEAALPGFVEAMGPAEWAGLSLTMPLKRAVIPLLDEVSATAGSVEAVNTLVLTPEGRRLGDNTDIPGMVAALAERGVTSVPGAAVLGAGATASSALAALARICTGEVTAYVRGPERERQMRQWGERLGVAVRTAAWQEAAEALTAPLVVNTTPAGAADHLAGAVPEHPGALFDVLYEPWPTALAAAWTARGGAVTSGLDLLVHQAVLQVEQHTGRAPAPLAAMRAAGEAALARARAGSA

Samples

Sample ID Description Type Environment
1 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
6 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
7 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
8 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
9 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
10 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
11 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
12 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
13 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
14 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
15 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
16 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
17 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
18 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
19 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
24 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
25 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
26 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
27 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
28 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
29 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
30 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
31 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
32 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
33 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
34 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
35 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
36 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
37 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
38 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
39 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
40 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
41 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
42 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
43 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
44 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
45 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
46 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
47 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
48 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
49 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
50 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
51 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
52 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
53 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
54 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
55 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
56 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
57 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
58 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
59 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
60 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
61 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
62 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
63 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
64 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
65 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
66 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
67 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
68 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
69 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
70 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
71 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
72 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
73 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
76 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
77 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
78 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
79 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
80 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
83 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
84 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
85 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
86 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
87 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
88 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
89 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
90 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
91 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
92 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
93 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
96 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
97 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
98 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
99 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
100 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
101 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
102 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
103 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
104 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
105 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
106 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
107 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
113 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
114 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
115 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
116 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
117 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
132 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
135 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
