F448602

General Info

Members Datasets Scaffolds Average Seq Length
460 169 436 251

Family's Representative Sequence

Representative Sequence 3300046506|Ga0495583_0000049|Ga0495583_0000049_124697_125551
Length 284
Sequence MLNLRKRMAHRRRPRRTRPDSSNHKKENRLGPMQSTNDFGLENWHDYEVGSRREIIALLRSIGEKNQLIRMLIHGEADVCVTSILDVDPDTNTLILDRSVNRDQNQRILAARRISYETTLDKIRILFASDAVTETEYDQRPALRIAVPATLVRLQRREFYRMATPVSNPVRAIIPLPEELGGGSAIFPLADISCGGIAMLDNKFMLGNTIGINYPGCRIDLPDIGTVMTTLQVRNSLDLTLLNNKANRRLGCHFIDISRANLAMVQRYITKLERERNARIAGLS

Samples

Sample ID Description Type Environment
1 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
2 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
3 2643221638 Duganella sp. Root336D2 Isolate Unclassified
4 2643221645 Massilia sp. Root351 Isolate Unclassified
5 2738541280 Massilia sp. GV090 Isolate Unclassified
6 2738541297 Duganella sp. GV083 Isolate Unclassified
7 2738541300 Massilia sp. GV016 Isolate Unclassified
8 2738541357 Duganella sp. GV053 Isolate Unclassified
9 2738543003 Duganella sp. GV066 Isolate Unclassified
10 2738543018 Massilia sp. GV045 Isolate Unclassified
11 2738543026 Duganella sp. GV089 Isolate Unclassified
12 2738543029 Duganella sp. GV039 Isolate Unclassified
13 2738543030 Massilia sp. GV097 Isolate Unclassified
14 2821131069 Duganella sp. 1224 Isolate Unclassified
15 2842711865 Duganella sp. R-73148 Isolate Unclassified
16 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
17 2857553236 Duganella sp. R-74557 Isolate Unclassified
18 2857558681 Duganella sp. R-74565 Isolate Unclassified
19 2857564685 Duganella sp. R-74599 Isolate Unclassified
20 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
21 2904424332 Duganella sp. 1411 Isolate Rhizosphere
22 2919476304 Duganella sp. 3397 Isolate Unclassified
23 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
24 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
25 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
26 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
27 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
28 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
29 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
30 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
31 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
32 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
33 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
34 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
37 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
38 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
39 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
40 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
41 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
50 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
51 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
54 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
56 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
57 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
58 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
59 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
74 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
83 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
84 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
87 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
88 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
89 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
90 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
91 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
92 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
93 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
94 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
95 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
96 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
97 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
98 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
99 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
100 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
101 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
105 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
106 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
107 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
108 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
109 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
110 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
111 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
112 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
113 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
114 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
115 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
116 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
117 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
118 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
119 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
124 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
130 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
131 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
132 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
133 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
140 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
141 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
142 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
143 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
144 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
145 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
146 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
147 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
156 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
157 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
158 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
159 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
162 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
163 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
164 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
165 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
166 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
167 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
168 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
169 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.78
Metatranscriptomes 0
Isolates 5.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.39
Nodule 0.22
Rhizoplane 2.39
Rhizosphere 71.09
Stem 0
Stem Tuber 0
Unclassified 8.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1001870 3300002738 Bacteria 6411
2 JGI25152J39213_1000661 3300002773 Bacteria 18007
3 JGI25152J39213_1009873 3300002773 Bacteria 2227
4 JGI25150J39212_1001342 3300002774 Bacteria 6998
5 JGI25150J39212_1017311 3300002774 Bacteria 1166
6 JGI25159J45721_1003969 3300002987 Bacteria 5045
7 JGI25159J45721_1007888 3300002987 Bacteria 2992
8 JGI25153J46596_10002108 3300003215 Bacteria 11647
9 JGI25153J46596_10059428 3300003215 Bacteria 1047
10 rootH2_10035623 3300003320 Bacteria 2436
11 rootL2_10068323 3300003322 Bacteria 2538
12 rootL2_10106234 3300003322 Bacteria 4932
13 JGI25160J50197_1006033 3300003354 Bacteria 4955
14 JGI25161J50226_1002114 3300003374 Bacteria 5346
15 JGI25161J50226_1002569 3300003374 Bacteria 4577
16 Ga0055529_1000185 3300003763 Bacteria 85584
17 Ga0055526_1002381 3300003771 Bacteria 12740
18 Ga0055526_1002451 3300003771 Bacteria 12541
19 Ga0055526_1015442 3300003771 Bacteria 3064
20 Ga0055537_1000072 3300003773 Bacteria 73276
21 Ga0055537_1014691 3300003773 Bacteria 1408
22 Ga0055537_1023860 3300003773 Bacteria 868
23 Ga0055524_1001485 3300003775 Bacteria 13375
24 Ga0055524_1009540 3300003775 Bacteria 3935
25 Ga0055524_1035287 3300003775 Bacteria 1366
26 Ga0055534_1000136 3300003784 Bacteria 55242
27 Ga0055534_1001319 3300003784 Bacteria 9980
28 Ga0055528_1000025 3300003790 Bacteria 130730
29 Ga0055528_1005148 3300003790 Bacteria 6152
30 Ga0055530_10032562 3300003791 Bacteria 1354
31 Ga0055543_1001185 3300004625 Bacteria 10992
32 Ga0055543_1005934 3300004625 Bacteria 3037
33 Ga0065165_1000094 3300005262 Bacteria 146099
34 Ga0065165_1007529 3300005262 Bacteria 5323
35 Ga0075363_100143584 3300006048 Bacteria 1345
36 Ga0079104_1028269 3300006946 Bacteria 1426
37 Ga0105244_10005704 3300009036 Bacteria 8218
38 Ga0105244_10009302 3300009036 Bacteria 6054
39 Ga0105248_10994999 3300009177 Bacteria 947
40 Ga0157371_10000001 3300013102 Bacteria 1162285
41 Ga0182008_10000671 3300014497 Bacteria 24825
42 Ga0182008_10017414 3300014497 Bacteria 3728
43 Ga0182006_1000075 3300015261 Bacteria 130239
44 Ga0182006_1000163 3300015261 Bacteria 70369
45 Ga0182007_10000135 3300015262 Bacteria 51737
46 Ga0182007_10053926 3300015262 Bacteria 1323
47 Ga0182005_1000020 3300015265 Bacteria 278671
48 Ga0182005_1000106 3300015265 Bacteria 63464
49 Ga0163161_10122170 3300017792 Bacteria 1958
50 Ga0213872_10000002 3300021361 Bacteria 554092
51 Ga0213872_10001032 3300021361 Bacteria 19398
