F448568

General Info

Members Datasets Scaffolds Average Seq Length
460 294 920 321

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10002217|Ga0265327_100022174
Length 321
Sequence VENVYRPRRTCLSVPGSSDKMIAKAKTLPADQVFLDLEDAVAADAKAAARTRVAEALCEPGWAGQLRGLRVNDWTTPWTYADVIEVVTAVARGGGELDVIVLPKVSDVSHVHALDLLLTQLERTHGLPVGRIGIEAQIEDAKGLTNADAIAGGPRVQALIFGPGDLMASLNMRTLVVGEQPVGYGVGDAYHHVLMTILVAARAHGINAIDGPYFKVKDTEAFTRVAGQTAALGYDGKWVLHPDQIAAGNEIFSPRQADYDHAELILEAYEWHTSQAGGARGAVLLGDEMIDEASRKMALVIAGKGRAAGMTRTGERFSPPA

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
147 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
151 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
152 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
156 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
157 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
158 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
159 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
164 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
165 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
172 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
176 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
181 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
182 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
202 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
225 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
226 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
260 2547132424 Nocardia nova SH22a Isolate Unclassified
261 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
262 2558860280 Kutzneria sp. 744 Isolate Unclassified
263 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
264 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
265 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
266 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
267 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
268 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
269 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
270 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
271 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
272 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
273 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
274 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
275 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
276 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
277 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
278 2891562705 Microbispora tritici MT50 Isolate Unclassified
279 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
280 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
281 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
282 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
283 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
284 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
285 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
286 2922554459 Rhodococcus sp. 66b Isolate Unclassified
287 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
288 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
289 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
290 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
291 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
292 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
293 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
294 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.74
Metatranscriptomes 0.65
Isolates 7.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.22
Bulb 0
Endosphere 0.87
Nodule 0
Rhizoplane 5.87
Rhizosphere 86.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10002217 3300031251 Bacteria 21198
2 JGI24737J22298_10050123 3300001990 Bacteria 1269
3 JGI24735J21928_10007384 3300002067 Bacteria 3587
4 JGI24735J21928_10032429 3300002067 Bacteria 1546
5 JGI24745J21846_1001351 3300002073 Bacteria 2368
6 JGI25406J46586_10005170 3300003203 Bacteria 6053
7 Ga0055540_1000052 3300003792 Bacteria 143472
8 Ga0070670_100434066 3300005331 Bacteria 1162
9 Ga0068869_100017531 3300005334 Bacteria 4855
10 Ga0068869_100087056 3300005334 Bacteria 2343
11 Ga0070682_100230845 3300005337 Bacteria 1323
12 Ga0068868_100156744 3300005338 Bacteria 1878
13 Ga0068868_100309555 3300005338 Bacteria 1343
14 Ga0070660_100009360 3300005339 Bacteria 6885
15 Ga0070660_100043510 3300005339 Bacteria 3432
16 Ga0070689_100136404 3300005340 Bacteria 1970
17 Ga0070689_100219564 3300005340 Bacteria 1559
18 Ga0070687_100003775 3300005343 Bacteria 5939
19 Ga0070692_10079081 3300005345 Bacteria 1767
20 Ga0070668_100043811 3300005347 Bacteria 3432
21 Ga0070668_100267111 3300005347 Bacteria 1425
22 Ga0070671_100001748 3300005355 Bacteria 16507
23 Ga0070674_100113325 3300005356 Bacteria 1995
24 Ga0070673_100213194 3300005364 Bacteria 1669
25 Ga0070688_100040582 3300005365 Bacteria 2853
26 Ga0070659_100000118 3300005366 Bacteria 59407
27 Ga0070667_100007753 3300005367 Bacteria 8902
28 Ga0070667_100021634 3300005367 Bacteria 5338
29 Ga0070667_100269657 3300005367 Bacteria 1526