136 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
187 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
188 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
189 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
190 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
191 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
192 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
193 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
194 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
195 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
196 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
197 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
202 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
203 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
204 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
205 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
206 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
207 2643221548 Streptomyces sp. Root55 Isolate Unclassified
208 2643221576 Nocardioides sp. Root614 Isolate Unclassified
209 2643221590 Nocardioides sp. Root682 Isolate Unclassified
210 2643221604 Nocardioides sp. Root190 Isolate Unclassified
211 2643221617 Nocardioides sp. Root79 Isolate Unclassified
212 2643221620 Nocardioides sp. Root240 Isolate Unclassified
213 2643221647 Streptomyces sp. Root369 Isolate Unclassified
214 2643221670 Streptomyces sp. Root431 Isolate Unclassified
215 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
216 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
217 2643221714 Streptomyces sp. Root264 Isolate Unclassified
218 2738541305 Nocardioides sp. CF167 Isolate Unclassified
219 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
220 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
221 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
222 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
223 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
224 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
225 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
226 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
227 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
228 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
229 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
230 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
231 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
232 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
233 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
234 2862574272 Streptomyces sp. AcE210 Isolate Nodule
235 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
236 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
237 2867428634 Streptomyces sp. RP5T Isolate Unclassified
238 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
239 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
240 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
241 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
242 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
243 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
244 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
245 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
246 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
247 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
248 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
249 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
250 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
251 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
252 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
253 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
254 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
255 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
256 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
257 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
258 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
259 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
260 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
261 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
262 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
263 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
264 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
265 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
266 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
267 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
268 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
269 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
270 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
271 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
272 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.35
Metatranscriptomes 0.22
Isolates 15.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.04
Nodule 0.87
Rhizoplane 2.83
Rhizosphere 78.91
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501042_0023961 3300049578 Bacteria 4277
2 rootH2_10001760 3300003320 Bacteria 3659
3 rootH1_10023348 3300003323 Bacteria 2103
4 rootH1_10034305 3300003323 Bacteria 1671
5 Ga0006562J51391_1140816 3300003578 Bacteria 1200
6 Ga0068853_100028272 3300005539 Bacteria 4715
7 Ga0070664_100479736 3300005564 Bacteria 1144
8 Ga0068852_100046592 3300005616 Bacteria 3695
9 Ga0075434_100165689 3300006871 Bacteria 2230
10 Ga0099826_10022112 3300006948 Bacteria 4757
11 Ga0105251_10032292 3300009011 Bacteria 2611
12 Ga0111539_10567376 3300009094 Bacteria 1322
13 Ga0105245_10106096 3300009098 Bacteria 2606
14 Ga0105245_10215320 3300009098 Bacteria 1851
15 Ga0105245_10817800 3300009098 Bacteria 970
16 Ga0157372_10203418 3300013307 Bacteria 2294
17 Ga0157375_10792243 3300013308 Bacteria 1097
18 Ga0182008_10000988 3300014497 Bacteria 19736
19 Ga0182007_10000233 3300015262 Bacteria 37325
20 Ga0209758_1012234 3300025297 Bacteria 4828
21 Ga0207426_1001809 3300025302 Bacteria 15868