52 Ga0213872_10011587 3300021361 Bacteria 4168
53 Ga0213872_10113421 3300021361 Bacteria 1202
54 Ga0209436_102373 3300025208 Bacteria 5720
55 Ga0209436_102579 3300025208 Bacteria 5331
56 Ga0209437_109112 3300025233 Bacteria 1561
57 Ga0209437_110937 3300025233 Bacteria 1370
58 Ga0207425_1000001 3300025245 Bacteria 2525432
59 Ga0207425_1000153 3300025245 Bacteria 58689
60 Ga0207425_1001176 3300025245 Bacteria 11658
61 Ga0209646_1000028 3300025246 Bacteria 387986
62 Ga0209129_1000001 3300025258 Bacteria 1452436
63 Ga0209129_1005405 3300025258 Bacteria 4536
64 Ga0209565_1000009 3300025263 Bacteria 751701
65 Ga0209565_1000404 3300025263 Bacteria 36034
66 Ga0209565_1013552 3300025263 Bacteria 1904
67 Ga0209565_1017174 3300025263 Bacteria 1591
68 Ga0209565_1029395 3300025263 Bacteria 1079
69 Ga0209455_1000049 3300025272 Bacteria 374414
70 Ga0209673_1000036 3300025273 Bacteria 323162
71 Ga0209673_1003169 3300025273 Bacteria 10027
72 Ga0209130_1000455 3300025284 Bacteria 43009
73 Ga0209130_1001251 3300025284 Bacteria 17718
74 Ga0209130_1011148 3300025284 Bacteria 2422
75 Ga0209675_1000013 3300025291 Bacteria 448220
76 Ga0209675_1001097 3300025291 Bacteria 16631
77 Ga0209675_1003287 3300025291 Bacteria 7773
78 Ga0209025_1005178 3300025294 Bacteria 10777
79 Ga0209564_1000009 3300025295 Bacteria 950196
80 Ga0209564_1000045 3300025295 Bacteria 376549
81 Ga0209564_1000175 3300025295 Bacteria 153109
82 Ga0209564_1000515 3300025295 Bacteria 63379
83 Ga0209564_1001461 3300025295 Bacteria 23999
84 Ga0209564_1039077 3300025295 Bacteria 1309
85 Ga0209758_1000149 3300025297 Bacteria 163504
86 Ga0209758_1000230 3300025297 Bacteria 119426
87 Ga0209050_1000905 3300025298 Bacteria 39208
88 Ga0209050_1001360 3300025298 Bacteria 26768
89 Ga0209050_1002963 3300025298 Bacteria 13263
90 Ga0209256_1000005 3300025299 Bacteria 1315082
91 Ga0209256_1000358 3300025299 Bacteria 74650
92 Ga0209256_1000886 3300025299 Bacteria 36957
93 Ga0209256_1001613 3300025299 Bacteria 22014
94 Ga0209256_1002010 3300025299 Bacteria 18153
95 Ga0207426_1002658 3300025302 Bacteria 10981
96 Ga0207426_1007346 3300025302 Bacteria 4626
97 Ga0209051_1031627 3300025303 Bacteria 2032
98 Ga0209257_1000486 3300025304 Bacteria 71627
99 Ga0207655_1007880 3300025728 Bacteria 6845
100 Ga0207655_1013471 3300025728 Bacteria 4693
101 Ga0316180_1012425 3300030736 Bacteria 2986
102 Ga0316182_1091011 3300030745 Bacteria 947
103 Ga0307408_100000182 3300031548 Bacteria 69692
104 Ga0307408_100000837 3300031548 Bacteria 24309
105 Ga0307408_100046659 3300031548 Bacteria 3099
106 Ga0307408_100071523 3300031548 Bacteria 2565
107 Ga0307414_10051777 3300032004 Bacteria 2852
108 Ga0395899_0004489 3300037312 Bacteria 10874
109 Ga0395900_0016198 3300037418 Bacteria 7594
110 Ga0395900_0133109 3300037418 Bacteria 2547
111 Ga0395898_0265517 3300037466 Bacteria 1637
112 Ga0395905_0121898 3300037471 Bacteria 2451
113 Ga0395905_0300484 3300037471 Bacteria 1492
114 Ga0395901_0560124 3300038443 Bacteria 1157
115 Ga0436361_0140501 3300039447 Bacteria 9372
116 Ga0436361_0570400 3300039447 Bacteria 111725
117 Ga0436361_0592898 3300039447 Bacteria 2851
118 Ga0436361_0814020 3300039447 Bacteria 1130
119 Ga0436361_0950682 3300039447 Bacteria 10268
120 Ga0450897_002420 3300042128 Bacteria 1400
121 Ga0450906_010450 3300042145 Bacteria 1756
122 Ga0466966_0023507 3300044684 Bacteria 4034
123 Ga0466970_0038233 3300044765 Bacteria 2545
124 Ga0495617_000006 3300046452 Bacteria 398279
125 Ga0495617_000008 3300046452 Bacteria 340369
126 Ga0495627_000005 3300046453 Bacteria 630805
127 Ga0495627_000812 3300046453 Bacteria 22811
128 Ga0495627_003520 3300046453 Bacteria 6863
129 Ga0495603_0076006 3300046455 Bacteria 1971
130 Ga0495590_0000003 3300046457 Bacteria 478593
131 Ga0495590_0012678 3300046457 Bacteria 3122
132 Ga0495590_0114368 3300046457 Bacteria 964
133 Ga0495638_0000118 3300046460 Bacteria 127657
134 Ga0495638_0005053 3300046460 Bacteria 9893
135 Ga0495638_0053281 3300046460 Bacteria 2518
136 Ga0495638_0055441 3300046460 Bacteria 2461
137 Ga0495638_0088279 3300046460 Bacteria 1872
138 Ga0495638_0234916 3300046460 Bacteria 1018
139 Ga0495653_0000011 3300046463 Bacteria 272314
140 Ga0495650_0000195 3300046471 Bacteria 131338
141 Ga0495650_0000235 3300046471 Bacteria 111830
142 Ga0495650_0000544 3300046471 Bacteria 53879
143 Ga0495650_0001386 3300046471 Bacteria 23829
144 Ga0495650_0003130 3300046471 Bacteria 12388
145 Ga0495650_0014885 3300046471 Bacteria 4015
146 Ga0495650_0018048 3300046471 Bacteria 3519
147 Ga0495582_0062109 3300046473 Bacteria 2063
148 Ga0495605_0000003 3300046474 Bacteria 491502
149 Ga0495605_0000083 3300046474 Bacteria 124953
150 Ga0495605_0011701 3300046474 Bacteria 4883
151 Ga0495605_0233050 3300046474 Bacteria 792
152 Ga0495584_0000405 3300046491 Bacteria 29778
153 Ga0495584_0009076 3300046491 Bacteria 5136
154 Ga0495584_0013590 3300046491 Bacteria 4154
155 Ga0495584_0043189 3300046491 Bacteria 2275
156 Ga0495584_0209221 3300046491 Bacteria 991
157 Ga0495585_0001472 3300046492 Bacteria 18420
158 Ga0495585_0005802 3300046492 Bacteria 7742
159 Ga0495585_0032667 3300046492 Bacteria 2947
160 Ga0495585_0033106 3300046492 Bacteria 2927
161 Ga0495585_0065497 3300046492 Bacteria 1990
162 Ga0495594_0005224 3300046499 Bacteria 6674
163 Ga0495594_0022988 3300046499 Bacteria 3338
164 Ga0495594_0136271 3300046499 Bacteria 1391
165 Ga0495596_0000416 3300046500 Bacteria 27207
166 Ga0495596_0001393 3300046500 Bacteria 13892
167 Ga0495596_0013520 3300046500 Bacteria 3460
168 Ga0495596_0016593 3300046500 Bacteria 3056
169 Ga0495607_0002500 3300046501 Bacteria 14899
170 Ga0495607_0005199 3300046501 Bacteria 9372
171 Ga0495607_0006102 3300046501 Bacteria 8522
172 Ga0495607_0017198 3300046501 Bacteria 4650
173 Ga0495607_0023591 3300046501 Bacteria 3849
174 Ga0495607_0038911 3300046501 Bacteria 2844
175 Ga0495607_0074899 3300046501 Bacteria 1877
176 Ga0495607_0161858 3300046501 Bacteria 1136
177 Ga0495607_0207972 3300046501 Bacteria 964
178 Ga0495583_0000049 3300046506 Bacteria 216069
179 Ga0495583_0000079 3300046506 Bacteria 169681
180 Ga0495583_0000413 3300046506 Bacteria 64881
181 Ga0495583_0001390 3300046506 Bacteria 24725
182 Ga0495583_0003794 3300046506 Bacteria 11226
183 Ga0495606_0000185 3300046507 Bacteria 109977
184 Ga0495606_0000284 3300046507 Bacteria 88119
185 Ga0495606_0000778 3300046507 Bacteria 48896
186 Ga0495606_0001400 3300046507 Bacteria 32506
187 Ga0495606_0002275 3300046507 Bacteria 22723
188 Ga0495606_0003570 3300046507 Bacteria 16401
189 Ga0495606_0007751 3300046507 Bacteria 9507
190 Ga0495606_0009398 3300046507 Bacteria 8278
191 Ga0495606_0017387 3300046507 Bacteria 5437
192 Ga0495606_0034218 3300046507 Bacteria 3490
193 Ga0495606_0042866 3300046507 Bacteria 3023
194 Ga0495606_0240421 3300046507 Bacteria 1010
195 Ga0495610_0000004 3300046512 Bacteria 1006135
196 Ga0495610_0001183 3300046512 Bacteria 23602
197 Ga0495610_0013298 3300046512 Bacteria 4897
198 Ga0495610_0013862 3300046512 Bacteria 4764
199 Ga0495610_0034312 3300046512 Bacteria 2614
200 Ga0495610_0040579 3300046512 Bacteria 2344
201 Ga0495610_0040883 3300046512 Bacteria 2332
202 Ga0495616_0005718 3300046513 Bacteria 7615
203 Ga0495616_0006668 3300046513 Bacteria 6968
204 Ga0495616_0011209 3300046513 Bacteria 5147
205 Ga0495616_0030073 3300046513 Bacteria 2859
206 Ga0495616_0043102 3300046513 Bacteria 2293
207 Ga0495616_0055997 3300046513 Bacteria 1949
208 Ga0495616_0080659 3300046513 Bacteria 1557
209 Ga0495616_0085623 3300046513 Bacteria 1500
210 Ga0495631_0002637 3300046518 Bacteria 10010
211 Ga0495631_0005364 3300046518 Bacteria 6722
212 Ga0495631_0023515 3300046518 Bacteria 2855
213 Ga0495631_0024982 3300046518 Bacteria 2754
214 Ga0495631_0041287 3300046518 Bacteria 2042
215 Ga0495632_0000467 3300046519 Bacteria 38367
216 Ga0495632_0028271 3300046519 Bacteria 2927
217 Ga0495637_0001383 3300046520 Bacteria 14514
218 Ga0495637_0006637 3300046520 Bacteria 5792
219 Ga0495643_0000505 3300046522 Bacteria 48848
220 Ga0495643_0000641 3300046522 Bacteria 41474
221 Ga0495643_0023490 3300046522 Bacteria 3505
222 Ga0495643_0073834 3300046522 Bacteria 1787
223 Ga0495644_0010715 3300046523 Bacteria 3531
224 Ga0495644_0013905 3300046523 Bacteria 3085
225 Ga0495644_0044325 3300046523 Bacteria 1673
226 Ga0495644_0047934 3300046523 Bacteria 1604
227 Ga0495648_0000070 3300046524 Bacteria 136680
228 Ga0495648_0001121 3300046524 Bacteria 27150
229 Ga0495648_0001870 3300046524 Bacteria 20129
230 Ga0495648_0006446 3300046524 Bacteria 9579
231 Ga0495648_0008109 3300046524 Bacteria 8299
232 Ga0495648_0087728 3300046524 Bacteria 1751
233 Ga0495648_0092122 3300046524 Bacteria 1693
234 Ga0495663_0054185 3300046525 Bacteria 1248
235 Ga0495663_0089047 3300046525 Bacteria 1004
236 Ga0495666_0000706 3300046526 Bacteria 15182
237 Ga0495666_0072497 3300046526 Bacteria 1635
238 Ga0495642_0000733 3300046528 Bacteria 16294
239 Ga0495642_0000971 3300046528 Bacteria 13344
240 Ga0495642_0004916 3300046528 Bacteria 5154
241 Ga0495642_0009751 3300046528 Bacteria 3677
242 Ga0495642_0023796 3300046528 Bacteria 2419
243 Ga0495642_0194960 3300046528 Bacteria 882