30 Ga0070714_100007102 3300005435 Bacteria 8686
31 Ga0070714_100034904 3300005435 Bacteria 4212
32 Ga0070714_100216703 3300005435 Bacteria 1757
33 Ga0070714_100262909 3300005435 Bacteria 1598
34 Ga0070713_100047311 3300005436 Bacteria 3535
35 Ga0070713_100184931 3300005436 Bacteria 1875
36 Ga0070710_10007632 3300005437 Bacteria 5242
37 Ga0070710_10081063 3300005437 Bacteria 1894
38 Ga0070711_100002351 3300005439 Bacteria 10752
39 Ga0070700_100000031 3300005441 Bacteria 117217
40 Ga0070700_100005474 3300005441 Bacteria 6733
41 Ga0070694_100019599 3300005444 Bacteria 4304
42 Ga0070663_100181417 3300005455 Bacteria 1633
43 Ga0070678_100030266 3300005456 Bacteria 3719
44 Ga0070678_100082677 3300005456 Bacteria 2438
45 Ga0070678_100459238 3300005456 Bacteria 1117
46 Ga0070662_100010287 3300005457 Bacteria 6133
47 Ga0070679_100006550 3300005530 Bacteria 10855
48 Ga0070684_100327574 3300005535 Bacteria 1407
49 Ga0068853_100232066 3300005539 Bacteria 1688
50 Ga0070672_100174693 3300005543 Bacteria 1788
51 Ga0070686_100010222 3300005544 Bacteria 5284
52 Ga0070695_100107622 3300005545 Bacteria 1887
53 Ga0070696_100129354 3300005546 Bacteria 1836
54 Ga0070665_100003039 3300005548 Bacteria 18078
55 Ga0070665_100011089 3300005548 Bacteria 9106
56 Ga0070665_100022561 3300005548 Bacteria 6336
57 Ga0068855_100014800 3300005563 Bacteria 9393
58 Ga0070664_100108679 3300005564 Bacteria 2419
59 Ga0070664_100126594 3300005564 Bacteria 2241
60 Ga0068857_100090200 3300005577 Bacteria 2743
61 Ga0068854_100019370 3300005578 Bacteria 4584
62 Ga0068856_100006403 3300005614 Bacteria 11551
63 Ga0068856_100009036 3300005614 Bacteria 9696
64 Ga0068856_100106497 3300005614 Bacteria 2798
65 Ga0068856_100156708 3300005614 Bacteria 2287
66 Ga0068852_100345320 3300005616 Bacteria 1452
67 Ga0068864_100071913 3300005618 Bacteria 3013
68 Ga0068866_10021408 3300005718 Bacteria 2978
69 Ga0068866_10106690 3300005718 Bacteria 1555
70 Ga0068851_10098218 3300005834 Bacteria 1550
71 Ga0068870_10063842 3300005840 Bacteria 1987
72 Ga0068863_100000580 3300005841 Bacteria 37264
73 Ga0068863_100109068 3300005841 Bacteria 2635
74 Ga0068858_100000328 3300005842 Bacteria 50178
75 Ga0068858_100020931 3300005842 Bacteria 6112
76 Ga0068860_100000345 3300005843 Bacteria 62383
77 Ga0068860_100042279 3300005843 Bacteria 4353
78 Ga0068860_100060595 3300005843 Bacteria 3597
79 Ga0081455_10000507 3300005937 Bacteria 50462
80 Ga0081455_10033981 3300005937 Bacteria 4575
81 Ga0081455_10040578 3300005937 Bacteria 4102
82 Ga0081538_10000095 3300005981 Bacteria 86487
83 Ga0081540_1000710 3300005983 Bacteria 30907
84 Ga0081540_1066502 3300005983 Bacteria 1689
85 Ga0081539_10000272 3300005985 Bacteria 118649
86 Ga0081539_10005560 3300005985 Bacteria 12768
87 Ga0081539_10020947 3300005985 Bacteria 4390
88 Ga0070717_10075662 3300006028 Bacteria 2816
89 Ga0070717_10350538 3300006028 Bacteria 1320
90 Ga0075363_100046156 3300006048 Bacteria 2311
91 Ga0070715_10005387 3300006163 Bacteria 4263
92 Ga0070716_100001095 3300006173 Bacteria 11898
93 Ga0070716_100005851 3300006173 Bacteria 5975
94 Ga0070712_100005917 3300006175 Bacteria 7568
95 Ga0097621_100019065 3300006237 Bacteria 5259
96 Ga0097621_100166517 3300006237 Bacteria 1898
97 Ga0068871_100105622 3300006358 Bacteria 2363
98 Ga0068871_100282500 3300006358 Bacteria 1452
99 Ga0075428_100002618 3300006844 Bacteria 19591
100 Ga0075428_100023167 3300006844 Bacteria 6869
101 Ga0075430_100000734 3300006846 Bacteria 25115
102 Ga0075431_100001048 3300006847 Bacteria 24677
103 Ga0075431_100002049 3300006847 Bacteria 19255
104 Ga0075429_100000366 3300006880 Bacteria 33350
105 Ga0075429_100026194 3300006880 Bacteria 5061
106 Ga0068865_100129155 3300006881 Bacteria 1891
107 Ga0075436_100112115 3300006914 Bacteria 1904
108 Ga0075435_100007664 3300007076 Bacteria 7710
109 Ga0105240_10053377 3300009093 Bacteria 5073
110 Ga0105240_10119840 3300009093 Bacteria 3169
111 Ga0105240_10481320 3300009093 Bacteria 1384
112 Ga0105240_10683817 3300009093 Bacteria 1121
113 Ga0105245_10043338 3300009098 Bacteria 4013
114 Ga0105245_10174023 3300009098 Bacteria 2052
115 Ga0114129_10003185 3300009147 Bacteria 23009
116 Ga0114129_10091315 3300009147 Bacteria 4219
117 Ga0105243_10000243 3300009148 Bacteria 62451
118 Ga0105241_10292680 3300009174 Bacteria 1395
119 Ga0105248_10000450 3300009177 Bacteria 46809
120 Ga0105248_10023561 3300009177 Bacteria 6839
121 Ga0105248_10031564 3300009177 Bacteria 5920
122 Ga0105248_10338197 3300009177 Bacteria 1695
123 Ga0105237_10048304 3300009545 Bacteria 4278
124 Ga0105237_10188298 3300009545 Bacteria 2064
125 Ga0105238_10032836 3300009551 Bacteria 5283
126 Ga0105249_10004171 3300009553 Bacteria 12481
127 Ga0105249_10075485 3300009553 Bacteria 3122
128 Ga0105239_10118719 3300010375 Bacteria 2935
129 Ga0105239_10169295 3300010375 Bacteria 2443
130 Ga0105246_10016685 3300011119 Bacteria 4654
131 Ga0157373_10132994 3300013100 Bacteria 1749
132 Ga0157370_10018215 3300013104 Bacteria 7066
133 Ga0157370_10064903 3300013104 Bacteria 3455
134 Ga0157369_10442983 3300013105 Bacteria 1345
135 Ga0157378_10254131 3300013297 Bacteria 1684