22 Ga0207687_10079950 3300025927 Bacteria 2358
23 Ga0207709_10326294 3300025935 Bacteria 1151
24 Ga0207639_10013111 3300026041 Bacteria 5790
25 Ga0207678_10262715 3300026067 Bacteria 1479
26 Ga0307517_10006575 3300028786 Bacteria 17165
27 Ga0307517_10006948 3300028786 Bacteria 16631
28 Ga0307515_10002608 3300028794 Bacteria 38833
29 Ga0307511_10004244 3300030521 Bacteria 14631
30 Ga0307511_10038518 3300030521 Bacteria 4102
31 Ga0307511_10157544 3300030521 Bacteria 1285
32 Ga0307512_10014055 3300030522 Bacteria 7473
33 Ga0307512_10041864 3300030522 Bacteria 3802
34 Ga0307513_10043756 3300031456 Bacteria 4914
35 Ga0307509_10036407 3300031507 Bacteria 5388
36 Ga0307508_10014305 3300031616 Bacteria 7239
37 Ga0307508_10019826 3300031616 Bacteria 6112
38 Ga0307508_10033163 3300031616 Bacteria 4662
39 Ga0307508_10251011 3300031616 Bacteria 1365
40 Ga0307514_10014150 3300031649 Bacteria 6609
41 Ga0307514_10074768 3300031649 Bacteria 2528
42 Ga0307514_10117372 3300031649 Bacteria 1867
43 Ga0316576_10003064 3300031727 Bacteria 9726
44 Ga0316578_10020566 3300031728 Bacteria 3649
45 Ga0307516_10005306 3300031730 Bacteria 15509
46 Ga0307516_10017360 3300031730 Bacteria 7506
47 Ga0307516_10017376 3300031730 Bacteria 7502
48 Ga0316577_10166566 3300031733 Bacteria 1243
49 Ga0307518_10165104 3300031838 Bacteria 1516
50 Ga0307409_100072488 3300031995 Bacteria 2743
51 Ga0307507_10023054 3300033179 Bacteria 6851
52 Ga0307507_10154848 3300033179 Bacteria 1712
53 Ga0307510_10025621 3300033180 Bacteria 6797
54 Ga0307510_10027250 3300033180 Bacteria 6551
55 Ga0307510_10046435 3300033180 Bacteria 4669
56 Ga0307510_10315506 3300033180 Bacteria 1021
57 Ga0316574_0006011 3300035398 Bacteria 6522
58 Ga0316584_0015292 3300036712 Bacteria 5485
59 Ga0395900_0705478 3300037418 Bacteria 942
60 Ga0395898_0021397 3300037466 Bacteria 6558
61 Ga0395905_0055913 3300037471 Bacteria 3694
62 Ga0436364_0846682 3300037853 Bacteria 27024
63 Ga0395901_0251183 3300038443 Bacteria 1842
64 Ga0439436_0014155 3300041404 Bacteria 2410
65 Ga0439436_0039188 3300041404 Bacteria 1361
66 Ga0439439_0001785 3300041406 Bacteria 4395
67 Ga0451837_0295718 3300041494 Bacteria 2210
68 Ga0451843_0583928 3300041509 Bacteria 1523
69 Ga0451853_1869466 3300041512 Bacteria 2409
70 Ga0439433_0001824 3300041999 Bacteria 4441
71 Ga0439449_0001359 3300042007 Bacteria 9582
72 Ga0439449_0048528 3300042007 Bacteria 1571
73 Ga0439455_0011514 3300042012 Bacteria 1967
74 Ga0439457_000613 3300042014 Bacteria 10525
75 Ga0439462_0004688 3300042015 Bacteria 3345
76 Ga0450894_003933 3300042131 Bacteria 1941
77 Ga0450903_000035 3300042138 Bacteria 27336
78 Ga0450906_008253 3300042145 Bacteria 2022
79 Ga0439458_0003344 3300042157 Bacteria 3768
80 Ga0466969_0001238 3300044656 Bacteria 13802
81 Ga0466969_0021641 3300044656 Bacteria 3324
82 Ga0466972_0000856 3300044658 Bacteria 14601
83 Ga0466972_0009861 3300044658 Bacteria 4796
84 Ga0466972_0017143 3300044658 Bacteria 3622
85 Ga0466972_0023868 3300044658 Bacteria 3039
86 Ga0466965_0004704 3300044683 Bacteria 6084
87 Ga0466965_0023703 3300044683 Bacteria 2964
88 Ga0466965_0071338 3300044683 Bacteria 1747
89 Ga0466966_0003382 3300044684 Bacteria 10518
90 Ga0466966_0007225 3300044684 Bacteria 7362
91 Ga0466961_0019498 3300044693 Bacteria 4362
92 Ga0466961_0034774 3300044693 Bacteria 3235
93 Ga0466961_0216637 3300044693 Bacteria 1181
94 Ga0466963_0001685 3300044694 Bacteria 12038
95 Ga0466963_0012550 3300044694 Bacteria 5190
96 Ga0466964_0007512 3300044706 Bacteria 4079
97 Ga0466971_0000179 3300044719 Bacteria 23854
98 Ga0466971_0038033 3300044719 Bacteria 2158
99 Ga0466968_0034234 3300044735 Bacteria 2119
100 Ga0466970_0003823 3300044765 Bacteria 7372
101 Ga0466970_0034666 3300044765 Bacteria 2673
102 Ga0466970_0051006 3300044765 Bacteria 2207
103 Ga0466957_0030726 3300044842 Bacteria 3208
104 Ga0466957_0308170 3300044842 Bacteria 1065
105 Ga0466960_0018568 3300044901 Bacteria 3050
106 Ga0466960_0112908 3300044901 Bacteria 1414
107 Ga0466959_0002782 3300045049 Bacteria 11257
108 Ga0466959_0025982 3300045049 Bacteria 4342
109 Ga0466959_0260018 3300045049 Bacteria 1195
110 Ga0466958_0046433 3300045836 Bacteria 2621
111 Ga0466967_0016052 3300045976 Bacteria 5891
112 Ga0466967_0041950 3300045976 Bacteria 3950
113 Ga0466967_0067395 3300045976 Bacteria 3192
114 Ga0466967_0259199 3300045976 Bacteria 1663
115 Ga0466967_0365814 3300045976 Bacteria 1398
116 Ga0495617_017180 3300046452 Bacteria 2442
117 Ga0495627_029264 3300046453 Bacteria 1754
118 Ga0495592_0009046 3300046454 Bacteria 7487
119 Ga0495592_0016299 3300046454 Bacteria 5639
120 Ga0495603_0004625 3300046455 Bacteria 8218
121 Ga0495603_0013742 3300046455 Bacteria 4898
122 Ga0495603_0022737 3300046455 Bacteria 3794
123 Ga0495603_0074478 3300046455 Bacteria 1994
124 Ga0495629_0005230 3300046459 Bacteria 9705
125 Ga0495629_0006078 3300046459 Bacteria 8969
126 Ga0495629_0009590 3300046459 Bacteria 7072
127 Ga0495629_0025358 3300046459 Bacteria 4215
128 Ga0495629_0038432 3300046459 Bacteria 3371
129 Ga0495638_0153584 3300046460 Bacteria 1334
130 Ga0495651_0000887 3300046462 Bacteria 23316
131 Ga0495653_0129361 3300046463 Bacteria 1789
132 Ga0495582_0019362 3300046473 Bacteria 3721
133 Ga0495582_0099598 3300046473 Bacteria 1626
134 Ga0495605_0001852 3300046474 Bacteria 13530
135 Ga0495662_0008535 3300046476 Bacteria 5035
136 Ga0495662_0009421 3300046476 Bacteria 4788
137 Ga0495662_0012535 3300046476 Bacteria 4135
138 Ga0495662_0048076 3300046476 Bacteria 2059
139 Ga0495664_0003842 3300046477 Bacteria 8202
140 Ga0495664_0005269 3300046477 Bacteria 7095
141 Ga0495585_0031593 3300046492 Bacteria 3005
142 Ga0495585_0069403 3300046492 Bacteria 1924
143 Ga0495585_0199777 3300046492 Bacteria 1019
144 Ga0495594_0003901 3300046499 Bacteria 7674
145 Ga0495594_0103350 3300046499 Bacteria 1603
146 Ga0495594_0214022 3300046499 Bacteria 1099
147 Ga0495596_0049339 3300046500 Bacteria 1650
148 Ga0495607_0072633 3300046501 Bacteria 1915
149 Ga0495607_0179414 3300046501 Bacteria 1063
150 Ga0495606_0011715 3300046507 Bacteria 7116
