F448580

General Info

Members Datasets Scaffolds Average Seq Length
460 176 920 266

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0515660|Ga0395905_0515660_65_898
Length 277
Sequence MNFLDALPERYRVIFCDVWGVVHDGVTLYPGAAKRLQQWRGEGRFVVLITNAPRTAEAVEQQLERLGLPNDAWDGIATSGEAGIAALKLLGKPVGFVGTRSDRAVLEGRGIAITDGGDFTDLACSGLDDRTGEVGDYLPDLERWAARSVRMHCLNPDRLVIRGGVPEACAGAIADVYEALGGEVVWYGKPHKAIYEHALQLADNPPGEAVLAVGDGLQTDILGAARMGFDAVFVTGGISEGQPFPADFAAKYGLGDWQPVAVVDSLAEGSNSLPTRP

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
147 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
172 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
173 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
174 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
175 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
176 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10
Rhizosphere 89.78
Stem 0
Stem Tuber 0
Unclassified 3.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0515660 3300037471 Bacteria 1096
2 JGI24739J22299_10016068 3300001989 Bacteria 2713
3 JGI24735J21928_10002654 3300002067 Bacteria 6182
4 JGI24744J21845_10010937 3300002077 Bacteria 1858
5 Ga0070658_10016639 3300005327 Bacteria 5885
6 Ga0070658_10071868 3300005327 Bacteria 2834
7 Ga0070676_10036999 3300005328 Bacteria 2813
8 Ga0070683_100006282 3300005329 Bacteria 9969
9 Ga0070683_100013626 3300005329 Bacteria 7097
10 Ga0070683_100263406 3300005329 Bacteria 1640
11 Ga0070670_100012404 3300005331 Bacteria 7292
12 Ga0068869_100122775 3300005334 Bacteria 1988
13 Ga0070666_10002901 3300005335 Bacteria 10357
14 Ga0070666_10134732 3300005335 Bacteria 1718
15 Ga0070680_100002872 3300005336 Bacteria 12792
16 Ga0070680_100088060 3300005336 Bacteria 2568
17 Ga0070680_100254280 3300005336 Bacteria 1486
18 Ga0068868_100039613 3300005338 Bacteria 3662
19 Ga0070660_100005974 3300005339 Bacteria 8415
20 Ga0070660_100026633 3300005339 Bacteria 4307
21 Ga0070660_100080184 3300005339 Bacteria 2561
22 Ga0070687_100057167 3300005343 Bacteria 2045
23 Ga0070661_100005963 3300005344 Bacteria 8385
24 Ga0070661_100013319 3300005344 Bacteria 5773
25 Ga0070661_100020789 3300005344 Bacteria 4683
26 Ga0070661_100060924 3300005344 Bacteria 2769
27 Ga0070661_100070803 3300005344 Bacteria 2565
28 Ga0070661_100131886 3300005344 Bacteria 1877
29 Ga0070661_100544137 3300005344 Bacteria 933
30 Ga0070669_100260867 3300005353 Bacteria 1383
31 Ga0070675_100289142 3300005354 Bacteria 1442
32 Ga0070671_100000773 3300005355 Bacteria 22941
33 Ga0070671_100009026 3300005355 Bacteria 8000
34 Ga0070671_100018987 3300005355 Bacteria 5591
35 Ga0070674_100023891 3300005356 Bacteria 3963
36 Ga0070674_100091861 3300005356 Bacteria 2193
37 Ga0070673_100026185 3300005364 Bacteria 4304
38 Ga0070673_100035224 3300005364 Bacteria 3794
39 Ga0070673_100075602 3300005364 Bacteria 2717
40 Ga0070673_100123693 3300005364 Bacteria 2162
41 Ga0070673_100154723 3300005364 Bacteria 1945
42 Ga0070659_100003299 3300005366 Bacteria 11492
43 Ga0070659_100091676 3300005366 Bacteria 2436
44 Ga0070667_100001859 3300005367 Bacteria 18763
45 Ga0070667_100006887 3300005367 Bacteria 9442
46 Ga0070713_100218924 3300005436 Unclassified 1726
47 Ga0070663_100011047 3300005455 Bacteria 5653
48 Ga0070663_100018361 3300005455 Bacteria 4584
49 Ga0070663_100164239 3300005455 Bacteria 1711
50 Ga0070678_100005924 3300005456 Bacteria 7110
51 Ga0070678_100009191 3300005456 Bacteria 5971
52 Ga0070678_100216232 3300005456 Bacteria 1591
53 Ga0070662_100010153 3300005457 Bacteria 6169
54 Ga0070662_100062112 3300005457 Bacteria 2729
55 Ga0070681_10055825 3300005458 Bacteria 3931
56 Ga0070679_100371599 3300005530 Bacteria 1377
57 Ga0070684_100007162 3300005535 Bacteria 8666
58 Ga0070684_100018594 3300005535 Bacteria 5729
59 Ga0068853_100064610 3300005539 Unclassified 3174
60 Ga0068853_100083430 3300005539 Bacteria 2800
61 Ga0068853_100115248 3300005539 Bacteria 2391
62 Ga0068853_100133313 3300005539 Bacteria 2225
63 Ga0070672_100030117 3300005543 Bacteria 4074
64 Ga0070672_100037073 3300005543 Bacteria 3718
65 Ga0070672_100157004 3300005543 Bacteria 1885
66 Ga0070672_100390585 3300005543 Unclassified 1191
67 Ga0070665_100011428 3300005548 Bacteria 8976
68 Ga0070665_100028966 3300005548 Bacteria 5574
69 Ga0068855_100036351 3300005563 Bacteria 5863
70 Ga0068855_100385848 3300005563 Bacteria 1537
71 Ga0068855_100393787 3300005563 Bacteria 1519
72 Ga0068855_100492258 3300005563 Bacteria 1333
73 Ga0070664_100005817 3300005564 Bacteria 9945
74 Ga0070664_100007048 3300005564 Bacteria 9070
75 Ga0070664_100008931 3300005564 Bacteria 8126
76 Ga0070664_100009914 3300005564 Bacteria 7722
77 Ga0070664_100190119 3300005564 Bacteria 1829
78 Ga0068857_100005165 3300005577 Bacteria 11100
79 Ga0068857_100014492 3300005577 Bacteria 6876
80 Ga0068857_100028684 3300005577 Bacteria 4911
