F448621

General Info

Members Datasets Scaffolds Average Seq Length
460 361 920 242

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0518932|Ga0496108_0518932_137_976
Length 279
Sequence MTKQDLQIKTRDGVARAGLFRAANTSPAKAGIILYMDAFGPRAALDGMAERLAGEGYAVLVPDLFYRNAPYGPFDAKTAFAEEKTKTVLMALVTGTTQEMTISDSGAFVDALAAEGVTGPIGTVGYCMGGARALNAAATYPEQIRAAASFHGGNLASDAADSPHRKAASIKARVYVGTSGVDRSFPPEQSARLAEALRVAEVDHVIENYVGMAHGWCVPDHSVFDAIGAERHWKRLTTLFAETLIQNGPGRCLRSHRTGRDLHDWRRLLNGAVSGNDLA

Samples

Sample ID Description Type Environment
1 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
36 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
37 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
39 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
40 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
54 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
55 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
59 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
60 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
61 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
62 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
63 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
64 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
65 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
66 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
67 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
68 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
69 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
70 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
85 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
86 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
87 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
88 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
89 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
90 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
91 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
92 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
93 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
94 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
95 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
96 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
99 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
100 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
101 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
102 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
103 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
104 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
105 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
106 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
107 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
108 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
109 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
110 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
111 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
112 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
113 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
114 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
115 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
116 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
117 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
118 2512875024
119 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
120 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
121 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
122 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
123 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
124 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
125 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
126 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
127 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
128 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
129 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
130 2738543024 Aminobacter sp. AP02 Isolate Unclassified
131 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
132 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
133 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
134 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
135 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
136 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
137 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
138 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
139 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
140 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
141 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
142 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
143 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
144 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
145 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
146 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
147 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
148 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
149 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
150 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
151 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
152 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
153 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
154 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
155 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
156 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
157 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
158 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
159 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
160 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
161 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
162 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
163 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
164 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