136 Ga0163162_10159020 3300013306 Bacteria 2380
137 Ga0157372_10000023 3300013307 Bacteria 198536
138 Ga0157372_10074981 3300013307 Bacteria 3816
139 Ga0157375_10498275 3300013308 Bacteria 1382
140 Ga0163163_10008174 3300014325 Bacteria 9280
141 Ga0163163_10079453 3300014325 Bacteria 3278
142 Ga0163163_10086125 3300014325 Bacteria 3150
143 Ga0157380_10186319 3300014326 Bacteria 1828
144 Ga0157377_10037100 3300014745 Bacteria 2685
145 Ga0157379_10000015 3300014968 Bacteria 104289
146 Ga0157379_10002387 3300014968 Bacteria 15694
147 Ga0163161_10005938 3300017792 Bacteria 8463
148 Ga0206353_11004473 3300020082 Bacteria 1608
149 Ga0224712_10009359 3300022467 Bacteria 2950
150 Ga0207692_10000457 3300025898 Bacteria 14468
151 Ga0207692_10003071 3300025898 Bacteria 6481
152 Ga0207642_10065658 3300025899 Bacteria 1706
153 Ga0207710_10067393 3300025900 Bacteria 1635
154 Ga0207688_10000271 3300025901 Bacteria 23580
155 Ga0207680_10120961 3300025903 Bacteria 1712
156 Ga0207680_10189588 3300025903 Bacteria 1395
157 Ga0207647_10046448 3300025904 Bacteria 2706
158 Ga0207647_10068168 3300025904 Bacteria 2154
159 Ga0207647_10098969 3300025904 Bacteria 1732
160 Ga0207685_10012715 3300025905 Bacteria 2579
161 Ga0207699_10088511 3300025906 Bacteria 1938
162 Ga0207645_10058998 3300025907 Bacteria 2450
163 Ga0207643_10013687 3300025908 Bacteria 4398
164 Ga0207707_10007451 3300025912 Bacteria 9534
165 Ga0207695_10044375 3300025913 Bacteria 4728
166 Ga0207671_10055038 3300025914 Bacteria 2948
167 Ga0207693_10002100 3300025915 Bacteria 17387
168 Ga0207693_10007135 3300025915 Bacteria 9218
169 Ga0207660_10086086 3300025917 Bacteria 2320
170 Ga0207662_10008030 3300025918 Bacteria 5758
171 Ga0207662_10032360 3300025918 Bacteria 3044
172 Ga0207657_10037757 3300025919 Bacteria 4309
173 Ga0207657_10169496 3300025919 Bacteria 1770
174 Ga0207657_10271298 3300025919 Bacteria 1349
175 Ga0207652_10030119 3300025921 Bacteria 4542
176 Ga0207694_10064920 3300025924 Bacteria 2846
177 Ga0207694_10317040 3300025924 Bacteria 1286
178 Ga0207687_10015443 3300025927 Bacteria 5008
179 Ga0207687_10024623 3300025927 Bacteria 4023
180 Ga0207687_10068687 3300025927 Bacteria 2525
181 Ga0207687_10077583 3300025927 Bacteria 2389
182 Ga0207700_10036912 3300025928 Bacteria 3534
183 Ga0207700_10041369 3300025928 Bacteria 3371
184 Ga0207664_10000002 3300025929 Bacteria 657053
185 Ga0207664_10003961 3300025929 Bacteria 9968
186 Ga0207664_10014039 3300025929 Bacteria 5775
187 Ga0207664_10168631 3300025929 Bacteria 1872
188 Ga0207644_10001436 3300025931 Bacteria 15349
189 Ga0207690_10000065 3300025932 Bacteria 94536
190 Ga0207690_10006056 3300025932 Bacteria 7164
191 Ga0207690_10023030 3300025932 Bacteria 3883
192 Ga0207686_10015402 3300025934 Bacteria 4275
193 Ga0207709_10006172 3300025935 Bacteria 6749
194 Ga0207709_10118437 3300025935 Bacteria 1784
195 Ga0207709_10120355 3300025935 Bacteria 1771
196 Ga0207670_10103154 3300025936 Bacteria 2040
197 Ga0207665_10000467 3300025939 Bacteria 27660
198 Ga0207665_10002449 3300025939 Bacteria 12529
199 Ga0207691_10189698 3300025940 Bacteria 1793
200 Ga0207711_10000395 3300025941 Bacteria 46418
201 Ga0207711_10000967 3300025941 Bacteria 27498
202 Ga0207689_10003447 3300025942 Bacteria 14440
203 Ga0207689_10065156 3300025942 Bacteria 2997
204 Ga0207689_10082249 3300025942 Bacteria 2647
205 Ga0207679_10116457 3300025945 Bacteria 2119
206 Ga0207667_10046503 3300025949 Bacteria 4595
207 Ga0207667_10052382 3300025949 Bacteria 4298
208 Ga0207712_10005038 3300025961 Bacteria 8360
209 Ga0207712_10037930 3300025961 Bacteria 3292
210 Ga0207668_10127149 3300025972 Bacteria 1940
211 Ga0207668_10166232 3300025972 Bacteria 1725
212 Ga0207658_10002834 3300025986 Bacteria 12422
213 Ga0207658_10085348 3300025986 Bacteria 2432
214 Ga0207677_10018006 3300026023 Bacteria 4230
215 Ga0207703_10000094 3300026035 Bacteria 104297
216 Ga0207703_10000264 3300026035 Bacteria 58616
217 Ga0207639_10053748 3300026041 Bacteria 3074
218 Ga0207639_10157600 3300026041 Bacteria 1909
219 Ga0207678_10261818 3300026067 Bacteria 1482
220 Ga0207708_10000046 3300026075 Bacteria 116515
221 Ga0207708_10027529 3300026075 Bacteria 4304
222 Ga0207702_10014132 3300026078 Bacteria 6630
223 Ga0207702_10032629 3300026078 Bacteria 4345
224 Ga0207702_10096079 3300026078 Bacteria 2605
225 Ga0207641_10000562 3300026088 Bacteria 41565
226 Ga0207641_10003346 3300026088 Bacteria 14253
227 Ga0207641_10024371 3300026088 Bacteria 4987
228 Ga0207641_10116438 3300026088 Bacteria 2378
229 Ga0207648_10020505 3300026089 Bacteria 5951
230 Ga0207674_10023402 3300026116 Bacteria 6618
231 Ga0207675_100010593 3300026118 Bacteria 8636
232 Ga0207675_100256268 3300026118 Bacteria 1695
233 Ga0207683_10003326 3300026121 Bacteria 14009
234 Ga0207683_10255656 3300026121 Bacteria 1599
235 Ga0207698_10024682 3300026142 Bacteria 4224
236 Ga0268266_10010107 3300028379 Bacteria 8273
237 Ga0268266_10016725 3300028379 Bacteria 6271
238 Ga0268266_10035341 3300028379 Bacteria 4251
239 Ga0268266_10101574 3300028379 Bacteria 2536
240 Ga0268266_10112095 3300028379 Bacteria 2418
241 Ga0268266_10187609 3300028379 Bacteria 1886
242 Ga0268266_10345617 3300028379 Bacteria 1397