81 Ga0068857_100062611 3300005577 Bacteria 3307
82 Ga0068854_100024106 3300005578 Bacteria 4163
83 Ga0068854_100030143 3300005578 Bacteria 3761
84 Ga0068854_100040802 3300005578 Bacteria 3276
85 Ga0068854_100071558 3300005578 Unclassified 2537
86 Ga0068856_100017812 3300005614 Bacteria 6889
87 Ga0068856_100021660 3300005614 Bacteria 6246
88 Ga0068856_100027809 3300005614 Bacteria 5517
89 Ga0068856_100029260 3300005614 Bacteria 5381
90 Ga0068856_100113893 3300005614 Bacteria 2703
91 Ga0068852_100002526 3300005616 Bacteria 12606
92 Ga0068852_100026367 3300005616 Bacteria 4722
93 Ga0068852_100089831 3300005616 Bacteria 2746
94 Ga0068852_100237965 3300005616 Bacteria 1738
95 Ga0068859_100013006 3300005617 Bacteria 8361
96 Ga0068864_100002533 3300005618 Bacteria 15089
97 Ga0068864_100178045 3300005618 Bacteria 1942
98 Ga0068864_100285004 3300005618 Bacteria 1543
99 Ga0068866_10038110 3300005718 Bacteria 2365
100 Ga0068866_10044622 3300005718 Bacteria 2219
101 Ga0068851_10025717 3300005834 Bacteria 2889
102 Ga0068863_100004857 3300005841 Bacteria 13244
103 Ga0068863_100005862 3300005841 Bacteria 12035
104 Ga0068863_100008188 3300005841 Bacteria 10212
105 Ga0068863_100029320 3300005841 Bacteria 5252
106 Ga0068860_100084728 3300005843 Bacteria 3015
107 Ga0068860_100536606 3300005843 Bacteria 1171
108 Ga0081539_10036036 3300005985 Bacteria 2965
109 Ga0070717_10006511 3300006028 Bacteria 8594
110 Ga0097621_100011378 3300006237 Bacteria 6549
111 Ga0097621_100033731 3300006237 Bacteria 4079
112 Ga0068871_100014690 3300006358 Bacteria 5843
113 Ga0068871_100073133 3300006358 Bacteria 2826
114 Ga0068865_100025419 3300006881 Bacteria 3895
115 Ga0097620_100013006 3300006931 Bacteria 8361
116 Ga0105240_10014590 3300009093 Bacteria 10720
117 Ga0105240_10967786 3300009093 Bacteria 912
118 Ga0105245_10311203 3300009098 Bacteria 1549
119 Ga0105243_10034579 3300009148 Bacteria 3914
120 Ga0105241_10224322 3300009174 Bacteria 1581
121 Ga0105248_10011744 3300009177 Bacteria 9660
122 Ga0105248_10029505 3300009177 Bacteria 6119
123 Ga0105248_10029999 3300009177 Bacteria 6070
124 Ga0105248_10046672 3300009177 Bacteria 4856
125 Ga0105248_10067249 3300009177 Bacteria 4023
126 Ga0105248_10128111 3300009177 Bacteria 2863
127 Ga0105248_10183062 3300009177 Bacteria 2361
128 Ga0105248_10395372 3300009177 Bacteria 1556
129 Ga0105237_10015914 3300009545 Bacteria 7821
130 Ga0105237_10044899 3300009545 Bacteria 4449
131 Ga0105238_10005248 3300009551 Bacteria 12810
132 Ga0105238_10078488 3300009551 Bacteria 3291
133 Ga0105238_10443504 3300009551 Bacteria 1294
134 Ga0105249_10301255 3300009553 Bacteria 1608
135 Ga0157373_10007501 3300013100 Bacteria 8110
136 Ga0157373_10027801 3300013100 Bacteria 4080
137 Ga0157373_10174167 3300013100 Bacteria 1514
138 Ga0157373_10218970 3300013100 Bacteria 1343
139 Ga0157373_10247103 3300013100 Bacteria 1261
140 Ga0157371_10039577 3300013102 Bacteria 3371
141 Ga0157371_10107458 3300013102 Bacteria 1980
142 Ga0157371_10134166 3300013102 Bacteria 1763
143 Ga0157371_10134815 3300013102 Bacteria 1758
144 Ga0157370_10021079 3300013104 Bacteria 6497
145 Ga0157370_10240885 3300013104 Bacteria 1673
146 Ga0157369_10017309 3300013105 Bacteria 8102
147 Ga0157369_10048558 3300013105 Bacteria 4605
148 Ga0157369_10097818 3300013105 Bacteria 3130
149 Ga0157369_10263657 3300013105 Bacteria 1797
150 Ga0157369_10389313 3300013105 Bacteria 1446
151 Ga0157369_10498224 3300013105 Unclassified 1260
152 Ga0157374_10383810 3300013296 Bacteria 1400
153 Ga0157378_10029068 3300013297 Bacteria 4879
154 Ga0157378_10038876 3300013297 Bacteria 4219
155 Ga0163162_10021243 3300013306 Bacteria 6388
156 Ga0163162_10118010 3300013306 Bacteria 2755
157 Ga0157372_10273946 3300013307 Bacteria 1961
158 Ga0157375_10000296 3300013308 Bacteria 45207
159 Ga0157375_10050457 3300013308 Bacteria 4081
160 Ga0157375_10621650 3300013308 Bacteria 1238
161 Ga0163163_10012757 3300014325 Bacteria 7666
162 Ga0163163_10060101 3300014325 Bacteria 3762
163 Ga0163163_10132724 3300014325 Bacteria 2530
164 Ga0157377_10105997 3300014745 Bacteria 1683
165 Ga0157379_10022252 3300014968 Bacteria 5614
166 Ga0157376_10001808 3300014969 Bacteria 14227
167 Ga0163161_10048313 3300017792 Bacteria 3073
168 Ga0206353_10175799 3300020082 Bacteria 4118
169 Ga0206353_10932754 3300020082 Bacteria 1528
170 Ga0207656_10040723 3300025321 Bacteria 1971
171 Ga0207656_10159016 3300025321 Bacteria 1074
172 Ga0207656_10165129 3300025321 Bacteria 1055
173 Ga0207688_10016094 3300025901 Bacteria 4055
174 Ga0207680_10012612 3300025903 Bacteria 4310
175 Ga0207680_10139372 3300025903 Bacteria 1607
176 Ga0207647_10003096 3300025904 Bacteria 12494
177 Ga0207647_10050587 3300025904 Bacteria 2572
178 Ga0207647_10054530 3300025904 Bacteria 2459
179 Ga0207699_10052602 3300025906 Bacteria 2411