165 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
166 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
167 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
168 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
169 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
170 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
171 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
172 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
173 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
174 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
175 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
176 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
177 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
178 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
179 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
180 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
181 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
182 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
183 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
184 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
185 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
186 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
187 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
188 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
189 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
190 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
191 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
192 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
193 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
194 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
195 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
196 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
197 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
198 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
199 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
200 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
201 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
202 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
203 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
204 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
205 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
206 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
207 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
208 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
209 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
210 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
211 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
212 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
213 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
214 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
215 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
216 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
217 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
218 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
219 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
220 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
221 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
222 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
223 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
224 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
225 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
226 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
227 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
228 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
229 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
230 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
231 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
232 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
233 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
234 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
235 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
236 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
237 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
238 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
239 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
240 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
241 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
242 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
243 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
244 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
245 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
246 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
247 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
248 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
249 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
250 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
251 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
252 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
253 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
254 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
255 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
256 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
257 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
258 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
259 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
260 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
261 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
262 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
263 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
264 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
265 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
266 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
267 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
268 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
269 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
270 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
271 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
272 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
273 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
274 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
275 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
276 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
277 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
278 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
279 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
280 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
281 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
282 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
283 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
284 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
285 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
286 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
287 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
288 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
289 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
290 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
291 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
292 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
293 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
294 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
295 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
296 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
297 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
298 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
299 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
300 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
301 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
302 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
303 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
304 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
305 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
306 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
307 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
308 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
309 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
310 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
311 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
312 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
313 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
314 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
315 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
316 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
317 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
318 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
319 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
320 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
321 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
322 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
323 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
324 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
325 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
326 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
327 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
328 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
329 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
330 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
331 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
332 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
333 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
334 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
335 3004167301 Mesorhizobium loti 582 Isolate Unclassified
336 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
337 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
338 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
339 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
340 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
341 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
342 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
343 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
344 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
345 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
346 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
347 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
348 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
349 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
350 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
351 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
352 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
353 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
354 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
355 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
356 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
357 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
358 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
359 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
360 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
361 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 45.65
Metatranscriptomes 0
Isolates 54.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.83
Nodule 47.61
Rhizoplane 0.65
Rhizosphere 35.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496108_0518932 3300048911 Bacteria 1040
2 JGI24740J21852_10022833 3300001979 Bacteria 2147
3 JGI24739J22299_10056649 3300001989 Bacteria 1250
4 JGI25156J39149_1001756 3300002705 Bacteria 8650
5 JGI25157J39369_1000751 3300002741 Bacteria 17047
6 JGI25165J46597_1000062 3300003214 Bacteria 206459
7 Ga0055542_1000395 3300003762 Bacteria 43439
8 Ga0055529_1002810 3300003763 Bacteria 3151
9 Ga0070660_100045304 3300005339 Bacteria 3366
10 Ga0070674_100599989 3300005356 Bacteria 930
11 Ga0070663_100017854 3300005455 Bacteria 4638