243 Ga0268265_10038419 3300028380 Bacteria 3522
244 Ga0268264_10000257 3300028381 Bacteria 96251
245 Ga0268264_10003187 3300028381 Bacteria 14212
246 Ga0307511_10022840 3300030521 Bacteria 5848
247 Ga0316180_1041813 3300030736 Bacteria 1580
248 Ga0307513_10013296 3300031456 Bacteria 10107
249 Ga0307509_10026874 3300031507 Bacteria 6411
250 Ga0307509_10050338 3300031507 Bacteria 4461
251 Ga0316579_10001073 3300031691 Bacteria 9668
252 Ga0316579_10006195 3300031691 Bacteria 4867
253 Ga0316576_10022525 3300031727 Bacteria 4376
254 Ga0316576_10036229 3300031727 Bacteria 3526
255 Ga0316576_10053157 3300031727 Bacteria 2951
256 Ga0316576_10081277 3300031727 Bacteria 2404
257 Ga0316578_10026645 3300031728 Bacteria 3262
258 Ga0316578_10042850 3300031728 Bacteria 2626
259 Ga0307409_100394359 3300031995 Bacteria 1320
260 Ga0307415_100024379 3300032126 Bacteria 3776
261 Ga0316585_10005101 3300032137 Bacteria 3694
262 Ga0316580_10010547 3300032139 Bacteria 2795
263 Ga0307507_10000113 3300033179 Bacteria 133812
264 Ga0373929_0011094 3300035085 Bacteria 1693
265 Ga0373940_0024768 3300035088 Bacteria 1558
266 Ga0373939_0023207 3300035114 Bacteria 1717
267 Ga0316574_0076919 3300035398 Bacteria 2114
268 Ga0373931_0003248 3300035691 Bacteria 7265
269 Ga0372808_000099 3300036459 Bacteria 4349
270 Ga0316582_0031606 3300036647 Bacteria 3237
271 Ga0316582_0293105 3300036647 Bacteria 1117
272 Ga0316584_0063639 3300036712 Bacteria 2761
273 Ga0373925_0002789 3300037068 Bacteria 13799
274 Ga0373925_0145569 3300037068 Bacteria 1857
275 Ga0395900_0135773 3300037418 Bacteria 2520
276 Ga0395898_0275835 3300037466 Bacteria 1604
277 Ga0316581_0007610 3300037588 Bacteria 2915
278 Ga0436365_0414071 3300039437 Bacteria 3216
279 Ga0451797_1504186 3300041453 Bacteria 1113
280 Ga0451802_1703259 3300041460 Bacteria 1408
281 Ga0451853_3757730 3300041512 Bacteria 6863
282 Ga0451577_0341974 3300042876 Bacteria 1357
283 Ga0466969_0008445 3300044656 Bacteria 5464
284 Ga0466965_0121452 3300044683 Bacteria 1350
285 Ga0466966_0006392 3300044684 Bacteria 7792
286 Ga0466966_0012359 3300044684 Bacteria 5657
287 Ga0466966_0087660 3300044684 Bacteria 1934
288 Ga0466966_0281719 3300044684 Bacteria 1000
289 Ga0466961_0018149 3300044693 Bacteria 4525
290 Ga0466961_0028853 3300044693 Bacteria 3568
291 Ga0466961_0033302 3300044693 Bacteria 3312
292 Ga0466961_0054786 3300044693 Bacteria 2543
293 Ga0466961_0075845 3300044693 Bacteria 2131
294 Ga0466963_0002774 3300044694 Bacteria 9872
295 Ga0466963_0094390 3300044694 Bacteria 2040
296 Ga0466964_0053300 3300044706 Bacteria 1665
297 Ga0466971_0001405 3300044719 Bacteria 10116
298 Ga0466971_0009818 3300044719 Bacteria 4179
299 Ga0466971_0018780 3300044719 Bacteria 3065
300 Ga0466971_0063241 3300044719 Bacteria 1675
301 Ga0466970_0050697 3300044765 Bacteria 2214
302 Ga0466970_0070336 3300044765 Bacteria 1881
303 Ga0466957_0083747 3300044842 Bacteria 1990
304 Ga0466957_0129469 3300044842 Bacteria 1615
305 Ga0466960_0006063 3300044901 Bacteria 4832
306 Ga0466960_0013453 3300044901 Bacteria 3477
307 Ga0466959_0002255 3300045049 Bacteria 12286
308 Ga0466959_0020629 3300045049 Bacteria 4856
309 Ga0466959_0054433 3300045049 Bacteria 2923
310 Ga0466959_0162401 3300045049 Bacteria 1570
311 Ga0466958_0012043 3300045836 Bacteria 4888
312 Ga0466958_0013606 3300045836 Bacteria 4636
313 Ga0466958_0025781 3300045836 Bacteria 3469
314 Ga0466958_0068841 3300045836 Bacteria 2164
315 Ga0466958_0143499 3300045836 Bacteria 1504
316 Ga0466958_0145696 3300045836 Bacteria 1492
317 Ga0466958_0152176 3300045836 Bacteria 1459
318 Ga0466967_0002592 3300045976 Bacteria 11362
319 Ga0466967_0006323 3300045976 Bacteria 8363
320 Ga0466967_0017321 3300045976 Bacteria 5715
321 Ga0466967_0042666 3300045976 Bacteria 3921
322 Ga0466967_0145185 3300045976 Bacteria 2213
323 Ga0466967_0146178 3300045976 Bacteria 2205
324 Ga0495592_0126695 3300046454 Bacteria 1790
325 Ga0495651_0014196 3300046462 Bacteria 6156
326 Ga0495662_0073527 3300046476 Bacteria 1658
327 Ga0495664_0015224 3300046477 Bacteria 4370
328 Ga0495594_0002125 3300046499 Bacteria 10318
329 Ga0495652_0027338 3300046529 Bacteria 5026
330 Ga0495652_0160811 3300046529 Bacteria 1744
331 Ga0495665_0018528 3300046531 Bacteria 3740
332 Ga0495665_0020375 3300046531 Bacteria 3562
333 Ga0495640_0021235 3300046533 Bacteria 4768
334 Ga0495645_0127341 3300046543 Bacteria 1788
335 Ga0495645_0248414 3300046543 Bacteria 1183
336 Ga0495656_0145649 3300046615 Bacteria 1140
337 Ga0495635_0027273 3300046663 Bacteria 3973
338 Ga0495588_0062705 3300046674 Bacteria 1927
339 Ga0495599_0166061 3300046678 Bacteria 1363
340 Ga0495623_0006899 3300046679 Bacteria 7386
341 Ga0495646_0151876 3300046680 Bacteria 1287
342 Ga0495600_0024783 3300046809 Bacteria 3863
343 Ga0495581_0020290 3300047315 Bacteria 3858
344 Ga0495581_0095423 3300047315 Bacteria 1727
345 Ga0495674_0001809 3300047319 Bacteria 21070
346 Ga0495672_0048202 3300047320 Bacteria 2528
347 Ga0495675_0164531 3300047444 Bacteria 1365
348 Ga0495602_0066827 3300048088 Bacteria 3096
349 Ga0496100_0366178 3300048903 Bacteria 1092
350 Ga0496101_0112881 3300048904 Bacteria 2047