180 Ga0207645_10082103 3300025907 Bacteria 2066
181 Ga0207705_10007327 3300025909 Bacteria 8105
182 Ga0207705_10039799 3300025909 Bacteria 3369
183 Ga0207705_10182426 3300025909 Bacteria 1584
184 Ga0207705_10410658 3300025909 Unclassified 1047
185 Ga0207707_10245938 3300025912 Bacteria 1554
186 Ga0207695_10040988 3300025913 Bacteria 4958
187 Ga0207671_10020799 3300025914 Bacteria 4990
188 Ga0207660_10028200 3300025917 Bacteria 3838
189 Ga0207660_10212858 3300025917 Bacteria 1514
190 Ga0207660_10513070 3300025917 Bacteria 973
191 Ga0207662_10067165 3300025918 Bacteria 2162
192 Ga0207657_10008816 3300025919 Bacteria 10203
193 Ga0207657_10018700 3300025919 Bacteria 6603
194 Ga0207657_10029336 3300025919 Bacteria 5009
195 Ga0207657_10036655 3300025919 Bacteria 4388
196 Ga0207657_10139323 3300025919 Bacteria 1983
197 Ga0207657_10335557 3300025919 Bacteria 1194
198 Ga0207649_10008388 3300025920 Bacteria 5632
199 Ga0207649_10079631 3300025920 Bacteria 2117
200 Ga0207649_10101670 3300025920 Bacteria 1904
201 Ga0207649_10439665 3300025920 Unclassified 982
202 Ga0207652_10018468 3300025921 Bacteria 5721
203 Ga0207652_10062180 3300025921 Bacteria 3226
204 Ga0207652_10210814 3300025921 Bacteria 1749
205 Ga0207681_10310236 3300025923 Unclassified 1251
206 Ga0207694_10004309 3300025924 Bacteria 11120
207 Ga0207694_10065590 3300025924 Bacteria 2831
208 Ga0207650_10043611 3300025925 Bacteria 3293
209 Ga0207650_10049671 3300025925 Bacteria 3098
210 Ga0207659_10246130 3300025926 Bacteria 1449
211 Ga0207687_10117220 3300025927 Bacteria 1986
212 Ga0207700_10049325 3300025928 Bacteria 3131
213 Ga0207664_10114681 3300025929 Unclassified 2246
214 Ga0207644_10015430 3300025931 Bacteria 5127
215 Ga0207644_10022405 3300025931 Bacteria 4316
216 Ga0207644_10037183 3300025931 Bacteria 3423
217 Ga0207644_10108414 3300025931 Bacteria 2096
218 Ga0207690_10002269 3300025932 Bacteria 11725
219 Ga0207690_10066486 3300025932 Bacteria 2469
220 Ga0207690_10123700 3300025932 Bacteria 1883
221 Ga0207706_10003940 3300025933 Bacteria 14068
222 Ga0207706_10011200 3300025933 Bacteria 8176
223 Ga0207706_10015530 3300025933 Bacteria 6880
224 Ga0207706_10043593 3300025933 Bacteria 3975
225 Ga0207706_10207864 3300025933 Bacteria 1716
226 Ga0207706_10240364 3300025933 Bacteria 1583
227 Ga0207706_10260099 3300025933 Bacteria 1515
228 Ga0207709_10164628 3300025935 Bacteria 1550
229 Ga0207669_10004373 3300025937 Bacteria 6212
230 Ga0207691_10003309 3300025940 Bacteria 15700
231 Ga0207691_10013146 3300025940 Bacteria 7925
232 Ga0207691_10015595 3300025940 Bacteria 7225
233 Ga0207711_10035471 3300025941 Bacteria 4227
234 Ga0207711_10057825 3300025941 Bacteria 3334
235 Ga0207711_10139638 3300025941 Bacteria 2179
236 Ga0207711_10202999 3300025941 Bacteria 1809
237 Ga0207689_10113756 3300025942 Bacteria 2224
238 Ga0207661_10006246 3300025944 Bacteria 8426
239 Ga0207679_10114158 3300025945 Bacteria 2138
240 Ga0207679_10238187 3300025945 Bacteria 1540
241 Ga0207667_10038840 3300025949 Bacteria 5078
242 Ga0207667_10066080 3300025949 Bacteria 3771
243 Ga0207667_10201258 3300025949 Bacteria 2043
244 Ga0207651_10012586 3300025960 Bacteria 4796
245 Ga0207651_10034916 3300025960 Bacteria 3262
246 Ga0207651_10119803 3300025960 Bacteria 1993
247 Ga0207640_10009545 3300025981 Bacteria 5436
248 Ga0207640_10044484 3300025981 Unclassified 2845
249 Ga0207640_10487174 3300025981 Bacteria 1024
250 Ga0207640_10527816 3300025981 Unclassified 988
251 Ga0207658_10012794 3300025986 Bacteria 5730
252 Ga0207677_10016517 3300026023 Bacteria 4375
253 Ga0207703_10292808 3300026035 Bacteria 1482
254 Ga0207639_10006719 3300026041 Bacteria 7823
255 Ga0207639_10139307 3300026041 Bacteria 2019
256 Ga0207678_10024682 3300026067 Bacteria 5250
257 Ga0207678_10038592 3300026067 Bacteria 4149
258 Ga0207678_10040551 3300026067 Bacteria 4038
259 Ga0207678_10099945 3300026067 Bacteria 2478
260 Ga0207678_10113199 3300026067 Bacteria 2315
261 Ga0207702_10005019 3300026078 Bacteria 11627
262 Ga0207702_10031929 3300026078 Bacteria 4392
263 Ga0207702_10040020 3300026078 Bacteria 3929
264 Ga0207702_10440813 3300026078 Bacteria 1262
265 Ga0207641_10042461 3300026088 Bacteria 3815
266 Ga0207641_10105908 3300026088 Bacteria 2484
267 Ga0207648_10013607 3300026089 Bacteria 7557
268 Ga0207676_10015390 3300026095 Bacteria 5516
269 Ga0207674_10000347 3300026116 Bacteria 59568
270 Ga0207674_10000782 3300026116 Bacteria 41485
271 Ga0207674_10001873 3300026116 Bacteria 26800
272 Ga0207674_10015519 3300026116 Bacteria 8367
273 Ga0207674_10016538 3300026116 Bacteria 8069
274 Ga0207683_10004977 3300026121 Bacteria 11426
275 Ga0207683_10009327 3300026121 Bacteria 8360
276 Ga0207698_10000791 3300026142 Bacteria 18427
277 Ga0207698_10007129 3300026142 Bacteria 7000
278 Ga0207698_10012797 3300026142 Bacteria 5508