12 Ga0070663_100076265 3300005455 Bacteria 2451
13 Ga0068867_100560582 3300005459 Bacteria 991
14 Ga0070685_10431356 3300005466 Bacteria 919
15 Ga0068853_100001788 3300005539 Bacteria 15811
16 Ga0070665_100040489 3300005548 Bacteria 4683
17 Ga0070665_100083099 3300005548 Bacteria 3207
18 Ga0070665_100113495 3300005548 Bacteria 2712
19 Ga0070665_100153398 3300005548 Bacteria 2305
20 Ga0070665_100357670 3300005548 Bacteria 1466
21 Ga0070665_100968410 3300005548 Bacteria 863
22 Ga0068855_100577163 3300005563 Bacteria 1215
23 Ga0068856_100531089 3300005614 Bacteria 1198
24 Ga0068852_100398633 3300005616 Bacteria 1353
25 Ga0081539_10001801 3300005985 Bacteria 33917
26 Ga0075365_10007380 3300006038 Bacteria 6150
27 Ga0075365_10120564 3300006038 Bacteria 1809
28 Ga0075365_10137328 3300006038 Bacteria 1695
29 Ga0075365_10416222 3300006038 Bacteria 949
30 Ga0075368_10021418 3300006042 Bacteria 2455
31 Ga0075363_100021082 3300006048 Bacteria 3277
32 Ga0075363_100042540 3300006048 Bacteria 2401
33 Ga0075367_10029548 3300006178 Bacteria 3136
34 Ga0075369_10037104 3300006186 Bacteria 2075
35 Ga0075369_10058815 3300006186 Bacteria 1674
36 Ga0075370_10131652 3300006353 Bacteria 1459
37 Ga0105240_10038269 3300009093 Bacteria 6154
38 Ga0105240_10327369 3300009093 Bacteria 1745
39 Ga0105248_10709414 3300009177 Bacteria 1135
40 Ga0105237_10004482 3300009545 Bacteria 16141
41 Ga0105237_10093868 3300009545 Bacteria 2990
42 Ga0105237_10324419 3300009545 Bacteria 1543
43 Ga0105238_10003702 3300009551 Bacteria 15217
44 Ga0105238_10086913 3300009551 Bacteria 3114
45 Ga0105239_10004313 3300010375 Bacteria 17054
46 Ga0105239_10171453 3300010375 Bacteria 2426
47 Ga0105239_10181399 3300010375 Bacteria 2355
48 Ga0105239_10183729 3300010375 Bacteria 2340
49 Ga0105239_10295948 3300010375 Bacteria 1822
50 Ga0157370_10575170 3300013104 Bacteria 1032
51 Ga0157369_10124298 3300013105 Bacteria 2736
52 Ga0157372_10450109 3300013307 Bacteria 1501
53 Ga0182008_10030913 3300014497 Bacteria 2697
54 Ga0182008_10180108 3300014497 Bacteria 1069
55 Ga0182006_1032404 3300015261 Bacteria 2100
56 Ga0209026_1000024 3300025250 Bacteria 355839
57 Ga0209148_1000050 3300025254 Bacteria 413178
58 Ga0209759_1000057 3300025256 Bacteria 205181
59 Ga0209233_1000129 3300025261 Bacteria 206511
60 Ga0209455_1000228 3300025272 Bacteria 74611
61 Ga0207647_10039944 3300025904 Bacteria 2958
62 Ga0207671_10103174 3300025914 Bacteria 2162
63 Ga0207671_10212700 3300025914 Bacteria 1513
64 Ga0207657_10071766 3300025919 Bacteria 2931
65 Ga0207649_10052929 3300025920 Bacteria 2521
66 Ga0207694_10202402 3300025924 Bacteria 1616
67 Ga0207694_10409791 3300025924 Bacteria 1128
68 Ga0207669_10029207 3300025937 Bacteria 3046
69 Ga0207711_10539463 3300025941 Bacteria 1088
70 Ga0207667_10212212 3300025949 Bacteria 1984
71 Ga0207639_10137820 3300026041 Bacteria 2029
72 Ga0207678_10031158 3300026067 Bacteria 4652
73 Ga0207678_10082803 3300026067 Bacteria 2745
74 Ga0207678_10548239 3300026067 Bacteria 1011
75 Ga0207698_10643379 3300026142 Bacteria 1050
76 Ga0268266_10034604 3300028379 Bacteria 4296
77 Ga0268266_10071653 3300028379 Bacteria 3004
78 Ga0268266_10216842 3300028379 Bacteria 1757
79 Ga0268266_10347115 3300028379 Bacteria 1394
80 Ga0268266_10542023 3300028379 Bacteria 1114
81 Ga0307412_10204495 3300031911 Bacteria 1502
82 Ga0307414_10311259 3300032004 Bacteria 1337
83 Ga0395900_0040567 3300037418 Bacteria 4797
84 Ga0395900_0090082 3300037418 Bacteria 3153
85 Ga0395900_0090102 3300037418 Bacteria 3153
86 Ga0395905_0010722 3300037471 Bacteria 8887
87 Ga0395905_0100843 3300037471 Bacteria 2711
88 Ga0395901_0120636 3300038443 Bacteria 2755
89 Ga0395901_0131473 3300038443 Bacteria 2630
90 Ga0395901_0144560 3300038443 Bacteria 2500
91 Ga0451833_1234222 3300041491 Bacteria 895
92 Ga0466960_0125666 3300044901 Bacteria 1348
93 Ga0495638_0007770 3300046460 Bacteria 7657
94 Ga0495637_0053618 3300046520 Bacteria 1678
95 Ga0495625_0017610 3300046660 Bacteria 5591
96 Ga0495687_056642 3300047443 Bacteria 1634
97 Ga0496112_0020064 3300048915 Bacteria 6328
98 Ga0496117_0263906 3300048920 Bacteria 932
99 Ga0496119_0053952 3300048922 Bacteria 2451
100 Ga0496119_0145186 3300048922 Bacteria 1277
101 Ga0496120_0067559 3300048923 Bacteria 1974
102 Ga0496121_0429198 3300048924 Bacteria 858
103 Ga0496126_0441789 3300048929 Bacteria 1048
104 Ga0501031_0000035 3300049568 Bacteria 73884
105 Ga0501031_0090419 3300049568 Bacteria 1996
106 Ga0501032_0000022 3300049569 Bacteria 146790
107 Ga0501032_0061745 3300049569 Bacteria 2512
108 Ga0501033_0000037 3300049570 Bacteria 146582
109 Ga0501033_0004478 3300049570 Bacteria 11178
110 Ga0501033_0016823 3300049570 Bacteria 5529
111 Ga0501033_0024640 3300049570 Bacteria 4537
112 Ga0501033_0032239 3300049570 Bacteria 3935
113 Ga0501033_0084528 3300049570 Bacteria 2325
114 Ga0501033_0126008 3300049570 Bacteria 1857
115 Ga0501034_0000634 3300049571 Bacteria 54577
116 Ga0501034_0003398 3300049571 Bacteria 18168
117 Ga0501034_0029726 3300049571 Bacteria 5555
118 Ga0501034_0075617 3300049571 Bacteria 3374
119 Ga0501034_0107573 3300049571 Bacteria 2780
120 Ga0501034_0231323 3300049571 Bacteria 1797
121 Ga0501034_0317810 3300049571 Bacteria 1490
122 Ga0501034_0506222 3300049571 Bacteria 1121
123 Ga0501036_0000013 3300049572 Bacteria 155326
124 Ga0501037_0000016 3300049573 Bacteria 161027
125 Ga0501037_0000061 3300049573 Bacteria 98711
126 Ga0501037_0483759 3300049573 Bacteria 841
127 Ga0501038_0000015 3300049574 Bacteria 161983
128 Ga0501038_0093468 3300049574 Bacteria 2516
129 Ga0501038_0202590 3300049574 Bacteria 1592
130 Ga0501039_0000013 3300049575 Bacteria 234418
131 Ga0501039_0334875 3300049575 Bacteria 1189
132 Ga0501040_0007340 3300049576 Bacteria 7139
133 Ga0501042_0106934 3300049578 Bacteria 2014
134 Ga0501043_0000107 3300049579 Bacteria 77469
135 Ga0501043_0000299 3300049579 Bacteria 44816
136 Ga0501043_0036037 3300049579 Bacteria 3891
137 Ga0501043_0132429 3300049579 Bacteria 1954
138 Ga0501046_0040925 3300049580 Bacteria 3700
139 Ga0501046_0181681 3300049580 Bacteria 1572