244 Ga0495654_0000035 3300046530 Bacteria 192768
245 Ga0495654_0009865 3300046530 Bacteria 5218
246 Ga0495654_0017523 3300046530 Bacteria 3765
247 Ga0495609_0000587 3300046538 Bacteria 28562
248 Ga0495609_0001640 3300046538 Bacteria 14580
249 Ga0495609_0007738 3300046538 Bacteria 5326
250 Ga0495609_0036132 3300046538 Bacteria 2232
251 Ga0495597_0000206 3300046542 Bacteria 53783
252 Ga0495597_0005143 3300046542 Bacteria 6976
253 Ga0495597_0005840 3300046542 Bacteria 6437
254 Ga0495597_0073419 3300046542 Bacteria 1470
255 Ga0495597_0077282 3300046542 Bacteria 1427
256 Ga0495622_0000004 3300046557 Bacteria 258984
257 Ga0495622_0000256 3300046557 Bacteria 40845
258 Ga0495622_0017387 3300046557 Bacteria 3347
259 Ga0495622_0026299 3300046557 Bacteria 2718
260 Ga0495622_0145729 3300046557 Bacteria 1073
261 Ga0495622_0152151 3300046557 Bacteria 1046
262 Ga0495622_0184748 3300046557 Bacteria 934
263 Ga0495633_0001442 3300046558 Bacteria 18481
264 Ga0495633_0001704 3300046558 Bacteria 16484
265 Ga0495633_0002584 3300046558 Bacteria 12672
266 Ga0495633_0003081 3300046558 Bacteria 11341
267 Ga0495633_0007532 3300046558 Bacteria 6252
268 Ga0495633_0015988 3300046558 Bacteria 3882
269 Ga0495633_0027461 3300046558 Bacteria 2782
270 Ga0495633_0048831 3300046558 Bacteria 1997
271 Ga0495633_0060017 3300046558 Bacteria 1782
272 Ga0495656_0000569 3300046615 Bacteria 12008
273 Ga0495656_0023931 3300046615 Bacteria 2407
274 Ga0495668_0000094 3300046616 Bacteria 141412
275 Ga0495668_0000168 3300046616 Bacteria 97230
276 Ga0495668_0000683 3300046616 Bacteria 40836
277 Ga0495668_0000883 3300046616 Bacteria 33776
278 Ga0495668_0001068 3300046616 Bacteria 28928
279 Ga0495668_0004229 3300046616 Bacteria 10332
280 Ga0495668_0009082 3300046616 Bacteria 6134
281 Ga0495668_0119623 3300046616 Bacteria 1440
282 Ga0495668_0276189 3300046616 Bacteria 920
283 Ga0495611_0003487 3300046648 Bacteria 6925
284 Ga0495611_0007717 3300046648 Bacteria 4569
285 Ga0495611_0035152 3300046648 Bacteria 2218
286 Ga0495611_0057265 3300046648 Bacteria 1766
287 Ga0495625_0000562 3300046660 Bacteria 54473
288 Ga0495625_0000916 3300046660 Bacteria 39677
289 Ga0495625_0023597 3300046660 Bacteria 4696
290 Ga0495625_0029741 3300046660 Bacteria 4082
291 Ga0495625_0055463 3300046660 Bacteria 2826
292 Ga0495625_0066033 3300046660 Bacteria 2549
293 Ga0495625_0069553 3300046660 Bacteria 2473
294 Ga0495625_0070597 3300046660 Bacteria 2452
295 Ga0495625_0255974 3300046660 Bacteria 1135
296 Ga0495659_0000031 3300046664 Bacteria 65868
297 Ga0495659_0002372 3300046664 Bacteria 6083
298 Ga0495659_0003774 3300046664 Bacteria 4814
299 Ga0495661_0000846 3300046665 Bacteria 28530
300 Ga0495661_0001460 3300046665 Bacteria 19792
301 Ga0495661_0020499 3300046665 Bacteria 4314
302 Ga0495661_0027784 3300046665 Bacteria 3629
303 Ga0495661_0042886 3300046665 Bacteria 2785
304 Ga0495661_0087771 3300046665 Bacteria 1777
305 Ga0495661_0135095 3300046665 Bacteria 1347
306 Ga0495661_0246164 3300046665 Bacteria 914
307 Ga0495588_0000067 3300046674 Bacteria 238958
308 Ga0495588_0007598 3300046674 Bacteria 4944
309 Ga0495588_0114231 3300046674 Bacteria 1423
310 Ga0495669_0000177 3300046684 Bacteria 40130
311 Ga0495669_0005745 3300046684 Bacteria 5173
312 Ga0495613_0033010 3300046689 Bacteria 3847
313 Ga0495670_0000189 3300046691 Bacteria 27218
314 Ga0495670_0006240 3300046691 Bacteria 5848
315 Ga0495670_0015563 3300046691 Bacteria 3737
316 Ga0495670_0059557 3300046691 Bacteria 1917
317 Ga0495670_0085759 3300046691 Bacteria 1607
318 Ga0495670_0105868 3300046691 Bacteria 1452
319 Ga0495671_0000001 3300046692 Bacteria 1169494
320 Ga0495671_0000345 3300046692 Bacteria 38587
321 Ga0495671_0001079 3300046692 Bacteria 18889
322 Ga0495671_0004940 3300046692 Bacteria 7866
323 Ga0495671_0005962 3300046692 Bacteria 7081
324 Ga0495671_0018328 3300046692 Bacteria 3717
325 Ga0495671_0044153 3300046692 Bacteria 2235
326 Ga0495671_0056435 3300046692 Bacteria 1944
327 Ga0495671_0075434 3300046692 Bacteria 1654
328 Ga0495649_0012036 3300046694 Bacteria 5050
329 Ga0495649_0016824 3300046694 Bacteria 4140
330 Ga0495589_0009512 3300046794 Bacteria 5051
331 Ga0495589_0047093 3300046794 Bacteria 2137
332 Ga0495589_0191854 3300046794 Bacteria 966
333 Ga0495660_0000777 3300046810 Bacteria 23916
334 Ga0495660_0000981 3300046810 Bacteria 20849
335 Ga0495660_0001658 3300046810 Bacteria 14919
336 Ga0495660_0001897 3300046810 Bacteria 13688
337 Ga0495660_0022010 3300046810 Bacteria 3644
338 Ga0495660_0024690 3300046810 Bacteria 3423
339 Ga0495660_0034245 3300046810 Bacteria 2843
340 Ga0495660_0070813 3300046810 Bacteria 1850
341 Ga0495660_0092437 3300046810 Bacteria 1570
342 Ga0495660_0215572 3300046810 Bacteria 908
343 Ga0495581_0018587 3300047315 Bacteria 4036
344 Ga0495604_0105132 3300047317 Bacteria 2067
345 Ga0495636_0000282 3300047318 Bacteria 19836
346 Ga0495636_0002672 3300047318 Bacteria 6883
347 Ga0495636_0003565 3300047318 Bacteria 6033
348 Ga0495636_0018707 3300047318 Bacteria 2780
349 Ga0495636_0021170 3300047318 Bacteria 2624
350 Ga0495674_0014385 3300047319 Bacteria 7408
351 Ga0495672_0000050 3300047320 Bacteria 240336
352 Ga0495672_0000580 3300047320 Bacteria 41398
353 Ga0495672_0000697 3300047320 Bacteria 37194
354 Ga0495672_0032892 3300047320 Bacteria 3218
355 Ga0495676_0000037 3300047321 Bacteria 115856
356 Ga0495676_0082800 3300047321 Bacteria 2427
357 Ga0495683_0077143 3300047323 Bacteria 1629
358 Ga0495687_000116 3300047443 Bacteria 122687
359 Ga0495687_000235 3300047443 Bacteria 76976
360 Ga0495687_001054 3300047443 Bacteria 27272
361 Ga0495687_006696 3300047443 Bacteria 6989
362 Ga0495677_0002854 3300047445 Bacteria 6732
363 Ga0495677_0006607 3300047445 Bacteria 4376
364 Ga0495677_0006919 3300047445 Bacteria 4263
365 Ga0495677_0009718 3300047445 Bacteria 3545
366 Ga0495677_0012991 3300047445 Bacteria 3031
367 Ga0495677_0047104 3300047445 Bacteria 1582
368 Ga0495677_0077855 3300047445 Bacteria 1241
369 Ga0495677_0119584 3300047445 Bacteria 1004
370 Ga0495679_001512 3300047446 Bacteria 13140
371 Ga0495679_009189 3300047446 Bacteria 3973
372 Ga0495679_063955 3300047446 Bacteria 1073
373 Ga0495685_000279 3300047447 Bacteria 17084
374 Ga0495685_000448 3300047447 Bacteria 12939
375 Ga0495685_022010 3300047447 Bacteria 2193
376 Ga0495685_028178 3300047447 Bacteria 1932
377 Ga0495673_0000006 3300047469 Bacteria 908691
378 Ga0495673_0000014 3300047469 Bacteria 599202
379 Ga0495673_0000090 3300047469 Bacteria 188187
380 Ga0495673_0064778 3300047469 Bacteria 1553
381 Ga0495681_0000751 3300047470 Bacteria 24951
382 Ga0495681_0002699 3300047470 Bacteria 12571
383 Ga0495681_0005034 3300047470 Bacteria 8906
384 Ga0495681_0055061 3300047470 Bacteria 1856
385 Ga0495681_0081878 3300047470 Bacteria 1439
386 Ga0495686_0000225 3300047472 Bacteria 104121
387 Ga0495686_0007014 3300047472 Bacteria 8512
388 Ga0495686_0075637 3300047472 Bacteria 2064
389 Ga0495686_0105732 3300047472 Bacteria 1693
390 Ga0495686_0168137 3300047472 Bacteria 1277
391 Ga0495626_0015512 3300048091 Bacteria 3896
392 Ga0495626_0026554 3300048091 Bacteria 2821
393 Ga0496102_0000193 3300048905 Bacteria 83162
394 Ga0496102_0001901 3300048905 Bacteria 18007
395 Ga0496102_0009463 3300048905 Bacteria 8374
396 Ga0496102_0425971 3300048905 Bacteria 1246
397 Ga0496103_0010282 3300048906 Bacteria 5534
398 Ga0496103_0015489 3300048906 Bacteria 4538
399 Ga0496103_0057082 3300048906 Bacteria 2424
400 Ga0496103_0059574 3300048906 Bacteria 2372
401 Ga0496107_0196545 3300048910 Bacteria 1499
402 Ga0496111_0071420 3300048914 Bacteria 2527
403 Ga0496116_0031090 3300048919 Bacteria 3828
404 Ga0496116_0035403 3300048919 Bacteria 3507
405 Ga0496116_0052449 3300048919 Bacteria 2702
406 Ga0496117_0000001 3300048920 Bacteria 2526244
407 Ga0496118_0000008 3300048921 Bacteria 644537
408 Ga0496121_0055386 3300048924 Bacteria 3304
409 Ga0496121_0062197 3300048924 Bacteria 3059
410 Ga0496121_0112894 3300048924 Bacteria 2069
411 Ga0496121_0139132 3300048924 Bacteria 1804
412 Ga0496122_0001150 3300048925 Bacteria 45372
413 Ga0496122_0189421 3300048925 Bacteria 1216
414 Ga0496123_0001851 3300048926 Bacteria 27757
415 Ga0496123_0003204 3300048926 Bacteria 18664
416 Ga0496124_0091180 3300048927 Bacteria 2484
417 Ga0496125_0181421 3300048928 Bacteria 1402
418 Ga0496125_0316421 3300048928 Bacteria 948
419 Ga0496126_0249200 3300048929 Bacteria 1481
420 Ga0495678_000016 3300049459 Bacteria 303426
421 Ga0495678_003082 3300049459 Bacteria 10574
422 Ga0495678_003398 3300049459 Bacteria 9897
423 Ga0495678_007840 3300049459 Bacteria 5486
424 Ga0495682_0000848 3300049460 Bacteria 19101
425 Ga0495682_0006016 3300049460 Bacteria 4955
426 Ga0495682_0007817 3300049460 Bacteria 4235
427 Ga0495682_0057527 3300049460 Bacteria 1407
428 Ga0495682_0098105 3300049460 Bacteria 1051
429 Ga0501222_017969 3300049662 Bacteria 939
430 Ga0501269_000499 3300049766 Bacteria 8110
431 Ga0501279_006588 3300049775 Bacteria 1535
432 nmdc:mga03n38_238355_c1 3300050490 Bacteria 956
433 Ga0500594_0024695 3300053118 Bacteria 1533
434 Ga0500618_000371 3300053125 Bacteria 31102
435 Ga0500586_014815 3300053145 Bacteria 2330
436 Ga0500586_020371 3300053145 Bacteria 2077