279 Ga0207698_10117371 3300026142 Bacteria 2245
280 Ga0268266_10034830 3300028379 Bacteria 4283
281 Ga0268264_10292523 3300028381 Bacteria 1530
282 Ga0268264_10370744 3300028381 Bacteria 1368
283 Ga0316177_1139633 3300030731 Bacteria 1320
284 Ga0307408_100045512 3300031548 Bacteria 3134
285 Ga0307405_10013091 3300031731 Bacteria 4416
286 Ga0307405_10091724 3300031731 Bacteria 2013
287 Ga0307413_10027910 3300031824 Bacteria 3135
288 Ga0307413_10135399 3300031824 Bacteria 1693
289 Ga0307413_10293745 3300031824 Bacteria 1229
290 Ga0307413_10308199 3300031824 Bacteria 1204
291 Ga0307410_10000697 3300031852 Bacteria 13997
292 Ga0307410_10085454 3300031852 Bacteria 2226
293 Ga0307410_10101090 3300031852 Bacteria 2066
294 Ga0307410_10179151 3300031852 Bacteria 1603
295 Ga0307410_10298039 3300031852 Bacteria 1271
296 Ga0307406_10040330 3300031901 Bacteria 2902
297 Ga0307407_10006432 3300031903 Bacteria 5220
298 Ga0307407_10068811 3300031903 Bacteria 2098
299 Ga0307407_10099996 3300031903 Bacteria 1798
300 Ga0307407_10106338 3300031903 Bacteria 1753
301 Ga0307407_10123290 3300031903 Bacteria 1646
302 Ga0307412_10025472 3300031911 Bacteria 3665
303 Ga0307412_10448841 3300031911 Bacteria 1062
304 Ga0307409_100056449 3300031995 Bacteria 3037
305 Ga0307409_100362546 3300031995 Bacteria 1371
306 Ga0307409_100559885 3300031995 Bacteria 1124
307 Ga0307416_100024296 3300032002 Bacteria 4419
308 Ga0307416_100251774 3300032002 Bacteria 1719
309 Ga0307414_10059749 3300032004 Bacteria 2693
310 Ga0307414_10140380 3300032004 Bacteria 1890
311 Ga0307414_10190425 3300032004 Bacteria 1659
312 Ga0307411_10002581 3300032005 Bacteria 8081
313 Ga0307411_10040210 3300032005 Bacteria 2964
314 Ga0307411_10063762 3300032005 Bacteria 2464
315 Ga0307411_10130433 3300032005 Bacteria 1836
316 Ga0307411_10137379 3300032005 Bacteria 1797
317 Ga0307411_10166070 3300032005 Bacteria 1659
318 Ga0307411_10273206 3300032005 Bacteria 1341
319 Ga0307415_100009323 3300032126 Bacteria 5494
320 Ga0307415_100010989 3300032126 Bacteria 5156
321 Ga0307415_100095549 3300032126 Bacteria 2164
322 Ga0307415_100190590 3300032126 Bacteria 1617
323 Ga0307415_100378180 3300032126 Bacteria 1201
324 Ga0395899_0001308 3300037312 Bacteria 21498
325 Ga0395899_0002057 3300037312 Bacteria 16558
326 Ga0395899_0002320 3300037312 Bacteria 15509
327 Ga0395899_0059781 3300037312 Bacteria 2809
328 Ga0395899_0091290 3300037312 Bacteria 2207
329 Ga0395899_0142474 3300037312 Bacteria 1704
330 Ga0395899_0258628 3300037312 Bacteria 1192
331 Ga0395900_0007644 3300037418 Bacteria 11158
332 Ga0395900_0011832 3300037418 Bacteria 8924
333 Ga0395900_0012943 3300037418 Bacteria 8523
334 Ga0395900_0015602 3300037418 Bacteria 7743
335 Ga0395900_0106953 3300037418 Bacteria 2874
336 Ga0395900_0114356 3300037418 Bacteria 2769
337 Ga0395900_0125665 3300037418 Bacteria 2630
338 Ga0395900_0156218 3300037418 Bacteria 2329
339 Ga0395900_0166320 3300037418 Bacteria 2247
340 Ga0395900_0192237 3300037418 Bacteria 2069
341 Ga0395900_0250765 3300037418 Bacteria 1771
342 Ga0395900_0290323 3300037418 Bacteria 1624
343 Ga0395898_0004303 3300037466 Bacteria 15595
344 Ga0395898_0006106 3300037466 Bacteria 12914
345 Ga0395898_0013522 3300037466 Bacteria 8404
346 Ga0395898_0162344 3300037466 Bacteria 2137
347 Ga0395898_0376159 3300037466 Bacteria 1354
348 Ga0395898_0493782 3300037466 Bacteria 1164
349 Ga0395905_0001816 3300037471 Bacteria 24696
350 Ga0395905_0002188 3300037471 Bacteria 22082
351 Ga0395905_0003075 3300037471 Bacteria 18051
352 Ga0395905_0011698 3300037471 Bacteria 8472
353 Ga0395905_0013290 3300037471 Bacteria 7895
354 Ga0395905_0014050 3300037471 Bacteria 7656
355 Ga0395905_0049828 3300037471 Bacteria 3925
356 Ga0395905_0060807 3300037471 Bacteria 3533
357 Ga0395905_0085815 3300037471 Bacteria 2950
358 Ga0395905_0111295 3300037471 Bacteria 2571
359 Ga0395905_0115057 3300037471 Bacteria 2527
360 Ga0395905_0155277 3300037471 Bacteria 2152
361 Ga0395905_0158692 3300037471 Bacteria 2126
362 Ga0395905_0215317 3300037471 Bacteria 1799
363 Ga0395901_0003488 3300038443 Bacteria 15846
364 Ga0395901_0014371 3300038443 Bacteria 8058
365 Ga0395901_0029349 3300038443 Bacteria 5662
366 Ga0395901_0030523 3300038443 Bacteria 5553
367 Ga0395901_0041563 3300038443 Bacteria 4766
368 Ga0395901_0050726 3300038443 Bacteria 4310
369 Ga0395901_0053791 3300038443 Bacteria 4183
370 Ga0395901_0088188 3300038443 Bacteria 3244
371 Ga0395901_0150703 3300038443 Unclassified 2444
372 Ga0395901_0316488 3300038443 Bacteria 1615
373 Ga0395901_0429209 3300038443 Bacteria 1354
374 Ga0395901_0507882 3300038443 Bacteria 1226
375 Ga0395901_0729010 3300038443 Bacteria 986
376 Ga0436365_1435754 3300039437 Bacteria 20552
377 Ga0439449_0050988 3300042007 Bacteria 1531
378 Ga0466969_0040908 3300044656 Bacteria 2321
379 Ga0466961_0101597 3300044693 Bacteria 1811