140 Ga0501047_0033917 3300049581 Bacteria 4927
141 Ga0501047_0039885 3300049581 Bacteria 4542
142 Ga0501047_0048642 3300049581 Bacteria 4095
143 Ga0501047_0146527 3300049581 Bacteria 2238
144 Ga0501047_0230298 3300049581 Bacteria 1707
145 Ga0501047_0369311 3300049581 Bacteria 1270
146 Ga0501048_0020494 3300049582 Bacteria 4845
147 Ga0501067_0162317 3300049583 Bacteria 1244
148 Ga0501068_0008834 3300049584 Bacteria 5622
149 Ga0501068_0017718 3300049584 Bacteria 4121
150 Ga0501069_0000039 3300049585 Bacteria 82361
151 Ga0501069_0029482 3300049585 Bacteria 3011
152 Ga0501069_0081285 3300049585 Bacteria 1825
153 Ga0501070_0000132 3300049586 Bacteria 67092
154 Ga0501070_0002166 3300049586 Bacteria 17252
155 Ga0501070_0021348 3300049586 Bacteria 5433
156 Ga0501070_0129826 3300049586 Bacteria 2082
157 Ga0501071_0021397 3300049587 Bacteria 4503
158 Ga0501072_0199570 3300049588 Bacteria 1595
159 Ga0501073_0030884 3300049589 Bacteria 3825
160 Ga0501073_0092064 3300049589 Bacteria 2107
161 Ga0501074_0000037 3300049590 Bacteria 62760
162 Ga0501074_0025071 3300049590 Bacteria 4333
163 Ga0501074_0046098 3300049590 Bacteria 3152
164 Ga0501076_0129564 3300049592 Bacteria 2046
165 Ga0501079_0435739 3300049741 Bacteria 1029
166 Ga0501080_0001454 3300049742 Bacteria 19928
167 Ga0501080_0002010 3300049742 Bacteria 17571
168 Ga0501080_0046124 3300049742 Bacteria 4059
169 Ga0501083_0004586 3300049744 Bacteria 9761
170 Ga0501083_0107069 3300049744 Bacteria 1840
171 Ga0501035_0000046 3300049822 Bacteria 146599
172 Ga0501035_0000055 3300049822 Bacteria 139471
173 Ga0501035_0004171 3300049822 Bacteria 13736
174 Ga0501035_0014759 3300049822 Bacteria 7213
175 Ga0501035_0016289 3300049822 Bacteria 6857
176 Ga0501035_0019269 3300049822 Bacteria 6280
177 Ga0501035_0151861 3300049822 Bacteria 2009
178 Ga0501035_0190360 3300049822 Bacteria 1764
179 Ga0501035_0203526 3300049822 Bacteria 1696
180 Ga0501035_0264502 3300049822 Bacteria 1457
181 Ga0501044_0000038 3300049823 Bacteria 161027
182 Ga0501044_0000071 3300049823 Bacteria 124531
183 Ga0501044_0011679 3300049823 Bacteria 9518
184 Ga0501044_0013502 3300049823 Bacteria 8833
185 Ga0501044_0074452 3300049823 Bacteria 3450
186 Ga0501044_0095900 3300049823 Bacteria 2988
187 Ga0501044_0256117 3300049823 Bacteria 1689
188 Ga0501044_0338052 3300049823 Bacteria 1427
189 Ga0501045_0037917 3300049824 Bacteria 3505
190 Ga0501045_0265372 3300049824 Bacteria 1278
191 nmdc:mga03683_65414_c1 3300050489 Bacteria 1544
192 nmdc:mga0yw44_11550_c1 3300050492 Bacteria 4566
193 nmdc:mga0yw44_162030_c1 3300050492 Bacteria 1465
194 nmdc:mga0yw44_34617_c1 3300050492 Bacteria 2960
195 nmdc:mga0yw44_5682_c1 3300050492 Bacteria 5936
196 nmdc:mga06z11_205729_c1 3300050494 Bacteria 1145
197 nmdc:mga04h51_12555_c1 3300050495 Bacteria 2380
198 nmdc:mga07m45_14456_c1 3300050496 Bacteria 4204
199 nmdc:mga07m45_64343_c1 3300050496 Bacteria 2081
200 nmdc:mga0sz30_67563_c1 3300050516 Bacteria 1535
201 nmdc:mga0sz30_8408_c1 3300050516 Bacteria 3898
202 Ga0500610_0017425 3300053079 Bacteria 3451
203 Ga0495655_0049101 3300053083 Bacteria 1110
204 Ga0500658_0025382 3300053134 Bacteria 2277
205 Ga0500658_0032514 3300053134 Bacteria 2047
206 Ga0500559_0013271 3300053136 Bacteria 3491
207 Ga0500568_0000283 3300053139 Bacteria 42124
208 Ga0500604_0019344 3300053151 Bacteria 1906
209 Ga0500620_000068 3300053155 Bacteria 19837
210 Ga0500627_0020753 3300053158 Bacteria 2639
211 2503201902 2503198000 Bacteria 6884444
212 2509367555 2509276018 Bacteria 6910194
213 2509396579 2509276022 Bacteria 6200534
214 2510313660 2510065059 Bacteria 6847884
215 2512931204 2512875016 Bacteria 6529530
216 2512959022 2512875024 Bacteria 7195110
217 2513610836 2513237090 Bacteria 7096802
218 2514038301 2513237164 Bacteria 7563725
219 2588516984 2588253730 Bacteria 6881675
220 2599938451 2599185301 Bacteria 6161860
221 2643775867 2643221551 Bacteria 3750538
222 2643794314 2643221555 Bacteria 3749717
223 2643984663 2643221595 Bacteria 6565519
224 2644158513 2643221627 Bacteria 6761570
225 2688598717 2687453392 Bacteria 6880454
226 2694638226 2693429784 Bacteria 7241525
227 2723575666 2721755686 Bacteria 7343952
228 2739308241 2738543024 Bacteria 5603683
229 2756675968 2756170246 Bacteria 7451806
230 2792749526 2791355123 Bacteria 8049106
231 2841739549 2841734538 Bacteria 6784580
232 2844007140 2844002411 Bacteria 7168230
233 2844014022 2844009547 Bacteria 6728125
234 2847675865 2847670302 Bacteria 6165597
235 2856314591 2856314179 Bacteria 6477897
236 2856331373 2856328259 Bacteria 6528202
237 2856355270 2856349417 Bacteria 6230045
238 2856362665 2856356410 Bacteria 6297484
239 2857350798 2857349434 Bacteria 7926032
240 2857371862 2857367948 Bacteria 6965560
241 2869168904 2869162929 Bacteria 6399702
242 2869175258 2869169390 Bacteria 6659796
243 2869239525 2869234852 Bacteria 6654993
244 2869255003 2869249662 Bacteria 6868783
245 2869265933 2869264136 Bacteria 6880765
246 2869272416 2869271264 Bacteria 6908218
247 2869291857 2869285874 Bacteria 6901219
248 2871435066 2871429161 Bacteria 6547891
249 2871447537 2871444079 Bacteria 6423508
250 2871452241 2871451962 Bacteria 7336357
251 2871463209 2871459585 Bacteria 6866887
252 2871468381 2871466892 Bacteria 6923287
253 2871487804 2871481445 Bacteria 6700002
254 2871491263 2871488783 Bacteria 6929816
255 2871502967 2871495908 Bacteria 6935695
256 2874102547 2874102143 Bacteria 6342645
257 2874116176 2874109183 Bacteria 6517025
258 2874123195 2874116593 Bacteria 6674494
259 2874123768 2874123672 Bacteria 7238285
260 2874138183 2874131515 Bacteria 6820270
261 2874146162 2874139085 Bacteria 7021506
262 2874149457 2874146452 Bacteria 7533118
263 2874157720 2874155637 Bacteria 6724144
264 2874164364 2874162495 Bacteria 6174670
265 2874174520 2874168670 Bacteria 8062617
266 2876369262 2876363079 Bacteria 6544991
267 2876370143 2876369609 Bacteria 6807521
268 2876379430 2876377896 Bacteria 6565995
269 2876392452 2876386047 Bacteria 6698674
270 2876394514 2876392853 Bacteria 6660880
271 2876405920 2876399893 Bacteria 6927900
272 2876407222 2876406927 Bacteria 6191900