351 Ga0496102_0028239 3300048905 Bacteria 5010
352 Ga0496104_0000745 3300048907 Bacteria 27865
353 Ga0496105_0001842 3300048908 Bacteria 15200
354 Ga0496105_0016809 3300048908 Bacteria 5849
355 Ga0496105_0184945 3300048908 Bacteria 1705
356 Ga0496106_0016463 3300048909 Bacteria 5470
357 Ga0496107_0028579 3300048910 Bacteria 3963
358 Ga0496108_0011563 3300048911 Bacteria 7177
359 Ga0496108_0032843 3300048911 Bacteria 4310
360 Ga0496108_0160083 3300048911 Bacteria 1945
361 Ga0496109_0021867 3300048912 Bacteria 5662
362 Ga0496109_0029648 3300048912 Bacteria 4901
363 Ga0496110_0188457 3300048913 Bacteria 1873
364 Ga0496111_0163791 3300048914 Bacteria 1651
365 Ga0496111_0248109 3300048914 Bacteria 1321
366 Ga0496112_0000115 3300048915 Bacteria 49432
367 Ga0496112_0297024 3300048915 Bacteria 1561
368 Ga0496113_0013815 3300048916 Bacteria 5486
369 Ga0496113_0089431 3300048916 Bacteria 2370
370 Ga0496113_0220529 3300048916 Bacteria 1511
371 Ga0496114_0086463 3300048917 Bacteria 2657
372 Ga0496114_0304664 3300048917 Bacteria 1407
373 Ga0496115_0032381 3300048918 Bacteria 4124
374 Ga0496119_0000549 3300048922 Bacteria 51126
375 Ga0496120_0004382 3300048923 Bacteria 11881
376 Ga0496126_0000035 3300048929 Bacteria 361590
377 Ga0501032_0098116 3300049569 Bacteria 1942
378 Ga0501034_0033748 3300049571 Bacteria 5188
379 Ga0501034_0122311 3300049571 Bacteria 2589
380 Ga0501036_0002148 3300049572 Bacteria 15399
381 Ga0501036_0002746 3300049572 Bacteria 13913
382 Ga0501037_0007682 3300049573 Bacteria 7893
383 Ga0501037_0090921 3300049573 Bacteria 2207
384 Ga0501038_0035020 3300049574 Bacteria 4412
385 Ga0501038_0093802 3300049574 Bacteria 2510
386 Ga0501039_0001814 3300049575 Bacteria 15781
387 Ga0501039_0053836 3300049575 Bacteria 3115
388 Ga0501040_0061253 3300049576 Bacteria 2587
389 Ga0501040_0062059 3300049576 Bacteria 2571
390 Ga0501042_0049122 3300049578 Bacteria 3009
391 Ga0501043_0002254 3300049579 Bacteria 16404
392 Ga0501046_0063856 3300049580 Bacteria 2875
393 Ga0501047_0001099 3300049581 Bacteria 26908
394 Ga0501047_0061428 3300049581 Bacteria 3625
395 Ga0501048_0012395 3300049582 Bacteria 6342
396 Ga0501048_0057187 3300049582 Bacteria 2766
397 Ga0501068_0004875 3300049584 Bacteria 7306
398 Ga0501071_0056001 3300049587 Bacteria 2847
399 Ga0501071_0089816 3300049587 Bacteria 2255
400 Ga0501072_0001733 3300049588 Bacteria 16265
401 Ga0501074_0103279 3300049590 Bacteria 2040
402 Ga0501075_0060512 3300049591 Bacteria 2853
403 Ga0501075_0108114 3300049591 Bacteria 2114
404 Ga0501076_0047495 3300049592 Bacteria 3394
405 Ga0501077_0033585 3300049593 Bacteria 3266
406 Ga0501077_0034314 3300049593 Bacteria 3229
407 Ga0501081_0091046 3300049743 Bacteria 2145
408 Ga0501081_0220765 3300049743 Bacteria 1378
409 Ga0501035_0021109 3300049822 Bacteria 5988
410 Ga0501045_0024592 3300049824 Bacteria 4325
411 Ga0501045_0202932 3300049824 Bacteria 1477
412 Ga0501045_0358819 3300049824 Bacteria 1085
413 nmdc:mga03n38_89668_c1 3300050490 Bacteria 1461
414 nmdc:mga05p37_2502_c1 3300050507 Bacteria 21370
415 nmdc:mga05p37_6774_c1 3300050507 Bacteria 13505
416 nmdc:mga09592_2961_c1 3300050508 Bacteria 13762
417 nmdc:mga09592_890_c1 3300050508 Bacteria 23417
418 nmdc:mga06r32_12_c1 3300050510 Bacteria 111318
419 nmdc:mga08y16_199598_c1 3300050511 Bacteria 2073
420 Ga0495612_0020139 3300053078 Bacteria 2673
421 Ga0495619_0122646 3300053085 Bacteria 1782
422 Ga0500559_0002151 3300053136 Bacteria 10482
423 Ga0501082_0207835 3300060353 Bacteria 1703
424 Ga0466962_0000133 3300061719 Bacteria 30437
425 Ga0530510_0095418 3300061734 Bacteria 2172
426 2548698674 2547132424 Bacteria 8348532
427 2558909286 2558860112 Bacteria 9931328
428 2559426963 2558860280 Bacteria 11429938
429 2566997368 2565956761 Bacteria 6601618
430 2739203904 2738543005 Bacteria 5278128
431 2739238539 2738543011 Bacteria 5731169
432 2739366130 2738543034 Bacteria 6084756
433 2744954662 2744054611 Bacteria 5611514
434 2753039123 2751185725 Bacteria 5740550
435 2753327634 2751185792 Bacteria 5739090
436 2816426745 2816332119 Bacteria 8120218
437 2816511543 2816332139 Bacteria 9138787
438 2856748425 2856741275 Bacteria 8096094
439 2863068902 2863067949 Bacteria 8541735
440 2870783481 2870782633 Bacteria 9624083
441 2889302973 2889300758 Bacteria 5690814
442 2891399458 2891395885 Bacteria 9251614
443 2891560758 2891554331 Bacteria 8812224
444 2891564233 2891562705 Bacteria 8039471
445 2904538297 2904535858 Bacteria 6308016
446 2904767289 2904765812 Bacteria 5369154
447 2904775827 2904770941 Bacteria 5580202
448 2908812941 2908811453 Bacteria 5478616
449 2919424089 2919420072 Bacteria 5390363
450 2919436459 2919432681 Bacteria 5390474
451 2919719349 2919713450 Bacteria 7431245
452 2922557489 2922554459 Bacteria 6683962
453 2928145634 2928142448 Bacteria 5288925
454 2939746149 2939743619 Bacteria 5762299
455 2974318200 2974315732 Bacteria 4602776
456 2984526412 2984523437 Bacteria 4508481
457 3003005793 3002998708 Bacteria 11715108
458 8053946410 8053945823 Bacteria 8962862
459 8054475475 8054472261 Bacteria 7464355
460 8056215369 8056207758 Bacteria 8639239
461 Ga0265327_10002217