380 Ga0466961_0155358 3300044693 Bacteria 1427
381 Ga0466963_0002212 3300044694 Bacteria 10759
382 Ga0466963_0008651 3300044694 Bacteria 6110
383 Ga0466963_0108871 3300044694 Bacteria 1900
384 Ga0466964_0002775 3300044706 Bacteria 6291
385 Ga0466971_0003333 3300044719 Bacteria 6861
386 Ga0466971_0056574 3300044719 Bacteria 1769
387 Ga0466968_0031631 3300044735 Bacteria 2196
388 Ga0466968_0065626 3300044735 Bacteria 1572
389 Ga0466970_0072906 3300044765 Bacteria 1848
390 Ga0466957_0008931 3300044842 Bacteria 5712
391 Ga0466957_0012903 3300044842 Bacteria 4842
392 Ga0466959_0043796 3300045049 Bacteria 3298
393 Ga0466959_0136562 3300045049 Bacteria 1735
394 Ga0466958_0012655 3300045836 Bacteria 4783
395 Ga0466958_0030532 3300045836 Bacteria 3202
396 Ga0466958_0053281 3300045836 Bacteria 2452
397 Ga0466958_0148767 3300045836 Bacteria 1477
398 Ga0466958_0167243 3300045836 Bacteria 1392
399 Ga0466958_0171620 3300045836 Unclassified 1373
400 Ga0466967_0029723 3300045976 Bacteria 4577
401 Ga0466967_0110620 3300045976 Bacteria 2524
402 Ga0466967_0124269 3300045976 Bacteria 2388
403 Ga0466967_0273124 3300045976 Bacteria 1620
404 Ga0466967_0748571 3300045976 Unclassified 969
405 Ga0495669_0026382 3300046684 Bacteria 2539
406 Ga0495669_0060981 3300046684 Bacteria 1706
407 Ga0496100_0127529 3300048903 Bacteria 1788
408 Ga0496101_0034546 3300048904 Bacteria 3571
409 Ga0496101_0055109 3300048904 Bacteria 2871
410 Ga0496101_0080113 3300048904 Bacteria 2412
411 Ga0496101_0169449 3300048904 Bacteria 1678
412 Ga0496101_0192048 3300048904 Bacteria 1576
413 Ga0496102_0042374 3300048905 Bacteria 4124
414 Ga0496102_0188833 3300048905 Bacteria 1942
415 Ga0496102_0202713 3300048905 Bacteria 1870
416 Ga0496102_0257870 3300048905 Unclassified 1644
417 Ga0496103_0039452 3300048906 Bacteria 2902
418 Ga0496104_0046134 3300048907 Bacteria 4102
419 Ga0496105_0050458 3300048908 Bacteria 3437
420 Ga0496106_0035355 3300048909 Bacteria 3736
421 Ga0496107_0012594 3300048910 Bacteria 5906
422 Ga0496107_0032771 3300048910 Bacteria 3715
423 Ga0496107_0151047 3300048910 Bacteria 1718
424 Ga0496107_0391235 3300048910 Unclassified 1034
425 Ga0496108_0000883 3300048911 Bacteria 23370
426 Ga0496108_0003813 3300048911 Bacteria 12074
427 Ga0496108_0021979 3300048911 Bacteria 5243
428 Ga0496108_0022104 3300048911 Bacteria 5229
429 Ga0496108_0034052 3300048911 Bacteria 4231
430 Ga0496109_0009266 3300048912 Bacteria 8385
431 Ga0496109_0013334 3300048912 Bacteria 7124
432 Ga0496109_0070071 3300048912 Bacteria 3217
433 Ga0496109_0074180 3300048912 Bacteria 3127
434 Ga0496109_0258326 3300048912 Bacteria 1641
435 Ga0496110_0005777 3300048913 Bacteria 9723
436 Ga0496110_0008800 3300048913 Bacteria 8133
437 Ga0496111_0003982 3300048914 Bacteria 9274
438 Ga0496111_0008127 3300048914 Bacteria 6931
439 Ga0496111_0010370 3300048914 Bacteria 6249
440 Ga0496111_0169198 3300048914 Bacteria 1624
441 Ga0496112_0035559 3300048915 Bacteria 4853
442 Ga0496112_0039774 3300048915 Bacteria 4596
443 Ga0496112_0067454 3300048915 Bacteria 3531
444 Ga0496112_0081233 3300048915 Bacteria 3205
445 Ga0496113_0005161 3300048916 Bacteria 8122
446 Ga0496113_0016203 3300048916 Bacteria 5144
447 Ga0496113_0023845 3300048916 Bacteria 4343
448 Ga0496114_0003919 3300048917 Bacteria 11481
449 Ga0496114_0028693 3300048917 Bacteria 4568
450 Ga0496114_0644651 3300048917 Bacteria 932
451 Ga0496115_0010292 3300048918 Bacteria 6982
452 Ga0496115_0299656 3300048918 Bacteria 1317
453 Ga0501067_0111322 3300049583 Bacteria 1522
454 Ga0501069_0103257 3300049585 Unclassified 1619
455 Ga0501209_025898 3300049656 Bacteria 1443
456 Ga0501245_011307 3300049708 Bacteria 1297
457 Ga0501268_013045 3300049765 Bacteria 1337
458 Ga0495655_0058208 3300053083 Bacteria 1046
459 Ga0466962_0048957 3300061719 Bacteria 2020
460 Ga0466962_0065378 3300061719 Unclassified 1737
461 Ga0395905_0515660
462 JGI24739J22299_10016068
463 JGI24735J21928_10002654
464 JGI24744J21845_10010937
465 Ga0070658_10016639
466 Ga0070658_10071868
467 Ga0070676_10036999
468 Ga0070683_100006282
469 Ga0070683_100013626
470 Ga0070683_100263406
471 Ga0070670_100012404
472 Ga0068869_100122775
473 Ga0070666_10002901
474 Ga0070666_10134732
475 Ga0070680_100002872
476 Ga0070680_100088060
477 Ga0070680_100254280
478 Ga0068868_100039613
479 Ga0070660_100005974
480 Ga0070660_100026633
481 Ga0070660_100080184
482 Ga0070687_100057167
483 Ga0070661_100005963
484 Ga0070661_100013319
485 Ga0070661_100020789
486 Ga0070661_100060924
487 Ga0070661_100070803
488 Ga0070661_100131886
489 Ga0070661_100544137
490 Ga0070669_100260867
491 Ga0070675_100289142
492 Ga0070671_100000773
493 Ga0070671_100009026
494 Ga0070671_100018987
495 Ga0070674_100023891
496 Ga0070674_100091861
497 Ga0070673_100026185
498 Ga0070673_100035224
499 Ga0070673_100075602
500 Ga0070673_100123693