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300015262 Ga0182007_10053926 Ga0182007_100539262 203
2 3300047318 Ga0495636_0021170 Ga0495636_0021170_1514_2248 229
3 3300048906 Ga0496103_0059574 Ga0496103_0059574_916_1650 229
4 3300047447 Ga0495685_022010 Ga0495685_022010_1451_2161 235
5 iso_pu_bacteria 2821131069 2821133636 239
6 iso_pu_bacteria 2842711865 2842717311 239
7 iso_pu_bacteria 2857553236 2857553746 239
8 iso_pu_bacteria 2857558681 2857564660 239
9 iso_pu_bacteria 2857564685 2857565423 239
10 iso_pu_bacteria 2904424332 2904430477 239
11 iso_pu_bacteria 2919476304 2919480370 239
12 3300044765 Ga0466970_0038233 Ga0466970_0038233_305_1066 241
13 3300002774 JGI25150J39212_1017311 JGI25150J39212_10173111 243
14 3300003215 JGI25153J46596_10059428 JGI25153J46596_100594281 243
15 3300003320 rootH2_10035623 rootH2_100356232 243
16 3300025245 Ga0207425_1001176 Ga0207425_10011769 243
17 3300025294 Ga0209025_1005178 Ga0209025_10051788 243
18 3300025297 Ga0209758_1000149 Ga0209758_100014915 243
19 3300030736 Ga0316180_1012425 Ga0316180_10124251 243
20 3300046525 Ga0495663_0054185 Ga0495663_0054185_352_1086 243
21 3300046525 Ga0495663_0089047 Ga0495663_0089047_27_761 243
22 3300046542 Ga0495597_0077282 Ga0495597_0077282_198_932 243
23 iso_pu_bacteria 2857547612 2857547639 243
24 iso_pu_bacteria 2885080285 2885082248 243
25 3300037312 Ga0395899_0004489 Ga0395899_0004489_2660_3403 246
26 3300014497 Ga0182008_10000671 Ga0182008_1000067119 247
27 3300015261 Ga0182006_1000075 Ga0182006_100007531 247
28 3300015262 Ga0182007_10000135 Ga0182007_1000013528 247
29 3300015265 Ga0182005_1000106 Ga0182005_100010629 247
30 3300046530 Ga0495654_0017523 Ga0495654_0017523_971_1717 247
31 3300046557 Ga0495622_0017387 Ga0495622_0017387_1511_2257 247
32 3300046558 Ga0495633_0003081 Ga0495633_0003081_5652_6398 247
33 3300048919 Ga0496116_0035403 Ga0496116_0035403_575_1321 247
34 3300048920 Ga0496117_0000001 Ga0496117_0000001_2115620_2116366 247
35 3300048921 Ga0496118_0000008 Ga0496118_0000008_233913_234659 247
36 3300048924 Ga0496121_0055386 Ga0496121_0055386_2525_3271 247
37 3300048924 Ga0496121_0062197 Ga0496121_0062197_444_1190 247
38 3300048925 Ga0496122_0001150 Ga0496122_0001150_17894_18640 247
39 3300048926 Ga0496123_0003204 Ga0496123_0003204_17907_18653 247
40 3300048928 Ga0496125_0316421 Ga0496125_0316421_176_922 247
41 3300049460 Ga0495682_0098105 Ga0495682_0098105_232_978 247
42 3300013102 Ga0157371_10000001 Ga0157371_10000001480 248
43 3300014497 Ga0182008_10017414 Ga0182008_100174145 248
44 3300039447 Ga0436361_0592898 Ga0436361_0592898_20_769 248
45 3300042128 Ga0450897_002420 Ga0450897_002420_181_930 248
46 3300042145 Ga0450906_010450 Ga0450906_010450_146_895 248
47 3300046460 Ga0495638_0005053 Ga0495638_0005053_8127_8876 248
48 3300046491 Ga0495584_0209221 Ga0495584_0209221_228_977 248
49 3300046501 Ga0495607_0023591 Ga0495607_0023591_485_1234 248
50 3300046507 Ga0495606_0042866 Ga0495606_0042866_1921_2670 248
51 3300046513 Ga0495616_0085623 Ga0495616_0085623_339_1088 248
52 3300046519 Ga0495632_0028271 Ga0495632_0028271_1572_2321 248
53 3300046523 Ga0495644_0047934 Ga0495644_0047934_75_824 248
54 3300046528 Ga0495642_0023796 Ga0495642_0023796_1289_2038 248
55 3300046538 Ga0495609_0036132 Ga0495609_0036132_1204_1953 248
56 3300046660 Ga0495625_0069553 Ga0495625_0069553_1066_1815 248
57 3300046665 Ga0495661_0246164 Ga0495661_0246164_24_773 248
58 3300046794 Ga0495589_0047093 Ga0495589_0047093_950_1699 248
59 3300047323 Ga0495683_0077143 Ga0495683_0077143_286_1035 248
60 3300047445 Ga0495677_0047104 Ga0495677_0047104_463_1212 248
61 3300047447 Ga0495685_028178 Ga0495685_028178_687_1436 248
62 3300047472 Ga0495686_0168137 Ga0495686_0168137_15_764 248
63 3300049460 Ga0495682_0007817 Ga0495682_0007817_933_1682 248
64 iso_pu_bacteria 2600255292 2601670867 248
65 iso_pu_bacteria 2643221554 2643788232 248
66 iso_pu_bacteria 2643221638 2644213834 248
67 iso_pu_bacteria 2643221645 2644253961 248
68 iso_pu_bacteria 2738541280 2738742079 248
69 iso_pu_bacteria 2738541297 2738825029 248
70 iso_pu_bacteria 2738541300 2738844532 248
71 iso_pu_bacteria 2738541357 2739148826 248
72 iso_pu_bacteria 2738543003 2739190745 248
73 iso_pu_bacteria 2738543018 2739276042 248
74 iso_pu_bacteria 2738543026 2739317222 248
75 iso_pu_bacteria 2738543029 2739335463 248
76 iso_pu_bacteria 2738543030 2739345434 248
77 iso_pu_bacteria 2932410948 2932412251 248
78 iso_pu_bacteria 2932416698 2932419766 248
79 3300046455 Ga0495603_0076006 Ga0495603_0076006_707_1462 249
80 3300046491 Ga0495584_0043189 Ga0495584_0043189_961_1716 249
81 3300046492 Ga0495585_0065497 Ga0495585_0065497_1122_1877 249
82 3300046499 Ga0495594_0005224 Ga0495594_0005224_784_1539 249
83 3300046499 Ga0495594_0022988 Ga0495594_0022988_1010_1765 249
84 3300046518 Ga0495631_0041287 Ga0495631_0041287_386_1141 249
85 3300046526 Ga0495666_0072497 Ga0495666_0072497_147_902 249
86 3300046557 Ga0495622_0026299 Ga0495622_0026299_691_1446 249
87 3300046648 Ga0495611_0035152 Ga0495611_0035152_13_768 249
88 3300046810 Ga0495660_0092437 Ga0495660_0092437_530_1291 249
89 3300047318 Ga0495636_0003565 Ga0495636_0003565_3681_4436 249
90 3300047319 Ga0495674_0014385 Ga0495674_0014385_3701_4456 249
91 3300047320 Ga0495672_0000050 Ga0495672_0000050_7762_8523 249
92 3300047321 Ga0495676_0082800 Ga0495676_0082800_40_795 249
93 3300047470 Ga0495681_0055061 Ga0495681_0055061_195_950 249
94 3300047472 Ga0495686_0105732 Ga0495686_0105732_295_1056 249
95 3300048091 Ga0495626_0015512 Ga0495626_0015512_2252_3007 249
96 3300031548 Ga0307408_100000837 Ga0307408_10000083714 250
97 3300046660 Ga0495625_0055463 Ga0495625_0055463_312_1067 250
98 3300046674 Ga0495588_0007598 Ga0495588_0007598_3981_4736 250
99 3300046674 Ga0495588_0114231 Ga0495588_0114231_619_1374 250
100 3300002774 JGI25150J39212_1001342 JGI25150J39212_10013429 251
101 3300030745 Ga0316182_1091011 Ga0316182_10910111 251
102 3300037418 Ga0395900_0016198 Ga0395900_0016198_6268_7026 251
103 3300037418 Ga0395900_0133109 Ga0395900_0133109_1540_2298 251
104 3300037466 Ga0395898_0265517 Ga0395898_0265517_339_1097 251
105 3300037471 Ga0395905_0121898 Ga0395905_0121898_1490_2248 251
106 3300037471 Ga0395905_0300484 Ga0395905_0300484_531_1289 251
107 3300038443 Ga0395901_0560124 Ga0395901_0560124_154_912 251
108 3300044684 Ga0466966_0023507 Ga0466966_0023507_17_775 251
109 3300046452 Ga0495617_000008 Ga0495617_000008_76483_77241 251
110 3300046453 Ga0495627_000812 Ga0495627_000812_3360_4118 251
111 3300046453 Ga0495627_003520 Ga0495627_003520_422_1180 251
112 3300046457 Ga0495590_0012678 Ga0495590_0012678_2237_2995 251
113 3300046457 Ga0495590_0114368 Ga0495590_0114368_71_829 251
114 3300046460 Ga0495638_0055441 Ga0495638_0055441_254_1012 251
115 3300046473 Ga0495582_0062109 Ga0495582_0062109_1062_1820 251
116 3300046474 Ga0495605_0000083 Ga0495605_0000083_3248_4006 251
117 3300046474 Ga0495605_0233050 Ga0495605_0233050_14_772 251
118 3300046491 Ga0495584_0009076 Ga0495584_0009076_3536_4294 251
119 3300046492 Ga0495585_0005802 Ga0495585_0005802_3800_4558 251
120 3300046499 Ga0495594_0136271 Ga0495594_0136271_161_919 251