151 Ga0495616_0002501 3300046513 Bacteria 12156
152 Ga0495618_0122898 3300046514 Bacteria 1662
153 Ga0495630_0143624 3300046517 Bacteria 1814
154 Ga0495630_0151688 3300046517 Bacteria 1763
155 Ga0495632_0052522 3300046519 Bacteria 2004
156 Ga0495643_0001540 3300046522 Bacteria 20646
157 Ga0495643_0005887 3300046522 Bacteria 8196
158 Ga0495648_0158379 3300046524 Bacteria 1173
159 Ga0495666_0017505 3300046526 Bacteria 3568
160 Ga0495652_0049938 3300046529 Bacteria 3579
161 Ga0495665_0046241 3300046531 Bacteria 2311
162 Ga0495640_0083273 3300046533 Bacteria 2123
163 Ga0495587_0003878 3300046536 Bacteria 9922
164 Ga0495587_0020986 3300046536 Bacteria 4029
165 Ga0495587_0191592 3300046536 Bacteria 1157
166 Ga0495609_0109549 3300046538 Bacteria 1192
167 Ga0495597_0017826 3300046542 Bacteria 3336
168 Ga0495645_0027864 3300046543 Bacteria 4104
169 Ga0495645_0238286 3300046543 Bacteria 1215
170 Ga0495622_0034028 3300046557 Bacteria 2377
171 Ga0495622_0072497 3300046557 Bacteria 1589
172 Ga0495633_0044248 3300046558 Bacteria 2110
173 Ga0495667_0002010 3300046559 Bacteria 13467
174 Ga0495634_0008624 3300046642 Bacteria 7565
175 Ga0495634_0061767 3300046642 Bacteria 2489
176 Ga0495634_0275814 3300046642 Bacteria 1022
177 Ga0495625_0058244 3300046660 Bacteria 2745
178 Ga0495625_0120883 3300046660 Bacteria 1782
179 Ga0495635_0170007 3300046663 Bacteria 1482
180 Ga0495661_0012164 3300046665 Bacteria 5812
181 Ga0495588_0005413 3300046674 Bacteria 5680
182 Ga0495657_0002935 3300046675 Bacteria 14138
183 Ga0495657_0003267 3300046675 Bacteria 13315
184 Ga0495657_0016035 3300046675 Bacteria 5466
185 Ga0495599_0107475 3300046678 Bacteria 1738
186 Ga0495623_0053748 3300046679 Bacteria 2542
187 Ga0495623_0117707 3300046679 Bacteria 1604
188 Ga0495646_0025205 3300046680 Bacteria 3742
189 Ga0495646_0097899 3300046680 Bacteria 1685
190 Ga0495613_0004852 3300046689 Bacteria 10093
191 Ga0495613_0008134 3300046689 Bacteria 7801
192 Ga0495613_0013029 3300046689 Bacteria 6180
193 Ga0495613_0039723 3300046689 Bacteria 3488
194 Ga0495613_0076826 3300046689 Bacteria 2429
195 Ga0495613_0098093 3300046689 Bacteria 2117
196 Ga0495613_0303604 3300046689 Bacteria 1104
197 Ga0495624_0121543 3300046690 Bacteria 1603
198 Ga0495671_0009892 3300046692 Bacteria 5306
199 Ga0495649_0152820 3300046694 Bacteria 1212
200 Ga0495589_0012322 3300046794 Bacteria 4429
201 Ga0495589_0012487 3300046794 Bacteria 4398
202 Ga0495589_0014672 3300046794 Bacteria 4031
203 Ga0495589_0084007 3300046794 Bacteria 1548
204 Ga0495600_0001652 3300046809 Bacteria 12429
205 Ga0495600_0032219 3300046809 Bacteria 3400
206 Ga0495660_0014602 3300046810 Bacteria 4543
207 Ga0495581_0005916 3300047315 Bacteria 7093
208 Ga0495581_0012031 3300047315 Bacteria 5007
209 Ga0495581_0114279 3300047315 Bacteria 1570
210 Ga0495604_0002330 3300047317 Bacteria 15212
211 Ga0495604_0004731 3300047317 Bacteria 10787
212 Ga0495604_0044492 3300047317 Bacteria 3468
213 Ga0495604_0118408 3300047317 Bacteria 1920
214 Ga0495604_0248814 3300047317 Bacteria 1212
215 Ga0495636_0005741 3300047318 Bacteria 4864
216 Ga0495636_0018814 3300047318 Bacteria 2772
217 Ga0495636_0024653 3300047318 Bacteria 2441
218 Ga0495636_0045645 3300047318 Bacteria 1827
219 Ga0495674_0069109 3300047319 Bacteria 3055
220 Ga0495676_0002713 3300047321 Bacteria 15879
221 Ga0495676_0004289 3300047321 Bacteria 13019
222 Ga0495676_0021284 3300047321 Bacteria 5667
223 Ga0495676_0025796 3300047321 Bacteria 5068
224 Ga0495676_0042963 3300047321 Bacteria 3704
225 Ga0495676_0081887 3300047321 Bacteria 2444
226 Ga0495680_0124071 3300047322 Bacteria 1904
227 Ga0495683_0086332 3300047323 Bacteria 1525
228 Ga0495687_002189 3300047443 Bacteria 16258
229 Ga0495687_012917 3300047443 Bacteria 4387
230 Ga0495687_026463 3300047443 Bacteria 2729
231 Ga0495687_062301 3300047443 Bacteria 1531
232 Ga0495675_0037111 3300047444 Bacteria 3104
233 Ga0495677_0015652 3300047445 Bacteria 2754
234 Ga0495685_000258 3300047447 Bacteria 18267
235 Ga0495685_003632 3300047447 Bacteria 4935
236 Ga0495685_016059 3300047447 Bacteria 2558
237 Ga0495685_025220 3300047447 Bacteria 2046
238 Ga0495685_049770 3300047447 Bacteria 1422
239 Ga0495685_083814 3300047447 Bacteria 1060
240 Ga0495685_103216 3300047447 Bacteria 940
241 Ga0495681_0001206 3300047470 Bacteria 19657
242 Ga0495681_0007185 3300047470 Bacteria 7160
243 Ga0495681_0011826 3300047470 Bacteria 5168
244 Ga0495681_0073314 3300047470 Bacteria 1546
245 Ga0495686_0034475 3300047472 Bacteria 3259
246 Ga0495686_0050807 3300047472 Bacteria 2604
247 Ga0495593_0015925 3300047673 Bacteria 4247
248 Ga0495602_0203958 3300048088 Bacteria 1506
249 Ga0495614_0000423 3300048089 Bacteria 17379
250 Ga0495614_0004994 3300048089 Bacteria 5987
251 Ga0495614_0047692 3300048089 Bacteria 1837
252 Ga0496100_0257120 3300048903 Bacteria 1294
253 Ga0496102_0049595 3300048905 Bacteria 3819
254 Ga0496103_0066684 3300048906 Bacteria 2247
255 Ga0496106_0019112 3300048909 Bacteria 5079
256 Ga0496108_0082929 3300048911 Bacteria 2719
257 Ga0496108_0185965 3300048911 Bacteria 1800
258 Ga0496108_0220612 3300048911 Bacteria 1647
259 Ga0496109_0230957 3300048912 Bacteria 1740
260 Ga0496109_0470689 3300048912 Bacteria 1187
261 Ga0496110_0283073 3300048913 Bacteria 1510
262 Ga0496111_0066200 3300048914 Bacteria 2623
263 Ga0496111_0128171 3300048914 Bacteria 1877
264 Ga0496113_0121028 3300048916 Bacteria 2046
265 Ga0495678_018241 3300049459 Bacteria 3160
266 Ga0501031_0001063 3300049568 Bacteria 16659
267 Ga0501031_0005277 3300049568 Bacteria 8422
268 Ga0501032_0006508 3300049569 Bacteria 8585
269 Ga0501032_0017486 3300049569 Bacteria 5035
270 Ga0501032_0026487 3300049569 Bacteria 3987
271 Ga0501032_0072509 3300049569 Bacteria 2295
272 Ga0501033_0009233 3300049570 Bacteria 7593
273 Ga0501033_0079932 3300049570 Bacteria 2399
274 Ga0501033_0095118 3300049570 Bacteria 2177
275 Ga0501033_0160877 3300049570 Bacteria 1616
276 Ga0501033_0183872 3300049570 Bacteria 1497
277 Ga0501034_0002413 3300049571 Bacteria 22626