501 Ga0070673_100154723
502 Ga0070659_100003299
503 Ga0070659_100091676
504 Ga0070667_100001859
505 Ga0070667_100006887
506 Ga0070713_100218924
507 Ga0070663_100011047
508 Ga0070663_100018361
509 Ga0070663_100164239
510 Ga0070678_100005924
511 Ga0070678_100009191
512 Ga0070678_100216232
513 Ga0070662_100010153
514 Ga0070662_100062112
515 Ga0070681_10055825
516 Ga0070679_100371599
517 Ga0070684_100007162
518 Ga0070684_100018594
519 Ga0068853_100064610
520 Ga0068853_100083430
521 Ga0068853_100115248
522 Ga0068853_100133313
523 Ga0070672_100030117
524 Ga0070672_100037073
525 Ga0070672_100157004
526 Ga0070672_100390585
527 Ga0070665_100011428
528 Ga0070665_100028966
529 Ga0068855_100036351
530 Ga0068855_100385848
531 Ga0068855_100393787
532 Ga0068855_100492258
533 Ga0070664_100005817
534 Ga0070664_100007048
535 Ga0070664_100008931
536 Ga0070664_100009914
537 Ga0070664_100190119
538 Ga0068857_100005165
539 Ga0068857_100014492
540 Ga0068857_100028684
541 Ga0068857_100062611
542 Ga0068854_100024106
543 Ga0068854_100030143
544 Ga0068854_100040802
545 Ga0068854_100071558
546 Ga0068856_100017812
547 Ga0068856_100021660
548 Ga0068856_100027809
549 Ga0068856_100029260
550 Ga0068856_100113893
551 Ga0068852_100002526
552 Ga0068852_100026367
553 Ga0068852_100089831
554 Ga0068852_100237965
555 Ga0068859_100013006
556 Ga0068864_100002533
557 Ga0068864_100178045
558 Ga0068864_100285004
559 Ga0068866_10038110
560 Ga0068866_10044622
561 Ga0068851_10025717
562 Ga0068863_100004857
563 Ga0068863_100005862
564 Ga0068863_100008188
565 Ga0068863_100029320
566 Ga0068860_100084728
567 Ga0068860_100536606
568 Ga0081539_10036036
569 Ga0070717_10006511
570 Ga0097621_100011378
571 Ga0097621_100033731
572 Ga0068871_100014690
573 Ga0068871_100073133
574 Ga0068865_100025419
575 Ga0097620_100013006
576 Ga0105240_10014590
577 Ga0105240_10967786
578 Ga0105245_10311203
579 Ga0105243_10034579
580 Ga0105241_10224322
581 Ga0105248_10011744
582 Ga0105248_10029505
583 Ga0105248_10029999
584 Ga0105248_10046672
585 Ga0105248_10067249
586 Ga0105248_10128111
587 Ga0105248_10183062
588 Ga0105248_10395372
589 Ga0105237_10015914
590 Ga0105237_10044899
591 Ga0105238_10005248
592 Ga0105238_10078488
593 Ga0105238_10443504
594 Ga0105249_10301255
595 Ga0157373_10007501
596 Ga0157373_10027801
597 Ga0157373_10174167
598 Ga0157373_10218970
599 Ga0157373_10247103
600 Ga0157371_10039577
601 Ga0157371_10107458
602 Ga0157371_10134166
603 Ga0157371_10134815
604 Ga0157370_10021079
605 Ga0157370_10240885
606 Ga0157369_10017309
607 Ga0157369_10048558
608 Ga0157369_10097818
609 Ga0157369_10263657
610 Ga0157369_10389313
611 Ga0157369_10498224
612 Ga0157374_10383810
613 Ga0157378_10029068
614 Ga0157378_10038876
615 Ga0163162_10021243
616 Ga0163162_10118010
617 Ga0157372_10273946
618 Ga0157375_10000296
619 Ga0157375_10050457
620 Ga0157375_10621650
621 Ga0163163_10012757
622 Ga0163163_10060101
623 Ga0163163_10132724
624 Ga0157377_10105997
625 Ga0157379_10022252
626 Ga0157376_10001808
627 Ga0163161_10048313
628 Ga0206353_10175799
629 Ga0206353_10932754
630 Ga0207656_10040723
631 Ga0207656_10159016
632 Ga0207656_10165129
633 Ga0207688_10016094
634 Ga0207680_10012612
635 Ga0207680_10139372
636 Ga0207647_10003096
637 Ga0207647_10050587
638 Ga0207647_10054530
639 Ga0207699_10052602
640 Ga0207645_10082103
641 Ga0207705_10007327
642 Ga0207705_10039799
643 Ga0207705_10182426
644 Ga0207705_10410658
645 Ga0207707_10245938
646 Ga0207695_10040988
647 Ga0207671_10020799
648 Ga0207660_10028200
649 Ga0207660_10212858
650 Ga0207660_10513070
651 Ga0207662_10067165
652 Ga0207657_10008816
653 Ga0207657_10018700
654 Ga0207657_10029336
655 Ga0207657_10036655
656 Ga0207657_10139323
657 Ga0207657_10335557
658 Ga0207649_10008388
659 Ga0207649_10079631
660 Ga0207649_10101670
661 Ga0207649_10439665
662 Ga0207652_10018468
663 Ga0207652_10062180
664 Ga0207652_10210814
665 Ga0207681_10310236
666 Ga0207694_10004309
667 Ga0207694_10065590
668 Ga0207650_10043611
669 Ga0207650_10049671
670 Ga0207659_10246130
671 Ga0207687_10117220
672 Ga0207700_10049325
673 Ga0207664_10114681
674 Ga0207644_10015430
675 Ga0207644_10022405
676 Ga0207644_10037183
677 Ga0207644_10108414
678 Ga0207690_10002269
679 Ga0207690_10066486
680 Ga0207690_10123700
681 Ga0207706_10003940
682 Ga0207706_10011200
683 Ga0207706_10015530
684 Ga0207706_10043593
685 Ga0207706_10207864
686 Ga0207706_10240364
687 Ga0207706_10260099
688 Ga0207709_10164628
689 Ga0207669_10004373
690 Ga0207691_10003309
691 Ga0207691_10013146
692 Ga0207691_10015595
693 Ga0207711_10035471
694 Ga0207711_10057825
695 Ga0207711_10139638
696 Ga0207711_10202999
697 Ga0207689_10113756
698 Ga0207661_10006246
699 Ga0207679_10114158
700 Ga0207679_10238187
701 Ga0207667_10038840
702 Ga0207667_10066080
703 Ga0207667_10201258
704 Ga0207651_10012586
705 Ga0207651_10034916
706 Ga0207651_10119803