121 3300046500 Ga0495596_0000416 Ga0495596_0000416_15805_16563 251
122 3300046500 Ga0495596_0001393 Ga0495596_0001393_5103_5861 251
123 3300046500 Ga0495596_0013520 Ga0495596_0013520_1411_2169 251
124 3300046500 Ga0495596_0016593 Ga0495596_0016593_848_1606 251
125 3300046501 Ga0495607_0006102 Ga0495607_0006102_4743_5501 251
126 3300046501 Ga0495607_0074899 Ga0495607_0074899_797_1555 251
127 3300046501 Ga0495607_0161858 Ga0495607_0161858_295_1053 251
128 3300046506 Ga0495583_0000049 Ga0495583_0000049_124697_125551 251
129 3300046506 Ga0495583_0001390 Ga0495583_0001390_18020_18778 251
130 3300046506 Ga0495583_0003794 Ga0495583_0003794_5626_6384 251
131 3300046507 Ga0495606_0017387 Ga0495606_0017387_3825_4583 251
132 3300046513 Ga0495616_0005718 Ga0495616_0005718_2092_2850 251
133 3300046513 Ga0495616_0006668 Ga0495616_0006668_3963_4721 251
134 3300046513 Ga0495616_0011209 Ga0495616_0011209_3794_4552 251
135 3300046513 Ga0495616_0043102 Ga0495616_0043102_802_1560 251
136 3300046518 Ga0495631_0002637 Ga0495631_0002637_1777_2535 251
137 3300046518 Ga0495631_0005364 Ga0495631_0005364_5008_5766 251
138 3300046518 Ga0495631_0023515 Ga0495631_0023515_1666_2424 251
139 3300046518 Ga0495631_0024982 Ga0495631_0024982_376_1134 251
140 3300046519 Ga0495632_0000467 Ga0495632_0000467_24775_25533 251
141 3300046522 Ga0495643_0023490 Ga0495643_0023490_1408_2166 251
142 3300046522 Ga0495643_0073834 Ga0495643_0073834_951_1709 251
143 3300046524 Ga0495648_0001870 Ga0495648_0001870_2119_2877 251
144 3300046524 Ga0495648_0006446 Ga0495648_0006446_5639_6397 251
145 3300046524 Ga0495648_0092122 Ga0495648_0092122_267_1025 251
146 3300046526 Ga0495666_0000706 Ga0495666_0000706_17_775 251
147 3300046528 Ga0495642_0000971 Ga0495642_0000971_2009_2767 251
148 3300046528 Ga0495642_0004916 Ga0495642_0004916_1040_1798 251
149 3300046528 Ga0495642_0009751 Ga0495642_0009751_2450_3208 251
150 3300046528 Ga0495642_0194960 Ga0495642_0194960_61_819 251
151 3300046542 Ga0495597_0005143 Ga0495597_0005143_1072_1830 251
152 3300046557 Ga0495622_0145729 Ga0495622_0145729_109_867 251
153 3300046557 Ga0495622_0152151 Ga0495622_0152151_128_886 251
154 3300046558 Ga0495633_0001704 Ga0495633_0001704_1807_2565 251
155 3300046558 Ga0495633_0015988 Ga0495633_0015988_2037_2795 251
156 3300046558 Ga0495633_0027461 Ga0495633_0027461_852_1610 251
157 3300046558 Ga0495633_0048831 Ga0495633_0048831_35_793 251
158 3300046615 Ga0495656_0023931 Ga0495656_0023931_183_941 251
159 3300046616 Ga0495668_0000683 Ga0495668_0000683_8729_9487 251
160 3300046616 Ga0495668_0000883 Ga0495668_0000883_7342_8100 251
161 3300046616 Ga0495668_0119623 Ga0495668_0119623_60_818 251
162 3300046616 Ga0495668_0276189 Ga0495668_0276189_103_861 251
163 3300046648 Ga0495611_0057265 Ga0495611_0057265_930_1688 251
164 3300046665 Ga0495661_0000846 Ga0495661_0000846_5245_6003 251
165 3300046665 Ga0495661_0001460 Ga0495661_0001460_16297_17055 251
166 3300046665 Ga0495661_0042886 Ga0495661_0042886_1125_1883 251
167 3300046665 Ga0495661_0087771 Ga0495661_0087771_702_1460 251
168 3300046665 Ga0495661_0135095 Ga0495661_0135095_320_1078 251
169 3300046674 Ga0495588_0000067 Ga0495588_0000067_94788_95546 251
170 3300046684 Ga0495669_0000177 Ga0495669_0000177_33744_34502 251
171 3300046684 Ga0495669_0005745 Ga0495669_0005745_142_900 251
172 3300046689 Ga0495613_0033010 Ga0495613_0033010_1170_1928 251
173 3300046691 Ga0495670_0000189 Ga0495670_0000189_2042_2800 251
174 3300046691 Ga0495670_0059557 Ga0495670_0059557_711_1469 251
175 3300046691 Ga0495670_0085759 Ga0495670_0085759_689_1447 251
176 3300046691 Ga0495670_0105868 Ga0495670_0105868_406_1164 251
177 3300046692 Ga0495671_0001079 Ga0495671_0001079_15548_16306 251
178 3300046692 Ga0495671_0004940 Ga0495671_0004940_5250_6008 251
179 3300046692 Ga0495671_0005962 Ga0495671_0005962_6301_7059 251
180 3300046694 Ga0495649_0016824 Ga0495649_0016824_2280_3038 251
181 3300046794 Ga0495589_0009512 Ga0495589_0009512_1562_2320 251
182 3300046794 Ga0495589_0191854 Ga0495589_0191854_22_780 251
183 3300046810 Ga0495660_0001658 Ga0495660_0001658_807_1565 251
184 3300046810 Ga0495660_0070813 Ga0495660_0070813_1077_1835 251
185 3300047315 Ga0495581_0018587 Ga0495581_0018587_1460_2218 251
186 3300047317 Ga0495604_0105132 Ga0495604_0105132_656_1414 251
187 3300047318 Ga0495636_0018707 Ga0495636_0018707_1742_2500 251
188 3300047321 Ga0495676_0000037 Ga0495676_0000037_82751_83509 251
189 3300047443 Ga0495687_000116 Ga0495687_000116_55388_56146 251
190 3300047443 Ga0495687_006696 Ga0495687_006696_66_824 251
191 3300047445 Ga0495677_0002854 Ga0495677_0002854_1121_1879 251
192 3300047445 Ga0495677_0006607 Ga0495677_0006607_3073_3831 251
193 3300047445 Ga0495677_0006919 Ga0495677_0006919_1790_2548 251
194 3300047446 Ga0495679_001512 Ga0495679_001512_5663_6421 251
195 3300047446 Ga0495679_063955 Ga0495679_063955_59_817 251
196 3300047447 Ga0495685_000448 Ga0495685_000448_4518_5276 251
197 3300047469 Ga0495673_0064778 Ga0495673_0064778_116_874 251
198 3300047470 Ga0495681_0000751 Ga0495681_0000751_20260_21018 251
199 3300047470 Ga0495681_0081878 Ga0495681_0081878_499_1257 251
200 3300047472 Ga0495686_0075637 Ga0495686_0075637_124_882 251
201 3300048091 Ga0495626_0026554 Ga0495626_0026554_1828_2586 251
202 3300048905 Ga0496102_0000193 Ga0496102_0000193_6479_7237 251
203 3300048905 Ga0496102_0001901 Ga0496102_0001901_7021_7779 251
204 3300048905 Ga0496102_0009463 Ga0496102_0009463_2108_2866 251
205 3300048905 Ga0496102_0425971 Ga0496102_0425971_28_786 251
206 3300048906 Ga0496103_0010282 Ga0496103_0010282_218_976 251
207 3300048906 Ga0496103_0057082 Ga0496103_0057082_577_1335 251
208 3300048910 Ga0496107_0196545 Ga0496107_0196545_693_1451 251
209 3300048929 Ga0496126_0249200 Ga0496126_0249200_466_1224 251
210 3300049460 Ga0495682_0057527 Ga0495682_0057527_471_1229 251
211 3300002738 JGI25154J39366_1001870 JGI25154J39366_10018703 252
212 3300002773 JGI25152J39213_1000661 JGI25152J39213_10006613 252
213 3300002773 JGI25152J39213_1009873 JGI25152J39213_10098733 252
214 3300002987 JGI25159J45721_1003969 JGI25159J45721_10039696 252
215 3300002987 JGI25159J45721_1007888 JGI25159J45721_10078882 252
216 3300003215 JGI25153J46596_10002108 JGI25153J46596_1000210812 252
217 3300003322 rootL2_10068323 rootL2_100683231 252
218 3300003322 rootL2_10106234 rootL2_101062344 252
219 3300003354 JGI25160J50197_1006033 JGI25160J50197_10060335 252
220 3300003374 JGI25161J50226_1002114 JGI25161J50226_10021143 252
221 3300003374 JGI25161J50226_1002569 JGI25161J50226_10025694 252
222 3300003763 Ga0055529_1000185 Ga0055529_100018538 252
223 3300003771 Ga0055526_1002381 Ga0055526_10023814 252
224 3300003771 Ga0055526_1002451 Ga0055526_10024519 252
225 3300003771 Ga0055526_1015442 Ga0055526_10154422 252
226 3300003773 Ga0055537_1000072 Ga0055537_100007265 252
227 3300003773 Ga0055537_1014691 Ga0055537_10146912 252
228 3300003773 Ga0055537_1023860 Ga0055537_10238601 252
229 3300003775 Ga0055524_1001485 Ga0055524_100148513 252
230 3300003775 Ga0055524_1009540 Ga0055524_10095404 252
231 3300003775 Ga0055524_1035287 Ga0055524_10352871 252
232 3300003784 Ga0055534_1000136 Ga0055534_100013652 252
233 3300003784 Ga0055534_1001319 Ga0055534_10013199 252