278 Ga0501034_0004049 3300049571 Bacteria 16445
279 Ga0501034_0150157 3300049571 Bacteria 2306
280 Ga0501034_0236242 3300049571 Bacteria 1775
281 Ga0501034_0294496 3300049571 Bacteria 1560
282 Ga0501036_0002186 3300049572 Bacteria 15263
283 Ga0501036_0019650 3300049572 Bacteria 5671
284 Ga0501036_0026241 3300049572 Bacteria 4916
285 Ga0501036_0049589 3300049572 Bacteria 3554
286 Ga0501036_0052035 3300049572 Bacteria 3468
287 Ga0501036_0093313 3300049572 Bacteria 2543
288 Ga0501037_0002849 3300049573 Bacteria 12534
289 Ga0501037_0071773 3300049573 Bacteria 2518
290 Ga0501037_0083766 3300049573 Bacteria 2310
291 Ga0501037_0264369 3300049573 Bacteria 1202
292 Ga0501038_0006753 3300049574 Bacteria 10599
293 Ga0501038_0022843 3300049574 Bacteria 5599
294 Ga0501038_0031974 3300049574 Bacteria 4646
295 Ga0501038_0055187 3300049574 Bacteria 3414
296 Ga0501038_0064851 3300049574 Bacteria 3114
297 Ga0501039_0002709 3300049575 Bacteria 13220
298 Ga0501039_0007760 3300049575 Bacteria 8187
299 Ga0501039_0048409 3300049575 Bacteria 3286
300 Ga0501040_0011502 3300049576 Bacteria 5792
301 Ga0501041_0011456 3300049577 Bacteria 5241
302 Ga0501042_0002745 3300049578 Bacteria 10860
303 Ga0501043_0000622 3300049579 Bacteria 31276
304 Ga0501043_0002135 3300049579 Bacteria 16882
305 Ga0501043_0011247 3300049579 Bacteria 7008
306 Ga0501043_0014402 3300049579 Bacteria 6190
307 Ga0501043_0068566 3300049579 Bacteria 2785
308 Ga0501043_0089277 3300049579 Bacteria 2422
309 Ga0501043_0165947 3300049579 Bacteria 1724
310 Ga0501046_0001707 3300049580 Bacteria 20974
311 Ga0501046_0008676 3300049580 Bacteria 8834
312 Ga0501046_0024497 3300049580 Bacteria 4949
313 Ga0501046_0203182 3300049580 Bacteria 1473
314 Ga0501047_0000182 3300049581 Bacteria 76846
315 Ga0501047_0000248 3300049581 Bacteria 63961
316 Ga0501047_0007343 3300049581 Bacteria 10362
317 Ga0501047_0009126 3300049581 Bacteria 9365
318 Ga0501047_0032211 3300049581 Bacteria 5060
319 Ga0501047_0039647 3300049581 Bacteria 4555
320 Ga0501047_0098707 3300049581 Bacteria 2799
321 Ga0501047_0112142 3300049581 Bacteria 2609
322 Ga0501047_0279796 3300049581 Bacteria 1513
323 Ga0501048_0003271 3300049582 Bacteria 12342
324 Ga0501048_0003356 3300049582 Bacteria 12178
325 Ga0501048_0289283 3300049582 Bacteria 1165
326 Ga0501067_0032454 3300049583 Bacteria 2898
327 Ga0501067_0085810 3300049583 Bacteria 1747
328 Ga0501068_0018431 3300049584 Bacteria 4043
329 Ga0501068_0062005 3300049584 Bacteria 2272
330 Ga0501069_0024129 3300049585 Bacteria 3317
331 Ga0501069_0056619 3300049585 Bacteria 2185
332 Ga0501070_0002372 3300049586 Bacteria 16524
333 Ga0501070_0021180 3300049586 Bacteria 5456
334 Ga0501070_0086128 3300049586 Bacteria 2601
335 Ga0501070_0097126 3300049586 Bacteria 2437
336 Ga0501070_0209255 3300049586 Bacteria 1601
337 Ga0501070_0424212 3300049586 Bacteria 1074
338 Ga0501070_0508355 3300049586 Bacteria 967
339 Ga0501071_0000025 3300049587 Bacteria 49332
340 Ga0501072_0000410 3300049588 Bacteria 30636
341 Ga0501073_0018252 3300049589 Bacteria 5068
342 Ga0501074_0006744 3300049590 Bacteria 8284
343 Ga0501074_0040578 3300049590 Bacteria 3370
344 Ga0501076_0006349 3300049592 Bacteria 8571
345 Ga0501077_0001957 3300049593 Bacteria 12453
346 Ga0501079_0013612 3300049741 Bacteria 6205
347 Ga0501080_0037855 3300049742 Bacteria 4504
348 Ga0501083_0030959 3300049744 Bacteria 3672
349 Ga0501035_0000416 3300049822 Bacteria 48248
350 Ga0501035_0003716 3300049822 Bacteria 14550
351 Ga0501035_0006603 3300049822 Bacteria 10857
352 Ga0501035_0007515 3300049822 Bacteria 10181
353 Ga0501035_0029463 3300049822 Bacteria 5005
354 Ga0501035_0061826 3300049822 Bacteria 3332
355 Ga0501035_0133241 3300049822 Bacteria 2165
356 Ga0501035_0325092 3300049822 Bacteria 1291
357 Ga0501044_0001535 3300049823 Bacteria 27090
358 Ga0501044_0008206 3300049823 Bacteria 11459
359 Ga0501044_0009479 3300049823 Bacteria 10601
360 Ga0501044_0012672 3300049823 Bacteria 9131
361 Ga0501044_0016365 3300049823 Bacteria 7964
362 Ga0501044_0040394 3300049823 Bacteria 4862
363 Ga0501044_0083345 3300049823 Bacteria 3234
364 Ga0501044_0208724 3300049823 Bacteria 1908
365 Ga0501045_0016455 3300049824 Bacteria 5253
366 Ga0501045_0231427 3300049824 Bacteria 1376
367 nmdc:mga07m45_30108_c1 3300050496 Bacteria 2606
368 nmdc:mga08y16_554673_c1 3300050511 Bacteria 1162
369 nmdc:mga0n895_165159_c1 3300050512 Bacteria 2245
370 Ga0495601_0266361 3300053077 Bacteria 1118
371 Ga0495655_0011013 3300053083 Bacteria 1804
372 Ga0495619_0061303 3300053085 Bacteria 2503
373 Ga0500578_0080106 3300053086 Bacteria 2077
374 Ga0500583_0081915 3300053092 Bacteria 1560
375 Ga0500654_054972 3300053099 Bacteria 2102
376 Ga0500553_119957 3300053101 Bacteria 1086
377 Ga0500560_000130 3300053107 Bacteria 8088
378 Ga0500628_002050 3300053129 Bacteria 3384
379 Ga0500658_0009006 3300053134 Bacteria 3682
380 Ga0500573_0059570 3300053140 Bacteria 2188
381 Ga0500600_0009267 3300053149 Bacteria 5938
382 Ga0500616_0017846 3300053153 Bacteria 4020
383 Ga0500633_0024984 3300053160 Bacteria 1862
384 Ga0501084_0026583 3300054114 Bacteria 4830
385 Ga0501082_0007246 3300060353 Bacteria 9566
386 Ga0466962_0002219 3300061719 Bacteria 9178
387 Ga0466962_0018208 3300061719 Bacteria 3379
388 Ga0530510_0100204 3300061734 Bacteria 2118
389 Ga0530510_0693340 3300061734 Bacteria 776
390 2547406521 2547132111 Bacteria 8013147
391 2585300382 2582581312 Bacteria 7308206
392 2585303520 2582581313 Bacteria 10042643
393 2585317001 2582581314 Bacteria 11452267
394 2616695611 2616644814 Bacteria 11555299
395 2643760224 2643221548 Bacteria 8053412
396 2643891651 2643221576 Bacteria 5214352
397 2643960699 2643221590 Bacteria 5214697
398 2644035785 2643221604 Bacteria 5014917
399 2644102319 2643221617 Bacteria 5139111
400 2644115543 2643221620 Bacteria 5134593
401 2644268010 2643221647 Bacteria 10741251
402 2644389089 2643221670 Bacteria 6497041
403 2644443685 2643221678 Bacteria 9540101
404 2644460080 2643221682 Bacteria 6743283
405 2644629615 2643221714 Bacteria 9015452
406 2738868103 2738541305 Bacteria 4910150