707 Ga0207640_10009545
708 Ga0207640_10044484
709 Ga0207640_10487174
710 Ga0207640_10527816
711 Ga0207658_10012794
712 Ga0207677_10016517
713 Ga0207703_10292808
714 Ga0207639_10006719
715 Ga0207639_10139307
716 Ga0207678_10024682
717 Ga0207678_10038592
718 Ga0207678_10040551
719 Ga0207678_10099945
720 Ga0207678_10113199
721 Ga0207702_10005019
722 Ga0207702_10031929
723 Ga0207702_10040020
724 Ga0207702_10440813
725 Ga0207641_10042461
726 Ga0207641_10105908
727 Ga0207648_10013607
728 Ga0207676_10015390
729 Ga0207674_10000347
730 Ga0207674_10000782
731 Ga0207674_10001873
732 Ga0207674_10015519
733 Ga0207674_10016538
734 Ga0207683_10004977
735 Ga0207683_10009327
736 Ga0207698_10000791
737 Ga0207698_10007129
738 Ga0207698_10012797
739 Ga0207698_10117371
740 Ga0268266_10034830
741 Ga0268264_10292523
742 Ga0268264_10370744
743 Ga0316177_1139633
744 Ga0307408_100045512
745 Ga0307405_10013091
746 Ga0307405_10091724
747 Ga0307413_10027910
748 Ga0307413_10135399
749 Ga0307413_10293745
750 Ga0307413_10308199
751 Ga0307410_10000697
752 Ga0307410_10085454
753 Ga0307410_10101090
754 Ga0307410_10179151
755 Ga0307410_10298039
756 Ga0307406_10040330
757 Ga0307407_10006432
758 Ga0307407_10068811
759 Ga0307407_10099996
760 Ga0307407_10106338
761 Ga0307407_10123290
762 Ga0307412_10025472
763 Ga0307412_10448841
764 Ga0307409_100056449
765 Ga0307409_100362546
766 Ga0307409_100559885
767 Ga0307416_100024296
768 Ga0307416_100251774
769 Ga0307414_10059749
770 Ga0307414_10140380
771 Ga0307414_10190425
772 Ga0307411_10002581
773 Ga0307411_10040210
774 Ga0307411_10063762
775 Ga0307411_10130433
776 Ga0307411_10137379
777 Ga0307411_10166070
778 Ga0307411_10273206
779 Ga0307415_100009323
780 Ga0307415_100010989
781 Ga0307415_100095549
782 Ga0307415_100190590
783 Ga0307415_100378180
784 Ga0395899_0001308
785 Ga0395899_0002057
786 Ga0395899_0002320
787 Ga0395899_0059781
788 Ga0395899_0091290
789 Ga0395899_0142474
790 Ga0395899_0258628
791 Ga0395900_0007644
792 Ga0395900_0011832
793 Ga0395900_0012943
794 Ga0395900_0015602
795 Ga0395900_0106953
796 Ga0395900_0114356
797 Ga0395900_0125665
798 Ga0395900_0156218
799 Ga0395900_0166320
800 Ga0395900_0192237
801 Ga0395900_0250765
802 Ga0395900_0290323
803 Ga0395898_0004303
804 Ga0395898_0006106
805 Ga0395898_0013522
806 Ga0395898_0162344
807 Ga0395898_0376159
808 Ga0395898_0493782
809 Ga0395905_0001816
810 Ga0395905_0002188
811 Ga0395905_0003075
812 Ga0395905_0011698
813 Ga0395905_0013290
814 Ga0395905_0014050
815 Ga0395905_0049828
816 Ga0395905_0060807
817 Ga0395905_0085815
818 Ga0395905_0111295
819 Ga0395905_0115057
820 Ga0395905_0155277
821 Ga0395905_0158692
822 Ga0395905_0215317
823 Ga0395901_0003488
824 Ga0395901_0014371
825 Ga0395901_0029349
826 Ga0395901_0030523
827 Ga0395901_0041563
828 Ga0395901_0050726
829 Ga0395901_0053791
830 Ga0395901_0088188
831 Ga0395901_0150703
832 Ga0395901_0316488
833 Ga0395901_0429209
834 Ga0395901_0507882
835 Ga0395901_0729010
836 Ga0436365_1435754
837 Ga0439449_0050988
838 Ga0466969_0040908
839 Ga0466961_0101597
840 Ga0466961_0155358
841 Ga0466963_0002212
842 Ga0466963_0008651
843 Ga0466963_0108871
844 Ga0466964_0002775
845 Ga0466971_0003333
846 Ga0466971_0056574
847 Ga0466968_0031631
848 Ga0466968_0065626
849 Ga0466970_0072906
850 Ga0466957_0008931
851 Ga0466957_0012903
852 Ga0466959_0043796
853 Ga0466959_0136562
854 Ga0466958_0012655
855 Ga0466958_0030532
856 Ga0466958_0053281
857 Ga0466958_0148767
858 Ga0466958_0167243
859 Ga0466958_0171620
860 Ga0466967_0029723
861 Ga0466967_0110620
862 Ga0466967_0124269
863 Ga0466967_0273124
864 Ga0466967_0748571
865 Ga0495669_0026382
866 Ga0495669_0060981
867 Ga0496100_0127529
868 Ga0496101_0034546
869 Ga0496101_0055109
870 Ga0496101_0080113
871 Ga0496101_0169449
872 Ga0496101_0192048
873 Ga0496102_0042374
874 Ga0496102_0188833
875 Ga0496102_0202713
876 Ga0496102_0257870
877 Ga0496103_0039452
878 Ga0496104_0046134
879 Ga0496105_0050458
880 Ga0496106_0035355
881 Ga0496107_0012594
882 Ga0496107_0032771
883 Ga0496107_0151047
884 Ga0496107_0391235
885 Ga0496108_0000883
886 Ga0496108_0003813
887 Ga0496108_0021979
888 Ga0496108_0022104
889 Ga0496108_0034052
890 Ga0496109_0009266
891 Ga0496109_0013334
892 Ga0496109_0070071
893 Ga0496109_0074180
894 Ga0496109_0258326
895 Ga0496110_0005777
896 Ga0496110_0008800
897 Ga0496111_0003982
898 Ga0496111_0008127
899 Ga0496111_0010370
900 Ga0496111_0169198
901 Ga0496112_0035559
902 Ga0496112_0039774
903 Ga0496112_0067454
904 Ga0496112_0081233
905 Ga0496113_0005161
906 Ga0496113_0016203
907 Ga0496113_0023845
908 Ga0496114_0003919
909 Ga0496114_0028693
910 Ga0496114_0644651
911 Ga0496115_0010292
912 Ga0496115_0299656
913 Ga0501067_0111322
914 Ga0501069_0103257
915 Ga0501209_025898
916 Ga0501245_011307
917 Ga0501268_013045
918 Ga0495655_0058208
919 Ga0466962_0048957
920 Ga0466962_0065378