234 3300003790 Ga0055528_1000025 Ga0055528_100002577 252
235 3300003790 Ga0055528_1005148 Ga0055528_10051486 252
236 3300003791 Ga0055530_10032562 Ga0055530_100325622 252
237 3300004625 Ga0055543_1001185 Ga0055543_100118510 252
238 3300004625 Ga0055543_1005934 Ga0055543_10059341 252
239 3300005262 Ga0065165_1000094 Ga0065165_100009446 252
240 3300005262 Ga0065165_1007529 Ga0065165_10075293 252
241 3300006048 Ga0075363_100143584 Ga0075363_1001435843 252
242 3300006946 Ga0079104_1028269 Ga0079104_10282693 252
243 3300009036 Ga0105244_10005704 Ga0105244_100057046 252
244 3300009036 Ga0105244_10009302 Ga0105244_100093025 252
245 3300009177 Ga0105248_10994999 Ga0105248_109949992 252
246 3300015261 Ga0182006_1000163 Ga0182006_100016350 252
247 3300015265 Ga0182005_1000020 Ga0182005_1000020195 252
248 3300017792 Ga0163161_10122170 Ga0163161_101221703 252
249 3300021361 Ga0213872_10000002 Ga0213872_1000000290 252
250 3300021361 Ga0213872_10001032 Ga0213872_1000103210 252
251 3300021361 Ga0213872_10011587 Ga0213872_100115873 252
252 3300021361 Ga0213872_10113421 Ga0213872_101134212 252
253 3300025208 Ga0209436_102373 Ga0209436_1023733 252
254 3300025208 Ga0209436_102579 Ga0209436_1025793 252
255 3300025233 Ga0209437_109112 Ga0209437_1091122 252
256 3300025233 Ga0209437_110937 Ga0209437_1109373 252
257 3300025245 Ga0207425_1000001 Ga0207425_10000012017 252
258 3300025245 Ga0207425_1000153 Ga0207425_100015317 252
259 3300025246 Ga0209646_1000028 Ga0209646_1000028246 252
260 3300025258 Ga0209129_1000001 Ga0209129_10000011194 252
261 3300025258 Ga0209129_1005405 Ga0209129_10054051 252
262 3300025263 Ga0209565_1000009 Ga0209565_1000009462 252
263 3300025263 Ga0209565_1000404 Ga0209565_100040417 252
264 3300025263 Ga0209565_1013552 Ga0209565_10135523 252
265 3300025263 Ga0209565_1017174 Ga0209565_10171743 252
266 3300025263 Ga0209565_1029395 Ga0209565_10293952 252
267 3300025272 Ga0209455_1000049 Ga0209455_100004992 252
268 3300025273 Ga0209673_1000036 Ga0209673_1000036220 252
269 3300025273 Ga0209673_1003169 Ga0209673_10031699 252
270 3300025284 Ga0209130_1000455 Ga0209130_100045531 252
271 3300025284 Ga0209130_1001251 Ga0209130_10012514 252
272 3300025284 Ga0209130_1011148 Ga0209130_10111483 252
273 3300025291 Ga0209675_1000013 Ga0209675_1000013220 252
274 3300025291 Ga0209675_1001097 Ga0209675_10010978 252
275 3300025291 Ga0209675_1003287 Ga0209675_10032871 252
276 3300025295 Ga0209564_1000009 Ga0209564_1000009880 252
277 3300025295 Ga0209564_1000045 Ga0209564_1000045298 252
278 3300025295 Ga0209564_1000175 Ga0209564_100017599 252
279 3300025295 Ga0209564_1000515 Ga0209564_100051537 252
280 3300025295 Ga0209564_1001461 Ga0209564_100146110 252
281 3300025295 Ga0209564_1039077 Ga0209564_10390772 252
282 3300025297 Ga0209758_1000230 Ga0209758_100023022 252
283 3300025298 Ga0209050_1000905 Ga0209050_100090534 252
284 3300025298 Ga0209050_1001360 Ga0209050_100136027 252
285 3300025298 Ga0209050_1002963 Ga0209050_100296313 252
286 3300025299 Ga0209256_1000005 Ga0209256_1000005321 252
287 3300025299 Ga0209256_1000358 Ga0209256_100035825 252
288 3300025299 Ga0209256_1000886 Ga0209256_100088616 252
289 3300025299 Ga0209256_1001613 Ga0209256_10016134 252
290 3300025299 Ga0209256_1002010 Ga0209256_10020108 252
291 3300025302 Ga0207426_1002658 Ga0207426_10026588 252
292 3300025302 Ga0207426_1007346 Ga0207426_10073462 252
293 3300025303 Ga0209051_1031627 Ga0209051_10316273 252
294 3300025304 Ga0209257_1000486 Ga0209257_100048643 252
295 3300025728 Ga0207655_1007880 Ga0207655_10078807 252
296 3300025728 Ga0207655_1013471 Ga0207655_10134713 252
297 3300031548 Ga0307408_100000182 Ga0307408_10000018226 252
298 3300031548 Ga0307408_100046659 Ga0307408_1000466592 252
299 3300031548 Ga0307408_100071523 Ga0307408_1000715231 252
300 3300032004 Ga0307414_10051777 Ga0307414_100517773 252
301 3300039447 Ga0436361_0140501 Ga0436361_0140501_1952_2713 252
302 3300039447 Ga0436361_0570400 Ga0436361_0570400_11005_11766 252
303 3300039447 Ga0436361_0814020 Ga0436361_0814020_317_1078 252
304 3300039447 Ga0436361_0950682 Ga0436361_0950682_9111_9872 252
305 3300046452 Ga0495617_000006 Ga0495617_000006_243023_243781 252
306 3300046453 Ga0495627_000005 Ga0495627_000005_145474_146232 252
307 3300046457 Ga0495590_0000003 Ga0495590_0000003_52598_53356 252
308 3300046460 Ga0495638_0000118 Ga0495638_0000118_9569_10327 252
309 3300046460 Ga0495638_0053281 Ga0495638_0053281_1153_1914 252
310 3300046460 Ga0495638_0088279 Ga0495638_0088279_22_780 252
311 3300046460 Ga0495638_0234916 Ga0495638_0234916_35_796 252
312 3300046463 Ga0495653_0000011 Ga0495653_0000011_136992_137750 252
313 3300046471 Ga0495650_0000195 Ga0495650_0000195_131_892 252
314 3300046471 Ga0495650_0000235 Ga0495650_0000235_78411_79169 252
315 3300046471 Ga0495650_0000544 Ga0495650_0000544_42678_43436 252
316 3300046471 Ga0495650_0001386 Ga0495650_0001386_13861_14619 252
317 3300046471 Ga0495650_0003130 Ga0495650_0003130_3079_3837 252
318 3300046471 Ga0495650_0014885 Ga0495650_0014885_48_806 252
319 3300046471 Ga0495650_0018048 Ga0495650_0018048_1612_2370 252
320 3300046474 Ga0495605_0000003 Ga0495605_0000003_244400_245158 252
321 3300046474 Ga0495605_0011701 Ga0495605_0011701_3048_3809 252
322 3300046491 Ga0495584_0000405 Ga0495584_0000405_23012_23773 252
323 3300046491 Ga0495584_0013590 Ga0495584_0013590_2448_3209 252
324 3300046492 Ga0495585_0001472 Ga0495585_0001472_2593_3351 252
325 3300046492 Ga0495585_0032667 Ga0495585_0032667_1637_2398 252
326 3300046492 Ga0495585_0033106 Ga0495585_0033106_1996_2757 252
327 3300046501 Ga0495607_0002500 Ga0495607_0002500_184_945 252
328 3300046501 Ga0495607_0005199 Ga0495607_0005199_6117_6875 252
329 3300046501 Ga0495607_0017198 Ga0495607_0017198_2604_3362 252
330 3300046501 Ga0495607_0038911 Ga0495607_0038911_1813_2574 252
331 3300046501 Ga0495607_0207972 Ga0495607_0207972_48_809 252
332 3300046506 Ga0495583_0000079 Ga0495583_0000079_52464_53222 252
333 3300046506 Ga0495583_0000413 Ga0495583_0000413_34553_35314 252
334 3300046507 Ga0495606_0000185 Ga0495606_0000185_12777_13535 252
335 3300046507 Ga0495606_0000284 Ga0495606_0000284_49506_50264 252
336 3300046507 Ga0495606_0000778 Ga0495606_0000778_21186_21947 252
337 3300046507 Ga0495606_0001400 Ga0495606_0001400_5113_5871 252
338 3300046507 Ga0495606_0002275 Ga0495606_0002275_21927_22685 252
339 3300046507 Ga0495606_0003570 Ga0495606_0003570_14218_14976 252
340 3300046507 Ga0495606_0007751 Ga0495606_0007751_8054_8812 252
341 3300046507 Ga0495606_0009398 Ga0495606_0009398_4573_5334 252
342 3300046507 Ga0495606_0034218 Ga0495606_0034218_743_1504 252
343 3300046507 Ga0495606_0240421 Ga0495606_0240421_83_841 252
344 3300046512 Ga0495610_0000004 Ga0495610_0000004_244011_244769 252
345 3300046512 Ga0495610_0001183 Ga0495610_0001183_2701_3459 252
346 3300046512 Ga0495610_0013298 Ga0495610_0013298_2063_2821 252
347 3300046512 Ga0495610_0013862 Ga0495610_0013862_3491_4249 252
348 3300046512 Ga0495610_0034312 Ga0495610_0034312_1574_2332 252
349 3300046512 Ga0495610_0040579 Ga0495610_0040579_1289_2047 252
350 3300046512 Ga0495610_0040883 Ga0495610_0040883_17_778 252
351 3300046513 Ga0495616_0030073 Ga0495616_0030073_177_938 252