462 JGI24737J22298_10050123
463 JGI24735J21928_10007384
464 JGI24735J21928_10032429
465 JGI24745J21846_1001351
466 JGI25406J46586_10005170
467 Ga0055540_1000052
468 Ga0070670_100434066
469 Ga0068869_100017531
470 Ga0068869_100087056
471 Ga0070682_100230845
472 Ga0068868_100156744
473 Ga0068868_100309555
474 Ga0070660_100009360
475 Ga0070660_100043510
476 Ga0070689_100136404
477 Ga0070689_100219564
478 Ga0070687_100003775
479 Ga0070692_10079081
480 Ga0070668_100043811
481 Ga0070668_100267111
482 Ga0070671_100001748
483 Ga0070674_100113325
484 Ga0070673_100213194
485 Ga0070688_100040582
486 Ga0070659_100000118
487 Ga0070667_100007753
488 Ga0070667_100021634
489 Ga0070667_100269657
490 Ga0070714_100007102
491 Ga0070714_100034904
492 Ga0070714_100216703
493 Ga0070714_100262909
494 Ga0070713_100047311
495 Ga0070713_100184931
496 Ga0070710_10007632
497 Ga0070710_10081063
498 Ga0070711_100002351
499 Ga0070700_100000031
500 Ga0070700_100005474
501 Ga0070694_100019599
502 Ga0070663_100181417
503 Ga0070678_100030266
504 Ga0070678_100082677
505 Ga0070678_100459238
506 Ga0070662_100010287
507 Ga0070679_100006550
508 Ga0070684_100327574
509 Ga0068853_100232066
510 Ga0070672_100174693
511 Ga0070686_100010222
512 Ga0070695_100107622
513 Ga0070696_100129354
514 Ga0070665_100003039
515 Ga0070665_100011089
516 Ga0070665_100022561
517 Ga0068855_100014800
518 Ga0070664_100108679
519 Ga0070664_100126594
520 Ga0068857_100090200
521 Ga0068854_100019370
522 Ga0068856_100006403
523 Ga0068856_100009036
524 Ga0068856_100106497
525 Ga0068856_100156708
526 Ga0068852_100345320
527 Ga0068864_100071913
528 Ga0068866_10021408
529 Ga0068866_10106690
530 Ga0068851_10098218
531 Ga0068870_10063842
532 Ga0068863_100000580
533 Ga0068863_100109068
534 Ga0068858_100000328
535 Ga0068858_100020931
536 Ga0068860_100000345
537 Ga0068860_100042279
538 Ga0068860_100060595
539 Ga0081455_10000507
540 Ga0081455_10033981
541 Ga0081455_10040578
542 Ga0081538_10000095
543 Ga0081540_1000710
544 Ga0081540_1066502
545 Ga0081539_10000272
546 Ga0081539_10005560
547 Ga0081539_10020947
548 Ga0070717_10075662
549 Ga0070717_10350538
550 Ga0075363_100046156
551 Ga0070715_10005387
552 Ga0070716_100001095
553 Ga0070716_100005851
554 Ga0070712_100005917
555 Ga0097621_100019065
556 Ga0097621_100166517
557 Ga0068871_100105622
558 Ga0068871_100282500
559 Ga0075428_100002618
560 Ga0075428_100023167
561 Ga0075430_100000734
562 Ga0075431_100001048
563 Ga0075431_100002049
564 Ga0075429_100000366
565 Ga0075429_100026194
566 Ga0068865_100129155
567 Ga0075436_100112115
568 Ga0075435_100007664
569 Ga0105240_10053377
570 Ga0105240_10119840
571 Ga0105240_10481320
572 Ga0105240_10683817
573 Ga0105245_10043338
574 Ga0105245_10174023
575 Ga0114129_10003185
576 Ga0114129_10091315
577 Ga0105243_10000243
578 Ga0105241_10292680
579 Ga0105248_10000450
580 Ga0105248_10023561
581 Ga0105248_10031564
582 Ga0105248_10338197
583 Ga0105237_10048304
584 Ga0105237_10188298
585 Ga0105238_10032836
586 Ga0105249_10004171
587 Ga0105249_10075485
588 Ga0105239_10118719
589 Ga0105239_10169295
590 Ga0105246_10016685
591 Ga0157373_10132994
592 Ga0157370_10018215
593 Ga0157370_10064903
594 Ga0157369_10442983
595 Ga0157378_10254131
596 Ga0163162_10159020
597 Ga0157372_10000023
598 Ga0157372_10074981
599 Ga0157375_10498275
600 Ga0163163_10008174
601 Ga0163163_10079453
602 Ga0163163_10086125
603 Ga0157380_10186319
604 Ga0157377_10037100
605 Ga0157379_10000015
606 Ga0157379_10002387
607 Ga0163161_10005938
608 Ga0206353_11004473
609 Ga0224712_10009359
610 Ga0207692_10000457
611 Ga0207692_10003071
612 Ga0207642_10065658
613 Ga0207710_10067393
614 Ga0207688_10000271
615 Ga0207680_10120961
616 Ga0207680_10189588
617 Ga0207647_10046448
618 Ga0207647_10068168
619 Ga0207647_10098969
620 Ga0207685_10012715
621 Ga0207699_10088511
622 Ga0207645_10058998
623 Ga0207643_10013687
624 Ga0207707_10007451
625 Ga0207695_10044375
626 Ga0207671_10055038
627 Ga0207693_10002100
628 Ga0207693_10007135
629 Ga0207660_10086086
630 Ga0207662_10008030
631 Ga0207662_10032360
632 Ga0207657_10037757
633 Ga0207657_10169496
634 Ga0207657_10271298
635 Ga0207652_10030119
636 Ga0207694_10064920
637 Ga0207694_10317040
638 Ga0207687_10015443
639 Ga0207687_10024623
640 Ga0207687_10068687
641 Ga0207687_10077583
642 Ga0207700_10036912
643 Ga0207700_10041369
644 Ga0207664_10000002
645 Ga0207664_10003961
646 Ga0207664_10014039
647 Ga0207664_10168631
648 Ga0207644_10001436
649 Ga0207690_10000065
650 Ga0207690_10006056
651 Ga0207690_10023030
652 Ga0207686_10015402
653 Ga0207709_10006172
654 Ga0207709_10118437
655 Ga0207709_10120355
656 Ga0207670_10103154
657 Ga0207665_10000467
658 Ga0207665_10002449
659 Ga0207691_10189698
660 Ga0207711_10000395
661 Ga0207711_10000967
662 Ga0207689_10003447
663 Ga0207689_10065156
664 Ga0207689_10082249
665 Ga0207679_10116457
666 Ga0207667_10046503
667 Ga0207667_10052382
668 Ga0207712_10005038
669 Ga0207712_10037930
670 Ga0207668_10127149
671 Ga0207668_10166232
672 Ga0207658_10002834
673 Ga0207658_10085348
674 Ga0207677_10018006
675 Ga0207703_10000094
676 Ga0207703_10000264
677 Ga0207639_10053748
678 Ga0207639_10157600
679 Ga0207678_10261818