407 2785345746 2784746763 Bacteria 9783172
408 2785367141 2784746768 Bacteria 10036182
409 2786668189 2786546132 Bacteria 10419719
410 2808847647 2808606359 Bacteria 9866990
411 2812333167 2811994874 Bacteria 5367947
412 2812360327 2811994879 Bacteria 9313447
413 2812482427 2811994917 Bacteria 7761064
414 2819696357 2818991463 Bacteria 7948711
415 2819739081 2818991472 Bacteria 10089953
416 2852637702 2852635781 Bacteria 8251373
417 2862186259 2862178590 Bacteria 8583590
418 2862289671 2862281513 Bacteria 9621493
419 2862292455 2862290372 Bacteria 7471434
420 2862392092 2862382967 Bacteria 10317375
421 2862510408 2862507626 Bacteria 9425308
422 2862583730 2862574272 Bacteria 10567477
423 2862708216 2862705112 Bacteria 6563286
424 2863406981 2863404153 Bacteria 9672205
425 2867435582 2867428634 Bacteria 9590268
426 2873157691 2873151551 Bacteria 8625867
427 2875392682 2875391855 Bacteria 7600475
428 2877683405 2877676314 Bacteria 9512378
429 2912722413 2912715099 Bacteria 9460473
430 2912726116 2912723979 Bacteria 8557534
431 2946052032 2946045630 Bacteria 8527308
432 2946065561 2946064051 Bacteria 8957905
433 2946073921 2946072368 Bacteria 8999607
434 2947231848 2947224130 Bacteria 9938529
435 2954011083 2954002825 Bacteria 9173742
436 2954388652 2954380949 Bacteria 10050426
437 2954674472 2954673503 Bacteria 9685905
438 2954689660 2954682443 Bacteria 9862841
439 2954699443 2954691527 Bacteria 10720516
440 2954702775 2954701450 Bacteria 10834262
441 2954718381 2954711539 Bacteria 10867210
442 2954728351 2954721474 Bacteria 10456478
443 2954733458 2954731030 Bacteria 10243860
444 2954747247 2954740390 Bacteria 10229294
445 2954752341 2954749733 Bacteria 10366972
446 2954766362 2954759201 Bacteria 9358192
447 2966604427 2966598605 Bacteria 7676064
448 2990045856 2990044586 Bacteria 6603797
449 2990059585 2990059506 Bacteria 9321252
450 2995469367 2995463766 Bacteria 8577691
451 2997454754 2997451912 Bacteria 8492419
452 3006328022 3006321560 Bacteria 8247479
453 3006395395 3006393351 Bacteria 6615579
454 3006495141 3006493962 Bacteria 8825450
455 8008486574 8008485437 Bacteria 7198341
456 8008561302 8008558824 Bacteria 10610750
457 8008580760 8008574985 Bacteria 7815457
458 8025525643 8025524527 Bacteria 7197316
459 8048408157 8048406513 Bacteria 8936924
460 8056835713 8056829672 Bacteria 9045328
461 Ga0501042_0023961
462 rootH2_10001760
463 rootH1_10023348
464 rootH1_10034305
465 Ga0006562J51391_1140816
466 Ga0068853_100028272
467 Ga0070664_100479736
468 Ga0068852_100046592
469 Ga0075434_100165689
470 Ga0099826_10022112
471 Ga0105251_10032292
472 Ga0111539_10567376
473 Ga0105245_10106096
474 Ga0105245_10215320
475 Ga0105245_10817800
476 Ga0157372_10203418
477 Ga0157375_10792243
478 Ga0182008_10000988
479 Ga0182007_10000233
480 Ga0209758_1012234
481 Ga0207426_1001809
482 Ga0207687_10079950
483 Ga0207709_10326294
484 Ga0207639_10013111
485 Ga0207678_10262715
486 Ga0307517_10006575
487 Ga0307517_10006948
488 Ga0307515_10002608
489 Ga0307511_10004244
490 Ga0307511_10038518
491 Ga0307511_10157544
492 Ga0307512_10014055
493 Ga0307512_10041864
494 Ga0307513_10043756
495 Ga0307509_10036407
496 Ga0307508_10014305
497 Ga0307508_10019826
498 Ga0307508_10033163
499 Ga0307508_10251011
500 Ga0307514_10014150
501 Ga0307514_10074768
502 Ga0307514_10117372
503 Ga0316576_10003064
504 Ga0316578_10020566
505 Ga0307516_10005306
506 Ga0307516_10017360
507 Ga0307516_10017376
508 Ga0316577_10166566
509 Ga0307518_10165104
510 Ga0307409_100072488
511 Ga0307507_10023054
512 Ga0307507_10154848
513 Ga0307510_10025621
514 Ga0307510_10027250
515 Ga0307510_10046435
516 Ga0307510_10315506
517 Ga0316574_0006011
518 Ga0316584_0015292
519 Ga0395900_0705478
520 Ga0395898_0021397
521 Ga0395905_0055913
522 Ga0436364_0846682
523 Ga0395901_0251183
524 Ga0439436_0014155
525 Ga0439436_0039188
526 Ga0439439_0001785
527 Ga0451837_0295718
528 Ga0451843_0583928
529 Ga0451853_1869466
530 Ga0439433_0001824
531 Ga0439449_0001359
532 Ga0439449_0048528
533 Ga0439455_0011514
534 Ga0439457_000613
535 Ga0439462_0004688
536 Ga0450894_003933
537 Ga0450903_000035
538 Ga0450906_008253
539 Ga0439458_0003344
540 Ga0466969_0001238
541 Ga0466969_0021641
542 Ga0466972_0000856
543 Ga0466972_0009861
544 Ga0466972_0017143
545 Ga0466972_0023868
546 Ga0466965_0004704
547 Ga0466965_0023703
548 Ga0466965_0071338
549 Ga0466966_0003382
550 Ga0466966_0007225
551 Ga0466961_0019498
552 Ga0466961_0034774
553 Ga0466961_0216637
554 Ga0466963_0001685
555 Ga0466963_0012550
556 Ga0466964_0007512
557 Ga0466971_0000179
558 Ga0466971_0038033
559 Ga0466968_0034234
560 Ga0466970_0003823
561 Ga0466970_0034666
562 Ga0466970_0051006
563 Ga0466957_0030726
564 Ga0466957_0308170
565 Ga0466960_0018568
566 Ga0466960_0112908
567 Ga0466959_0002782
568 Ga0466959_0025982
569 Ga0466959_0260018
570 Ga0466958_0046433
571 Ga0466967_0016052
572 Ga0466967_0041950
573 Ga0466967_0067395
574 Ga0466967_0259199
575 Ga0466967_0365814
576 Ga0495617_017180
577 Ga0495627_029264
578 Ga0495592_0009046
579 Ga0495592_0016299
580 Ga0495603_0004625
581 Ga0495603_0013742
582 Ga0495603_0022737
583 Ga0495603_0074478
584 Ga0495629_0005230
585 Ga0495629_0006078
586 Ga0495629_0009590
587 Ga0495629_0025358
588 Ga0495629_0038432
589 Ga0495638_0153584
590 Ga0495651_0000887
591 Ga0495653_0129361
592 Ga0495582_0019362
593 Ga0495582_0099598
594 Ga0495605_0001852
595 Ga0495662_0008535
596 Ga0495662_0009421
597 Ga0495662_0012535
598 Ga0495662_0048076
599 Ga0495664_0003842
600 Ga0495664_0005269
601 Ga0495585_0031593
602 Ga0495585_0069403
603 Ga0495585_0199777
604 Ga0495594_0003901
605 Ga0495594_0103350
606 Ga0495594_0214022
607 Ga0495596_0049339
608 Ga0495607_0072633
609 Ga0495607_0179414
610 Ga0495606_0011715
611 Ga0495616_0002501
612 Ga0495618_0122898
613 Ga0495630_0143624
614 Ga0495630_0151688
615 Ga0495632_0052522
616 Ga0495643_0001540
617 Ga0495643_0005887
618 Ga0495648_0158379
619 Ga0495666_0017505
620 Ga0495652_0049938
621 Ga0495665_0046241
622 Ga0495640_0083273
623 Ga0495587_0003878
624 Ga0495587_0020986