273 2876415923 2876413966 Bacteria 6831344
274 2876427521 2876420981 Bacteria 6687741
275 2878039936 2878035449 Bacteria 6555736
276 2878731546 2878730984 Bacteria 6380721
277 2878745541 2878738818 Bacteria 7136951
278 2878752201 2878745973 Bacteria 6867388
279 2878757698 2878753008 Bacteria 6922523
280 2878766859 2878760144 Bacteria 6823465
281 2878774056 2878767105 Bacteria 6898628
282 2878777378 2878774303 Bacteria 6108671
283 2878788432 2878781027 Bacteria 6834456
284 2878795391 2878788777 Bacteria 6567085
285 2881151805 2881147464 Bacteria 7779814
286 2881155586 2881155292 Bacteria 6461656
287 2881167815 2881161766 Bacteria 7127907
288 2881852037 2881845957 Bacteria 6611900
289 2881856805 2881853255 Bacteria 6698367
290 2881866648 2881861095 Bacteria 7128710
291 2882636551 2882632389 Bacteria 8154593
292 2882916225 2882912400 Bacteria 6801539
293 2885309711 2885305155 Bacteria 7348390
294 2885320146 2885318864 Bacteria 6729568
295 2885330549 2885326080 Bacteria 7134805
296 2885334690 2885334103 Bacteria 7216818
297 2885349814 2885342637 Bacteria 7011821
298 2885354343 2885350715 Bacteria 6787678
299 2888339712 2888337043 Bacteria 6629336
300 2888347081 2888343758 Bacteria 6611049
301 2889010980 2889010040 Bacteria 6749192
302 2889017329 2889016732 Bacteria 6700763
303 2903455326 2903448605 Bacteria 7357801
304 2903493241 2903492973 Bacteria 13473544
305 2903506373 2903492973 Bacteria 13473544
306 2903516465 2903513507 Bacteria 6344008
307 2903523131 2903521522 Bacteria 6525694
308 2903534409 2903528002 Bacteria 6586099
309 2903548106 2903540706 Bacteria 7062119
310 2904661148 2904659560 Bacteria 6685615
311 2906314595 2906308376 Bacteria 6841989
312 2906327763 2906321335 Bacteria 6579571
313 2906329759 2906328253 Bacteria 6585166
314 2906359221 2906354277 Bacteria 6991324
315 2906370635 2906363423 Bacteria 6856682
316 2906371659 2906370794 Bacteria 6881062
317 2906385022 2906378014 Bacteria 6911440
318 2906390594 2906386501 Bacteria 5977019
319 2906395355 2906393657 Bacteria 6790866
320 2906401803 2906401398 Bacteria 6693206
321 2906412188 2906408224 Bacteria 6162342
322 2906414544 2906414383 Bacteria 6580790
323 2922132245 2922130491 Bacteria 7173936
324 2922151392 2922151315 Bacteria 6902399
325 2922158631 2922158528 Bacteria 6573167
326 2922174523 2922172374 Bacteria 6167644
327 2922185012 2922178524 Bacteria 6025201
328 2924718266 2924710171 Bacteria 6752351
329 2924731989 2924726620 Bacteria 6271473
330 2924739442 2924733363 Bacteria 7574837
331 2924744378 2924741084 Bacteria 6661321
332 2924753964 2924748358 Bacteria 6154725
333 2924759650 2924754689 Bacteria 6774424
334 2924764145 2924762789 Bacteria 6561353
335 2924783785 2924776078 Bacteria 7492003
336 2924789366 2924784321 Bacteria 7416538
337 2937816102 2937813078 Bacteria 7783518
338 2937824763 2937822353 Bacteria 7290551
339 2937852900 2937848649 Bacteria 6983481
340 2937863421 2937861824 Bacteria 6660327
341 2937873753 2937868953 Bacteria 6639878
342 2937880486 2937877337 Bacteria 7246526
343 2937893694 2937891427 Bacteria 6357007
344 2937975575 2937972304 Bacteria 7532020
345 2937988163 2937980651 Bacteria 6517427
346 2938001982 2937994558 Bacteria 7036190
347 2938020594 2938014810 Bacteria 6700592
348 2958067701 2958064165 Bacteria 7158582
349 2958072962 2958071322 Bacteria 6815895
350 2958087620 2958084443 Bacteria 7312792
351 2958093483 2958092219 Bacteria 6861151
352 2958106864 2958100919 Bacteria 6800575
353 2958110834 2958108152 Bacteria 6681128
354 2958118706 2958115193 Bacteria 6923548
355 2958125802 2958122699 Bacteria 7280457
356 2958136255 2958130278 Bacteria 6897202
357 2958144053 2958137437 Bacteria 6050276
358 2958145311 2958144490 Bacteria 6677056
359 2958163158 2958158011 Bacteria 6058449
360 2958172037 2958165035 Bacteria 6906348
361 2958176030 2958172287 Bacteria 6716688
362 2958185723 2958179912 Bacteria 6874908
363 2961084100 2961077736 Bacteria 7079850
364 2961116299 2961114664 Bacteria 6680456
365 2961133816 2961127735 Bacteria 7196641
366 2961140761 2961136820 Bacteria 6775228
367 2961170483 2961163497 Bacteria 6901077
368 2961174241 2961170736 Bacteria 7072258
369 2961184597 2961183825 Bacteria 6688536
370 2963648015 2963644680 Bacteria 6530403
371 2965025229 2965018300 Bacteria 6883036
372 2965026431 2965025482 Bacteria 6532201
373 2965041618 2965040258 Bacteria 6855979
374 2965065499 2965062239 Bacteria 7412989
375 2965091128 2965089291 Bacteria 6866420
376 2965109859 2965102966 Bacteria 6800987
377 2965113904 2965110997 Bacteria 6693150
378 2965119630 2965119406 Bacteria 6956431
379 2968000188 2967996073 Bacteria 6787468
380 2968005540 2968003550 Bacteria 6929263
381 2968018153 2968016561 Bacteria 7022047
382 2968090836 2968083720 Bacteria 7351627
383 2968096521 2968091066 Bacteria 6052692
384 2968098989 2968097103 Bacteria 6107094
385 2968112205 2968110612 Bacteria 6814636
386 2968120968 2968117919 Bacteria 6536078
387 2968132572 2968128360 Bacteria 6270294
388 2968138905 2968138860 Bacteria 6605449
389 2968178870 2968171901 Bacteria 6894245
390 2970471673 2970469710 Bacteria 6969209
391 2970495619 2970489779 Bacteria 6517260
392 2970506828 2970503327 Bacteria 7099517
393 2970517697 2970510686 Bacteria 7006402
394 2970533003 2970532167 Bacteria 6553173
395 2970546000 2970540015 Bacteria 6977556
396 2970549356 2970547951 Bacteria 6931819
397 2970561715 2970554993 Bacteria 6814252
398 2970619571 2970619444 Bacteria 6986144
399 2970633620 2970627176 Bacteria 6680862
400 2977822230 2977821940 Bacteria 6906439
401 2977846338 2977843712 Bacteria 6753583
402 2977857089 2977851361 Bacteria 6694324
403 2977860437 2977858184 Bacteria 6215359
404 2977868970 2977864932 Bacteria 7534097
405 2977877414 2977872689 Bacteria 7270173
406 2977901935 2977898635 Bacteria 6675551
407 2977913486 2977907340 Bacteria 6577984
408 2977917500 2977915119 Bacteria 6829656
409 2977924519 2977922695 Bacteria 6956781
410 2977941369 2977935797 Bacteria 6252826
411 2977947500 2977942078 Bacteria 7570577
412 2977951191 2977950692 Bacteria 6893264
413 2977960106 2977957713 Bacteria 6877875