352 3300046513 Ga0495616_0055997 Ga0495616_0055997_960_1721 252
353 3300046513 Ga0495616_0080659 Ga0495616_0080659_233_994 252
354 3300046520 Ga0495637_0001383 Ga0495637_0001383_45_803 252
355 3300046520 Ga0495637_0006637 Ga0495637_0006637_4783_5541 252
356 3300046522 Ga0495643_0000505 Ga0495643_0000505_45103_45861 252
357 3300046522 Ga0495643_0000641 Ga0495643_0000641_37977_38735 252
358 3300046523 Ga0495644_0010715 Ga0495644_0010715_208_969 252
359 3300046523 Ga0495644_0013905 Ga0495644_0013905_1715_2476 252
360 3300046523 Ga0495644_0044325 Ga0495644_0044325_22_780 252
361 3300046524 Ga0495648_0000070 Ga0495648_0000070_9646_10404 252
362 3300046524 Ga0495648_0001121 Ga0495648_0001121_9462_10223 252
363 3300046524 Ga0495648_0008109 Ga0495648_0008109_2165_2923 252
364 3300046524 Ga0495648_0087728 Ga0495648_0087728_140_898 252
365 3300046528 Ga0495642_0000733 Ga0495642_0000733_1340_2098 252
366 3300046530 Ga0495654_0000035 Ga0495654_0000035_188888_189646 252
367 3300046530 Ga0495654_0009865 Ga0495654_0009865_1510_2271 252
368 3300046538 Ga0495609_0000587 Ga0495609_0000587_13754_14512 252
369 3300046538 Ga0495609_0001640 Ga0495609_0001640_218_979 252
370 3300046538 Ga0495609_0007738 Ga0495609_0007738_4518_5279 252
371 3300046542 Ga0495597_0000206 Ga0495597_0000206_4349_5107 252
372 3300046542 Ga0495597_0005840 Ga0495597_0005840_346_1104 252
373 3300046542 Ga0495597_0073419 Ga0495597_0073419_54_815 252
374 3300046557 Ga0495622_0000004 Ga0495622_0000004_255406_256167 252
375 3300046557 Ga0495622_0000256 Ga0495622_0000256_24924_25682 252
376 3300046557 Ga0495622_0184748 Ga0495622_0184748_50_811 252
377 3300046558 Ga0495633_0001442 Ga0495633_0001442_15029_15787 252
378 3300046558 Ga0495633_0002584 Ga0495633_0002584_10446_11204 252
379 3300046558 Ga0495633_0007532 Ga0495633_0007532_2401_3162 252
380 3300046558 Ga0495633_0060017 Ga0495633_0060017_715_1473 252
381 3300046615 Ga0495656_0000569 Ga0495656_0000569_8991_9752 252
382 3300046616 Ga0495668_0000094 Ga0495668_0000094_133061_133822 252
383 3300046616 Ga0495668_0000168 Ga0495668_0000168_44542_45300 252
384 3300046616 Ga0495668_0001068 Ga0495668_0001068_18478_19236 252
385 3300046616 Ga0495668_0004229 Ga0495668_0004229_7279_8037 252
386 3300046616 Ga0495668_0009082 Ga0495668_0009082_959_1717 252
387 3300046648 Ga0495611_0003487 Ga0495611_0003487_610_1371 252
388 3300046648 Ga0495611_0007717 Ga0495611_0007717_3640_4401 252
389 3300046660 Ga0495625_0000562 Ga0495625_0000562_1204_1962 252
390 3300046660 Ga0495625_0000916 Ga0495625_0000916_23914_24672 252
391 3300046660 Ga0495625_0023597 Ga0495625_0023597_1476_2234 252
392 3300046660 Ga0495625_0029741 Ga0495625_0029741_1680_2441 252
393 3300046660 Ga0495625_0066033 Ga0495625_0066033_67_825 252
394 3300046660 Ga0495625_0070597 Ga0495625_0070597_41_802 252
395 3300046660 Ga0495625_0255974 Ga0495625_0255974_290_1048 252
396 3300046664 Ga0495659_0000031 Ga0495659_0000031_39049_39810 252
397 3300046664 Ga0495659_0002372 Ga0495659_0002372_5285_6046 252
398 3300046664 Ga0495659_0003774 Ga0495659_0003774_540_1301 252
399 3300046665 Ga0495661_0020499 Ga0495661_0020499_61_822 252
400 3300046665 Ga0495661_0027784 Ga0495661_0027784_1614_2372 252
401 3300046691 Ga0495670_0006240 Ga0495670_0006240_185_946 252
402 3300046691 Ga0495670_0015563 Ga0495670_0015563_1908_2669 252
403 3300046692 Ga0495671_0000001 Ga0495671_0000001_891171_891929 252
404 3300046692 Ga0495671_0000345 Ga0495671_0000345_22765_23526 252
405 3300046692 Ga0495671_0018328 Ga0495671_0018328_1304_2062 252
406 3300046692 Ga0495671_0044153 Ga0495671_0044153_1173_1934 252
407 3300046692 Ga0495671_0056435 Ga0495671_0056435_256_1014 252
408 3300046692 Ga0495671_0075434 Ga0495671_0075434_355_1116 252
409 3300046694 Ga0495649_0012036 Ga0495649_0012036_2982_3740 252
410 3300046810 Ga0495660_0000777 Ga0495660_0000777_12649_13407 252
411 3300046810 Ga0495660_0000981 Ga0495660_0000981_6035_6793 252
412 3300046810 Ga0495660_0001897 Ga0495660_0001897_4318_5079 252
413 3300046810 Ga0495660_0022010 Ga0495660_0022010_1624_2382 252
414 3300046810 Ga0495660_0024690 Ga0495660_0024690_1477_2235 252
415 3300046810 Ga0495660_0034245 Ga0495660_0034245_742_1503 252
416 3300046810 Ga0495660_0215572 Ga0495660_0215572_46_804 252
417 3300047318 Ga0495636_0000282 Ga0495636_0000282_15071_15832 252
418 3300047318 Ga0495636_0002672 Ga0495636_0002672_1434_2195 252
419 3300047320 Ga0495672_0000580 Ga0495672_0000580_296_1054 252
420 3300047320 Ga0495672_0000697 Ga0495672_0000697_32809_33570 252
421 3300047320 Ga0495672_0032892 Ga0495672_0032892_2019_2780 252
422 3300047443 Ga0495687_000235 Ga0495687_000235_41231_41992 252
423 3300047443 Ga0495687_001054 Ga0495687_001054_7424_8182 252
424 3300047445 Ga0495677_0009718 Ga0495677_0009718_1143_1904 252
425 3300047445 Ga0495677_0012991 Ga0495677_0012991_254_1015 252
426 3300047445 Ga0495677_0077855 Ga0495677_0077855_355_1113 252
427 3300047445 Ga0495677_0119584 Ga0495677_0119584_148_906 252
428 3300047446 Ga0495679_009189 Ga0495679_009189_1442_2200 252
429 3300047447 Ga0495685_000279 Ga0495685_000279_36_797 252
430 3300047469 Ga0495673_0000006 Ga0495673_0000006_272882_273640 252
431 3300047469 Ga0495673_0000014 Ga0495673_0000014_131223_131981 252
432 3300047469 Ga0495673_0000090 Ga0495673_0000090_96646_97404 252
433 3300047470 Ga0495681_0002699 Ga0495681_0002699_2016_2777 252
434 3300047470 Ga0495681_0005034 Ga0495681_0005034_2300_3058 252
435 3300047472 Ga0495686_0000225 Ga0495686_0000225_101588_102349 252
436 3300047472 Ga0495686_0007014 Ga0495686_0007014_6871_7632 252
437 3300048906 Ga0496103_0015489 Ga0496103_0015489_576_1334 252
438 3300048914 Ga0496111_0071420 Ga0496111_0071420_180_941 252
439 3300048919 Ga0496116_0031090 Ga0496116_0031090_1268_2026 252
440 3300048919 Ga0496116_0052449 Ga0496116_0052449_354_1112 252
441 3300048924 Ga0496121_0112894 Ga0496121_0112894_1299_2057 252
442 3300048924 Ga0496121_0139132 Ga0496121_0139132_905_1663 252
443 3300048925 Ga0496122_0189421 Ga0496122_0189421_123_881 252
444 3300048926 Ga0496123_0001851 Ga0496123_0001851_25696_26454 252
445 3300048927 Ga0496124_0091180 Ga0496124_0091180_417_1175 252
446 3300048928 Ga0496125_0181421 Ga0496125_0181421_320_1078 252
447 3300049459 Ga0495678_000016 Ga0495678_000016_113792_114550 252
448 3300049459 Ga0495678_003082 Ga0495678_003082_7939_8700 252
449 3300049459 Ga0495678_003398 Ga0495678_003398_290_1048 252
450 3300049459 Ga0495678_007840 Ga0495678_007840_3407_4165 252
451 3300049460 Ga0495682_0000848 Ga0495682_0000848_15890_16651 252
452 3300049460 Ga0495682_0006016 Ga0495682_0006016_2429_3190 252
453 3300049662 Ga0501222_017969 Ga0501222_017969_17_778 252
454 3300049766 Ga0501269_000499 Ga0501269_000499_1298_2056 252
455 3300049775 Ga0501279_006588 Ga0501279_006588_67_828 252
456 3300050490 nmdc:mga03n38_238355_c1 nmdc:mga03n38_238355_c1_140_898 252
457 3300053118 Ga0500594_0024695 Ga0500594_0024695_390_1148 252
458 3300053125 Ga0500618_000371 Ga0500618_000371_113_871 252
459 3300053145 Ga0500586_014815 Ga0500586_014815_1276_2034 252
460 3300053145 Ga0500586_020371 Ga0500586_020371_420_1178 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07317