625 Ga0495587_0191592
626 Ga0495609_0109549
627 Ga0495597_0017826
628 Ga0495645_0027864
629 Ga0495645_0238286
630 Ga0495622_0034028
631 Ga0495622_0072497
632 Ga0495633_0044248
633 Ga0495667_0002010
634 Ga0495634_0008624
635 Ga0495634_0061767
636 Ga0495634_0275814
637 Ga0495625_0058244
638 Ga0495625_0120883
639 Ga0495635_0170007
640 Ga0495661_0012164
641 Ga0495588_0005413
642 Ga0495657_0002935
643 Ga0495657_0003267
644 Ga0495657_0016035
645 Ga0495599_0107475
646 Ga0495623_0053748
647 Ga0495623_0117707
648 Ga0495646_0025205
649 Ga0495646_0097899
650 Ga0495613_0004852
651 Ga0495613_0008134
652 Ga0495613_0013029
653 Ga0495613_0039723
654 Ga0495613_0076826
655 Ga0495613_0098093
656 Ga0495613_0303604
657 Ga0495624_0121543
658 Ga0495671_0009892
659 Ga0495649_0152820
660 Ga0495589_0012322
661 Ga0495589_0012487
662 Ga0495589_0014672
663 Ga0495589_0084007
664 Ga0495600_0001652
665 Ga0495600_0032219
666 Ga0495660_0014602
667 Ga0495581_0005916
668 Ga0495581_0012031
669 Ga0495581_0114279
670 Ga0495604_0002330
671 Ga0495604_0004731
672 Ga0495604_0044492
673 Ga0495604_0118408
674 Ga0495604_0248814
675 Ga0495636_0005741
676 Ga0495636_0018814
677 Ga0495636_0024653
678 Ga0495636_0045645
679 Ga0495674_0069109
680 Ga0495676_0002713
681 Ga0495676_0004289
682 Ga0495676_0021284
683 Ga0495676_0025796
684 Ga0495676_0042963
685 Ga0495676_0081887
686 Ga0495680_0124071
687 Ga0495683_0086332
688 Ga0495687_002189
689 Ga0495687_012917
690 Ga0495687_026463
691 Ga0495687_062301
692 Ga0495675_0037111
693 Ga0495677_0015652
694 Ga0495685_000258
695 Ga0495685_003632
696 Ga0495685_016059
697 Ga0495685_025220
698 Ga0495685_049770
699 Ga0495685_083814
700 Ga0495685_103216
701 Ga0495681_0001206
702 Ga0495681_0007185
703 Ga0495681_0011826
704 Ga0495681_0073314
705 Ga0495686_0034475
706 Ga0495686_0050807
707 Ga0495593_0015925
708 Ga0495602_0203958
709 Ga0495614_0000423
710 Ga0495614_0004994
711 Ga0495614_0047692
712 Ga0496100_0257120
713 Ga0496102_0049595
714 Ga0496103_0066684
715 Ga0496106_0019112
716 Ga0496108_0082929
717 Ga0496108_0185965
718 Ga0496108_0220612
719 Ga0496109_0230957
720 Ga0496109_0470689
721 Ga0496110_0283073
722 Ga0496111_0066200
723 Ga0496111_0128171
724 Ga0496113_0121028
725 Ga0495678_018241
726 Ga0501031_0001063
727 Ga0501031_0005277
728 Ga0501032_0006508
729 Ga0501032_0017486
730 Ga0501032_0026487
731 Ga0501032_0072509
732 Ga0501033_0009233
733 Ga0501033_0079932
734 Ga0501033_0095118
735 Ga0501033_0160877
736 Ga0501033_0183872
737 Ga0501034_0002413
738 Ga0501034_0004049
739 Ga0501034_0150157
740 Ga0501034_0236242
741 Ga0501034_0294496
742 Ga0501036_0002186
743 Ga0501036_0019650
744 Ga0501036_0026241
745 Ga0501036_0049589
746 Ga0501036_0052035
747 Ga0501036_0093313
748 Ga0501037_0002849
749 Ga0501037_0071773
750 Ga0501037_0083766
751 Ga0501037_0264369
752 Ga0501038_0006753
753 Ga0501038_0022843
754 Ga0501038_0031974
755 Ga0501038_0055187
756 Ga0501038_0064851
757 Ga0501039_0002709
758 Ga0501039_0007760
759 Ga0501039_0048409
760 Ga0501040_0011502
761 Ga0501041_0011456
762 Ga0501042_0002745
763 Ga0501043_0000622
764 Ga0501043_0002135
765 Ga0501043_0011247
766 Ga0501043_0014402
767 Ga0501043_0068566
768 Ga0501043_0089277
769 Ga0501043_0165947
770 Ga0501046_0001707
771 Ga0501046_0008676
772 Ga0501046_0024497
773 Ga0501046_0203182
774 Ga0501047_0000182
775 Ga0501047_0000248
776 Ga0501047_0007343
777 Ga0501047_0009126
778 Ga0501047_0032211
779 Ga0501047_0039647
780 Ga0501047_0098707
781 Ga0501047_0112142
782 Ga0501047_0279796
783 Ga0501048_0003271
784 Ga0501048_0003356
785 Ga0501048_0289283
786 Ga0501067_0032454
787 Ga0501067_0085810
788 Ga0501068_0018431
789 Ga0501068_0062005
790 Ga0501069_0024129
791 Ga0501069_0056619
792 Ga0501070_0002372
793 Ga0501070_0021180
794 Ga0501070_0086128
795 Ga0501070_0097126
796 Ga0501070_0209255
797 Ga0501070_0424212
798 Ga0501070_0508355
799 Ga0501071_0000025
800 Ga0501072_0000410
801 Ga0501073_0018252
802 Ga0501074_0006744
803 Ga0501074_0040578
804 Ga0501076_0006349
805 Ga0501077_0001957
806 Ga0501079_0013612
807 Ga0501080_0037855
808 Ga0501083_0030959
809 Ga0501035_0000416
810 Ga0501035_0003716
811 Ga0501035_0006603
812 Ga0501035_0007515
813 Ga0501035_0029463
814 Ga0501035_0061826
815 Ga0501035_0133241
816 Ga0501035_0325092
817 Ga0501044_0001535
818 Ga0501044_0008206
819 Ga0501044_0009479
820 Ga0501044_0012672
821 Ga0501044_0016365
822 Ga0501044_0040394
823 Ga0501044_0083345
824 Ga0501044_0208724
825 Ga0501045_0016455
826 Ga0501045_0231427
827 nmdc:mga07m45_30108_c1
828 nmdc:mga08y16_554673_c1
829 nmdc:mga0n895_165159_c1
830 Ga0495601_0266361
831 Ga0495655_0011013
832 Ga0495619_0061303
833 Ga0500578_0080106
834 Ga0500583_0081915
835 Ga0500654_054972
836 Ga0500553_119957
837 Ga0500560_000130
838 Ga0500628_002050
839 Ga0500658_0009006
840 Ga0500573_0059570
841 Ga0500600_0009267
842 Ga0500616_0017846
843 Ga0500633_0024984
844 Ga0501084_0026583
845 Ga0501082_0007246
846 Ga0466962_0002219
847 Ga0466962_0018208
848 Ga0530510_0100204
849 Ga0530510_0693340
850 2547406521
851 2585300382
852 2585303520
853 2585317001
854 2616695611
855 2643760224
856 2643891651
857 2643960699
858 2644035785
859 2644102319
860 2644115543
861 2644268010
862 2644389089
863 2644443685
864 2644460080
865 2644629615
866 2738868103
867 2785345746
868 2785367141
869 2786668189
870 2808847647
871 2812333167
872 2812360327
873 2812482427
874 2819696357
875 2819739081
876 2852637702
877 2862186259
878 2862289671
879 2862292455
880 2862392092
881 2862510408
882 2862583730
883 2862708216
884 2863406981
885 2867435582
886 2873157691
887 2875392682
888 2877683405
889 2912722413
890 2912726116
891 2946052032
892 2946065561
893 2946073921
894 2947231848
895 2954011083
896 2954388652
897 2954674472
898 2954689660
899 2954699443
900 2954702775
901 2954718381
902 2954728351
903 2954733458
904 2954747247
905 2954752341
906 2954766362
907 2966604427
908 2990045856
909 2990059585
910 2995469367
911 2997454754
912 3006328022
913 3006395395
914 3006495141
915 8008486574
916 8008561302
917 8008580760
918 8025525643
919 8048408157
920 8056835713