414 2977977624 2977971508 Bacteria 7472917
415 2977988323 2977986579 Bacteria 6581278
416 2979714517 2979710463 Bacteria 6785254
417 2979743001 2979742915 Bacteria 7301278
418 2979770982 2979764755 Bacteria 6610066
419 2979773771 2979772303 Bacteria 6618277
420 2979785038 2979779861 Bacteria 6219781
421 2979796597 2979793036 Bacteria 6808957
422 2979812023 2979808191 Bacteria 7179355
423 2987637983 2987636660 Bacteria 8088555
424 2987651377 2987645492 Bacteria 6117018
425 2987655897 2987652177 Bacteria 6969023
426 2987666724 2987659509 Bacteria 6966464
427 2987668950 2987666974 Bacteria 6509233
428 2987677005 2987673487 Bacteria 6884027
429 2996313814 2996310559 Bacteria 6357320
430 2996347369 2996341866 Bacteria 6643098
431 2996350458 2996348954 Bacteria 7239054
432 2996389936 2996386984 Bacteria 6978667
433 3000140316 3000135777 Bacteria 6891109
434 3004169206 3004167301 Bacteria 8330599
435 3004195726 3004188549 Bacteria 6952365
436 3004196172 3004195979 Bacteria 6776956
437 3004205695 3004203850 Bacteria 7307914
438 3004216252 3004211236 Bacteria 7417683
439 3004224002 3004218560 Bacteria 7421728
440 3004235097 3004232784 Bacteria 6662140
441 3004241516 3004239961 Bacteria 6892290
442 3004253286 3004248173 Bacteria 6563236
443 3004268810 3004268573 Bacteria 7043476
444 3004277156 3004275668 Bacteria 7114440
445 3004290191 3004289098 Bacteria 6135450
446 3004341414 3004334049 Bacteria 8449246
447 637074306 637000159 Bacteria 7596297
448 649873234 649633066 Bacteria 6690028
449 8002288789 8002285264 Bacteria 6717907
450 8004306641 8004300914 Bacteria 6132239
451 8004362805 8004361976 Bacteria 6858373
452 8004379209 8004374579 Bacteria 6898112
453 8004394417 8004387939 Bacteria 7049250
454 8004451063 8004445564 Bacteria 6322258
455 8004634878 8004633249 Bacteria 6723080
456 8004640532 8004640170 Bacteria 6723001
457 8004700962 8004695233 Bacteria 6731676
458 8004709608 8004703790 Bacteria 8006957
459 8004720856 8004714634 Bacteria 6776161
460 8004731934 8004727605 Bacteria 6643904
461 Ga0496108_0518932
462 JGI24740J21852_10022833
463 JGI24739J22299_10056649
464 JGI25156J39149_1001756
465 JGI25157J39369_1000751
466 JGI25165J46597_1000062
467 Ga0055542_1000395
468 Ga0055529_1002810
469 Ga0070660_100045304
470 Ga0070674_100599989
471 Ga0070663_100017854
472 Ga0070663_100076265
473 Ga0068867_100560582
474 Ga0070685_10431356
475 Ga0068853_100001788
476 Ga0070665_100040489
477 Ga0070665_100083099
478 Ga0070665_100113495
479 Ga0070665_100153398
480 Ga0070665_100357670
481 Ga0070665_100968410
482 Ga0068855_100577163
483 Ga0068856_100531089
484 Ga0068852_100398633
485 Ga0081539_10001801
486 Ga0075365_10007380
487 Ga0075365_10120564
488 Ga0075365_10137328
489 Ga0075365_10416222
490 Ga0075368_10021418
491 Ga0075363_100021082
492 Ga0075363_100042540
493 Ga0075367_10029548
494 Ga0075369_10037104
495 Ga0075369_10058815
496 Ga0075370_10131652
497 Ga0105240_10038269
498 Ga0105240_10327369
499 Ga0105248_10709414
500 Ga0105237_10004482
501 Ga0105237_10093868
502 Ga0105237_10324419
503 Ga0105238_10003702
504 Ga0105238_10086913
505 Ga0105239_10004313
506 Ga0105239_10171453
507 Ga0105239_10181399
508 Ga0105239_10183729
509 Ga0105239_10295948
510 Ga0157370_10575170
511 Ga0157369_10124298
512 Ga0157372_10450109
513 Ga0182008_10030913
514 Ga0182008_10180108
515 Ga0182006_1032404
516 Ga0209026_1000024
517 Ga0209148_1000050
518 Ga0209759_1000057
519 Ga0209233_1000129
520 Ga0209455_1000228
521 Ga0207647_10039944
522 Ga0207671_10103174
523 Ga0207671_10212700
524 Ga0207657_10071766
525 Ga0207649_10052929
526 Ga0207694_10202402
527 Ga0207694_10409791
528 Ga0207669_10029207
529 Ga0207711_10539463
530 Ga0207667_10212212
531 Ga0207639_10137820
532 Ga0207678_10031158
533 Ga0207678_10082803
534 Ga0207678_10548239
535 Ga0207698_10643379
536 Ga0268266_10034604
537 Ga0268266_10071653
538 Ga0268266_10216842
539 Ga0268266_10347115
540 Ga0268266_10542023
541 Ga0307412_10204495
542 Ga0307414_10311259
543 Ga0395900_0040567
544 Ga0395900_0090082
545 Ga0395900_0090102
546 Ga0395905_0010722
547 Ga0395905_0100843
548 Ga0395901_0120636
549 Ga0395901_0131473
550 Ga0395901_0144560
551 Ga0451833_1234222
552 Ga0466960_0125666
553 Ga0495638_0007770
554 Ga0495637_0053618
555 Ga0495625_0017610
556 Ga0495687_056642
557 Ga0496112_0020064
558 Ga0496117_0263906
559 Ga0496119_0053952
560 Ga0496119_0145186
561 Ga0496120_0067559
562 Ga0496121_0429198
563 Ga0496126_0441789
564 Ga0501031_0000035
565 Ga0501031_0090419
566 Ga0501032_0000022
567 Ga0501032_0061745
568 Ga0501033_0000037
569 Ga0501033_0004478
570 Ga0501033_0016823
571 Ga0501033_0024640
572 Ga0501033_0032239
573 Ga0501033_0084528
574 Ga0501033_0126008
575 Ga0501034_0000634
576 Ga0501034_0003398
577 Ga0501034_0029726
578 Ga0501034_0075617
579 Ga0501034_0107573
580 Ga0501034_0231323
581 Ga0501034_0317810
582 Ga0501034_0506222
583 Ga0501036_0000013
584 Ga0501037_0000016
585 Ga0501037_0000061
586 Ga0501037_0483759
587 Ga0501038_0000015
588 Ga0501038_0093468
589 Ga0501038_0202590
590 Ga0501039_0000013
591 Ga0501039_0334875
592 Ga0501040_0007340
593 Ga0501042_0106934
594 Ga0501043_0000107
595 Ga0501043_0000299
596 Ga0501043_0036037
597 Ga0501043_0132429
598 Ga0501046_0040925
599 Ga0501046_0181681
600 Ga0501047_0033917
601 Ga0501047_0039885
602 Ga0501047_0048642
603 Ga0501047_0146527
604 Ga0501047_0230298
605 Ga0501047_0369311
606 Ga0501048_0020494
607 Ga0501067_0162317
608 Ga0501068_0008834
609 Ga0501068_0017718
610 Ga0501069_0000039
611 Ga0501069_0029482
612 Ga0501069_0081285
613 Ga0501070_0000132
614 Ga0501070_0002166
615 Ga0501070_0021348
616 Ga0501070_0129826
617 Ga0501071_0021397
618 Ga0501072_0199570
619 Ga0501073_0030884
620 Ga0501073_0092064
621 Ga0501074_0000037
622 Ga0501074_0025071
623 Ga0501074_0046098
624 Ga0501076_0129564
625 Ga0501079_0435739
626 Ga0501080_0001454
627 Ga0501080_0002010
628 Ga0501080_0046124
629 Ga0501083_0004586
630 Ga0501083_0107069
631 Ga0501035_0000046
632 Ga0501035_0000055
633 Ga0501035_0004171
634 Ga0501035_0014759
635 Ga0501035_0016289
636 Ga0501035_0019269
637 Ga0501035_0151861
638 Ga0501035_0190360
639 Ga0501035_0203526