680 Ga0207708_10000046
681 Ga0207708_10027529
682 Ga0207702_10014132
683 Ga0207702_10032629
684 Ga0207702_10096079
685 Ga0207641_10000562
686 Ga0207641_10003346
687 Ga0207641_10024371
688 Ga0207641_10116438
689 Ga0207648_10020505
690 Ga0207674_10023402
691 Ga0207675_100010593
692 Ga0207675_100256268
693 Ga0207683_10003326
694 Ga0207683_10255656
695 Ga0207698_10024682
696 Ga0268266_10010107
697 Ga0268266_10016725
698 Ga0268266_10035341
699 Ga0268266_10101574
700 Ga0268266_10112095
701 Ga0268266_10187609
702 Ga0268266_10345617
703 Ga0268265_10038419
704 Ga0268264_10000257
705 Ga0268264_10003187
706 Ga0307511_10022840
707 Ga0316180_1041813
708 Ga0307513_10013296
709 Ga0307509_10026874
710 Ga0307509_10050338
711 Ga0316579_10001073
712 Ga0316579_10006195
713 Ga0316576_10022525
714 Ga0316576_10036229
715 Ga0316576_10053157
716 Ga0316576_10081277
717 Ga0316578_10026645
718 Ga0316578_10042850
719 Ga0307409_100394359
720 Ga0307415_100024379
721 Ga0316585_10005101
722 Ga0316580_10010547
723 Ga0307507_10000113
724 Ga0373929_0011094
725 Ga0373940_0024768
726 Ga0373939_0023207
727 Ga0316574_0076919
728 Ga0373931_0003248
729 Ga0372808_000099
730 Ga0316582_0031606
731 Ga0316582_0293105
732 Ga0316584_0063639
733 Ga0373925_0002789
734 Ga0373925_0145569
735 Ga0395900_0135773
736 Ga0395898_0275835
737 Ga0316581_0007610
738 Ga0436365_0414071
739 Ga0451797_1504186
740 Ga0451802_1703259
741 Ga0451853_3757730
742 Ga0451577_0341974
743 Ga0466969_0008445
744 Ga0466965_0121452
745 Ga0466966_0006392
746 Ga0466966_0012359
747 Ga0466966_0087660
748 Ga0466966_0281719
749 Ga0466961_0018149
750 Ga0466961_0028853
751 Ga0466961_0033302
752 Ga0466961_0054786
753 Ga0466961_0075845
754 Ga0466963_0002774
755 Ga0466963_0094390
756 Ga0466964_0053300
757 Ga0466971_0001405
758 Ga0466971_0009818
759 Ga0466971_0018780
760 Ga0466971_0063241
761 Ga0466970_0050697
762 Ga0466970_0070336
763 Ga0466957_0083747
764 Ga0466957_0129469
765 Ga0466960_0006063
766 Ga0466960_0013453
767 Ga0466959_0002255
768 Ga0466959_0020629
769 Ga0466959_0054433
770 Ga0466959_0162401
771 Ga0466958_0012043
772 Ga0466958_0013606
773 Ga0466958_0025781
774 Ga0466958_0068841
775 Ga0466958_0143499
776 Ga0466958_0145696
777 Ga0466958_0152176
778 Ga0466967_0002592
779 Ga0466967_0006323
780 Ga0466967_0017321
781 Ga0466967_0042666
782 Ga0466967_0145185
783 Ga0466967_0146178
784 Ga0495592_0126695
785 Ga0495651_0014196
786 Ga0495662_0073527
787 Ga0495664_0015224
788 Ga0495594_0002125
789 Ga0495652_0027338
790 Ga0495652_0160811
791 Ga0495665_0018528
792 Ga0495665_0020375
793 Ga0495640_0021235
794 Ga0495645_0127341
795 Ga0495645_0248414
796 Ga0495656_0145649
797 Ga0495635_0027273
798 Ga0495588_0062705
799 Ga0495599_0166061
800 Ga0495623_0006899
801 Ga0495646_0151876
802 Ga0495600_0024783
803 Ga0495581_0020290
804 Ga0495581_0095423
805 Ga0495674_0001809
806 Ga0495672_0048202
807 Ga0495675_0164531
808 Ga0495602_0066827
809 Ga0496100_0366178
810 Ga0496101_0112881
811 Ga0496102_0028239
812 Ga0496104_0000745
813 Ga0496105_0001842
814 Ga0496105_0016809
815 Ga0496105_0184945
816 Ga0496106_0016463
817 Ga0496107_0028579
818 Ga0496108_0011563
819 Ga0496108_0032843
820 Ga0496108_0160083
821 Ga0496109_0021867
822 Ga0496109_0029648
823 Ga0496110_0188457
824 Ga0496111_0163791
825 Ga0496111_0248109
826 Ga0496112_0000115
827 Ga0496112_0297024
828 Ga0496113_0013815
829 Ga0496113_0089431
830 Ga0496113_0220529
831 Ga0496114_0086463
832 Ga0496114_0304664
833 Ga0496115_0032381
834 Ga0496119_0000549
835 Ga0496120_0004382
836 Ga0496126_0000035
837 Ga0501032_0098116
838 Ga0501034_0033748
839 Ga0501034_0122311
840 Ga0501036_0002148
841 Ga0501036_0002746
842 Ga0501037_0007682
843 Ga0501037_0090921
844 Ga0501038_0035020
845 Ga0501038_0093802
846 Ga0501039_0001814
847 Ga0501039_0053836
848 Ga0501040_0061253
849 Ga0501040_0062059
850 Ga0501042_0049122
851 Ga0501043_0002254
852 Ga0501046_0063856
853 Ga0501047_0001099
854 Ga0501047_0061428
855 Ga0501048_0012395
856 Ga0501048_0057187
857 Ga0501068_0004875
858 Ga0501071_0056001
859 Ga0501071_0089816
860 Ga0501072_0001733
861 Ga0501074_0103279
862 Ga0501075_0060512
863 Ga0501075_0108114
864 Ga0501076_0047495
865 Ga0501077_0033585
866 Ga0501077_0034314
867 Ga0501081_0091046
868 Ga0501081_0220765
869 Ga0501035_0021109
870 Ga0501045_0024592
871 Ga0501045_0202932
872 Ga0501045_0358819
873 nmdc:mga03n38_89668_c1
874 nmdc:mga05p37_2502_c1
875 nmdc:mga05p37_6774_c1
876 nmdc:mga09592_2961_c1
877 nmdc:mga09592_890_c1
878 nmdc:mga06r32_12_c1
879 nmdc:mga08y16_199598_c1
880 Ga0495612_0020139
881 Ga0495619_0122646
882 Ga0500559_0002151
883 Ga0501082_0207835
884 Ga0466962_0000133
885 Ga0530510_0095418
886 2548698674
887 2558909286
888 2559426963
889 2566997368
890 2739203904
891 2739238539
892 2739366130
893 2744954662
894 2753039123
895 2753327634
896 2816426745
897 2816511543
898 2856748425
899 2863068902
900 2870783481
901 2889302973
902 2891399458
903 2891560758
904 2891564233
905 2904538297
906 2904767289
907 2904775827
908 2908812941
909 2919424089
910 2919436459
911 2919719349
912 2922557489
913 2928145634
914 2939746149
915 2974318200
916 2984526412
917 3003005793
918 8053946410
919 8054475475
920 8056215369