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08501

Shikimate_dh_N

Shikimate dehydrogenase substrate binding domain

21

104

0.98

PF18317

SDH_C

Shikimate 5'-dehydrogenase C-terminal domain

251

280

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p4l-assembly3.cif.gz_C crystal structure of mycobacterium tuberculosis shikimate dehydrogenase 0.9222 3 262
4p4g-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis shikimate dehydrogenase 0.921 3 262
4p4l-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis shikimate dehydrogenase 0.9111 3 262
4xij-assembly1.cif.gz_A crystal structure of a shikimate 5-dehydrogenase from mycobacterium fortuitum determined by iodide sad phasing 0.9082 1 262
4p4l-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis shikimate dehydrogenase 0.905 3 262
ID Description Score Start End Superfamily
af_I6Y120_6_102_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9594 4 102 3.40.50.150
af_P0A6D5_3_112_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9553 2 109 3.40.50.10860
af_P0A6D5_8_104_1.10.560.10 Mainly Alpha;Orthogonal Bundle;GROEL; domain 1;GroEL-like equatorial domain 0.9517 4 101 1.10.560.10
af_I6Y120_6_102_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9499 4 102 3.40.50.150
af_Q58484_1_94_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9361 3 90 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A7V8Y555-F1-model_v4 Shikimate dehydrogenase 0.9677 1 115 GO:0004764
GO:0005829
GO:0009423
GO:0019632
GO:0050661
AF-A0A0R1V5D2-F1-model_v4 Shikimate 5-dehydrogenase 0.9588 3 118 GO:0004764
GO:0009423
GO:0019632
AF-A0A497P9I6-F1-model_v4 Shikimate dehydrogenase 0.9566 4 113 GO:0004764
GO:0009423
GO:0019632
AF-A0A844EJK0-F1-model_v4 Shikimate dehydrogenase 0.9543 3 118 GO:0004764
GO:0009423
GO:0019632
AF-S5VIY2-F1-model_v4 Shikimate 5-dehydrogenase (EC 1.1.1.25) 0.9542 9 262 GO:0004764
GO:0005829
GO:0009423
GO:0019632
GO:0050661

Map