640 Ga0501035_0264502
641 Ga0501044_0000038
642 Ga0501044_0000071
643 Ga0501044_0011679
644 Ga0501044_0013502
645 Ga0501044_0074452
646 Ga0501044_0095900
647 Ga0501044_0256117
648 Ga0501044_0338052
649 Ga0501045_0037917
650 Ga0501045_0265372
651 nmdc:mga03683_65414_c1
652 nmdc:mga0yw44_11550_c1
653 nmdc:mga0yw44_162030_c1
654 nmdc:mga0yw44_34617_c1
655 nmdc:mga0yw44_5682_c1
656 nmdc:mga06z11_205729_c1
657 nmdc:mga04h51_12555_c1
658 nmdc:mga07m45_14456_c1
659 nmdc:mga07m45_64343_c1
660 nmdc:mga0sz30_67563_c1
661 nmdc:mga0sz30_8408_c1
662 Ga0500610_0017425
663 Ga0495655_0049101
664 Ga0500658_0025382
665 Ga0500658_0032514
666 Ga0500559_0013271
667 Ga0500568_0000283
668 Ga0500604_0019344
669 Ga0500620_000068
670 Ga0500627_0020753
671 2503201902
672 2509367555
673 2509396579
674 2510313660
675 2512931204
676 2512959022
677 2513610836
678 2514038301
679 2588516984
680 2599938451
681 2643775867
682 2643794314
683 2643984663
684 2644158513
685 2688598717
686 2694638226
687 2723575666
688 2739308241
689 2756675968
690 2792749526
691 2841739549
692 2844007140
693 2844014022
694 2847675865
695 2856314591
696 2856331373
697 2856355270
698 2856362665
699 2857350798
700 2857371862
701 2869168904
702 2869175258
703 2869239525
704 2869255003
705 2869265933
706 2869272416
707 2869291857
708 2871435066
709 2871447537
710 2871452241
711 2871463209
712 2871468381
713 2871487804
714 2871491263
715 2871502967
716 2874102547
717 2874116176
718 2874123195
719 2874123768
720 2874138183
721 2874146162
722 2874149457
723 2874157720
724 2874164364
725 2874174520
726 2876369262
727 2876370143
728 2876379430
729 2876392452
730 2876394514
731 2876405920
732 2876407222
733 2876415923
734 2876427521
735 2878039936
736 2878731546
737 2878745541
738 2878752201
739 2878757698
740 2878766859
741 2878774056
742 2878777378
743 2878788432
744 2878795391
745 2881151805
746 2881155586
747 2881167815
748 2881852037
749 2881856805
750 2881866648
751 2882636551
752 2882916225
753 2885309711
754 2885320146
755 2885330549
756 2885334690
757 2885349814
758 2885354343
759 2888339712
760 2888347081
761 2889010980
762 2889017329
763 2903455326
764 2903493241
765 2903506373
766 2903516465
767 2903523131
768 2903534409
769 2903548106
770 2904661148
771 2906314595
772 2906327763
773 2906329759
774 2906359221
775 2906370635
776 2906371659
777 2906385022
778 2906390594
779 2906395355
780 2906401803
781 2906412188
782 2906414544
783 2922132245
784 2922151392
785 2922158631
786 2922174523
787 2922185012
788 2924718266
789 2924731989
790 2924739442
791 2924744378
792 2924753964
793 2924759650
794 2924764145
795 2924783785
796 2924789366
797 2937816102
798 2937824763
799 2937852900
800 2937863421
801 2937873753
802 2937880486
803 2937893694
804 2937975575
805 2937988163
806 2938001982
807 2938020594
808 2958067701
809 2958072962
810 2958087620
811 2958093483
812 2958106864
813 2958110834
814 2958118706
815 2958125802
816 2958136255
817 2958144053
818 2958145311
819 2958163158
820 2958172037
821 2958176030
822 2958185723
823 2961084100
824 2961116299
825 2961133816
826 2961140761
827 2961170483
828 2961174241
829 2961184597
830 2963648015
831 2965025229
832 2965026431
833 2965041618
834 2965065499
835 2965091128
836 2965109859
837 2965113904
838 2965119630
839 2968000188
840 2968005540
841 2968018153
842 2968090836
843 2968096521
844 2968098989
845 2968112205
846 2968120968
847 2968132572
848 2968138905
849 2968178870
850 2970471673
851 2970495619
852 2970506828
853 2970517697
854 2970533003
855 2970546000
856 2970549356
857 2970561715
858 2970619571
859 2970633620
860 2977822230
861 2977846338
862 2977857089
863 2977860437
864 2977868970
865 2977877414
866 2977901935
867 2977913486
868 2977917500
869 2977924519
870 2977941369
871 2977947500
872 2977951191
873 2977960106
874 2977977624
875 2977988323
876 2979714517
877 2979743001
878 2979770982
879 2979773771
880 2979785038
881 2979796597
882 2979812023
883 2987637983
884 2987651377
885 2987655897
886 2987666724
887 2987668950
888 2987677005
889 2996313814
890 2996347369
891 2996350458
892 2996389936
893 3000140316
894 3004169206
895 3004195726
896 3004196172
897 3004205695
898 3004216252
899 3004224002
900 3004235097
901 3004241516
902 3004253286
903 3004268810
904 3004277156
905 3004290191
906 3004341414
907 637074306
908 649873234
909 8002288789
910 8004306641
911 8004362805
912 8004379209
913 8004394417
914 8004451063
915 8004634878
916 8004640532
917 8004700962
918 8004709608
919 8004720856
920 8004731934

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

17

244

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.8881 2 243
1ggv-assembly1.cif.gz_A crystal structure of the c123s mutant of dienelactone hydrolase (dlh) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf) 0.883 1 244
1ziy-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase mutant (c123s) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf)- 1.9 a 0.8816 1 241
1ggv-assembly1.cif.gz_A crystal structure of the c123s mutant of dienelactone hydrolase (dlh) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf) 0.8794 1 244
4u2b-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (c123s) at 1.70 a resolution 0.8773 6 244
ID Description Score Start End Superfamily
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9648 3 239 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.953 3 239 3.40.50.1820
af_Q54MZ9_1_255_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.914 1 243 3.40.50.1820
af_Q54MZ9_1_255_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9069 1 243 3.40.50.1820
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8918 2 243 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A530BR88-F1-model_v4 Dienelactone hydrolase family protein 0.9924 34 244 GO:0016787
AF-A0A526RRU4-F1-model_v4 Dienelactone hydrolase family protein 0.9906 48 244 GO:0016787
AF-A0A529VUX1-F1-model_v4 deleted 0.9902 1 149
AF-A0A5R2N1X5-F1-model_v4 Dienelactone hydrolase family protein 0.9901 20 144 GO:0016787
AF-A0A436CPQ2-F1-model_v4 Dienelactone hydrolase family protein 0.988 1 202 GO:0016787

Map