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13344

Hydrolase_6

Haloacid dehalogenase-like hydrolase

14

112

0.95

PF13242

Hydrolase_like

HAD-hyrolase-like

186

269

0.82

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

151

228

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ho4-assembly2.cif.gz_B crystal structure of protein from mouse mm.236127 0.8395 12 265
3hlt-assembly2.cif.gz_C the crystal structure of human haloacid dehalogenase-like hydrolase domain containing 2 (hdhd2) 0.8326 11 266
6nq4-assembly2.cif.gz_B crystal structure of a hydrolase, haloacid dehalogenase-like family from brucella suis 1330 0.8266 4 241
3hlt-assembly1.cif.gz_A the crystal structure of human haloacid dehalogenase-like hydrolase domain containing 2 (hdhd2) 0.8256 11 266
2ho4-assembly1.cif.gz_A crystal structure of protein from mouse mm.236127 0.8212 12 266
ID Description Score Start End Superfamily
af_Q655Y3_10_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8803 27 234 3.40.50.1000
af_O44538_58_131_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8781 15 81 3.40.50.1000
2om6B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8724 11 234 3.40.50.1000
3kzxA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8539 13 234 3.40.50.1000
af_Q9H0R4_7_106_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8516 12 92 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A7Y1T865-F1-model_v4 deleted 0.9613 4 265
AF-A0A429VAL4-F1-model_v4 HAD-IIA family hydrolase 0.9551 2 267 GO:0005737
GO:0016791
AF-A0A7Y1T865-F1-model_v4 deleted 0.947 4 265
AF-A0A429VAL4-F1-model_v4 HAD-IIA family hydrolase 0.9447 2 267 GO:0005737
GO:0016791
AF-A0A7H0GEU8-F1-model_v4 deleted 0.939 136 267

Map