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03328

HpcH_HpaI

HpcH/HpaI aldolase/citrate lyase family

9

242

0.91

PF22484

DUF6986

Domain of unknown function (DUF6986)

18

315

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l9y-assembly1.cif.gz_B crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa 0.9771 5 251
4l9z-assembly1.cif.gz_A crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, oxalate, and coa 0.9633 6 303
3qll-assembly1.cif.gz_A crystal structure of ripc from yersinia pestis 0.9291 9 252
4l80-assembly1.cif.gz_E crystal structure of chloroflexus aurantiacus malyl-coa lyase in complex with magnesium, oxalate, and propionyl-coa 0.9273 5 306
6kkh-assembly1.cif.gz_A crystal structure of the oxalate bound malyl-coa lyase from roseiflexus castenholzii 0.9164 5 303
ID Description Score Start End Superfamily
4l9yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9771 5 251 3.20.20.60
af_P0A9I1_3_299_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9211 5 307 3.20.20.60
3qllC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9142 3 252 3.20.20.60
4l9yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9116 5 251 3.20.20.60
af_Q1JPT8_41_343_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9007 1 306 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A2P6FXQ0-F1-model_v4 CoA ester lyase 0.9996 22 238 GO:0000287
GO:0006107
GO:0016829
AF-A0A6B3I1H3-F1-model_v4 CoA ester lyase 0.999 18 98 GO:0000287
GO:0006107
GO:0016829
AF-D3D852-F1-model_v4 HpcH/HpaI aldolase 0.9934 5 142 GO:0000287
GO:0003824
GO:0006107
AF-A0A1Q7W2M1-F1-model_v4 CoA ester lyase 0.9877 1 246 GO:0000287
GO:0006107
GO:0016829
AF-A0A2P6FXQ0-F1-model_v4 CoA ester lyase 0.986 22 238 GO:0000287
GO:0006107
GO:0016829

Map