PilZN

Flagellar regulator YcgR, PilZN domain

47

153

0.98

PF07238

PilZ

PilZ domain

155

271

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y6h-assembly1.cif.gz_A crystal structure of ycgr-n domain of ycgr from escherichia coli 0.943 16 122
5y6h-assembly1.cif.gz_A crystal structure of ycgr-n domain of ycgr from escherichia coli 0.8778 16 122
4rt1-assembly1.cif.gz_A structure of the alg44 pilz domain (r95a mutant) from pseudomonas aeruginosa pao1 in complex with c-di-gmp 0.7557 124 242
4xrn-assembly2.cif.gz_B pilz domain with c-di-gmp of a protein from pseudomonas aeruginosa 0.7411 124 238
4rt1-assembly1.cif.gz_A structure of the alg44 pilz domain (r95a mutant) from pseudomonas aeruginosa pao1 in complex with c-di-gmp 0.7368 124 242
ID Description Score Start End Superfamily
af_P76010_6_112_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9585 16 124 2.30.110.10
af_P76010_6_112_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9327 16 124 2.30.110.10
2gjgA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9288 17 124 2.30.110.10
2gjgA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9048 17 124 2.30.110.10
af_P76010_114_240_2.40.10.220 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.8041 126 248 2.40.10.220
ID Description Score Start End GO Terms
AF-A0A1A8XNK4-F1-model_v4 Flagellar brake protein YcgR 0.9344 54 126 GO:0009288
AF-A0A831A3C9-F1-model_v4 Type III secretion system flagellar brake protein YcgR PilZN domain-containing protein 0.9143 28 117
AF-A0A4V1TEX5-F1-model_v4 deleted 0.9071 155 252
AF-A0A3B8YF11-F1-model_v4 deleted 0.9035 18 114
AF-A0A133XHN5-F1-model_v4 PilZ domain-containing protein 0.9025 156 252 GO:0035438

Feature Viewer

pLDDT pTM Quality
81.73 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map