F448509

General Info

Members Datasets Scaffolds Average Seq Length
460 202 860 54

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100823114|Ga0068860_1008231141
Length 63
Sequence MFFALEDLRMKALMNRFVREESGQDLIEYGLLIGIITAAAITAIQAIGPKVGGYYSTLNSRLP

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
153 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
157 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
160 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
161 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
162 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.65
Metatranscriptomes 9.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 0.65
Rhizosphere 97.39
Stem 0
Stem Tuber 0
Unclassified 45.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100823114 3300005843 Bacteria 942
2 SwRhRL2b_contig_2647419 2162886007 Unclassified 1736
3 JGI24746J21847_1039451 3300001977 Unclassified 656
4 Ga0058859_11613651 3300004798 Unclassified 809
5 Ga0058859_11763726 3300004798 Unclassified 777
6 Ga0058859_11779674 3300004798 Unclassified 543
7 Ga0058859_11828318 3300004798 Unclassified 654
8 Ga0058863_11737588 3300004799 Unclassified 635
9 Ga0058863_11854033 3300004799 Bacteria 618
10 Ga0058861_11862060 3300004800 Bacteria 519
11 Ga0058860_12081722 3300004801 Unclassified 639
12 Ga0058860_12084719 3300004801 Bacteria 608
13 Ga0058860_12167350 3300004801 Unclassified 517
14 Ga0058862_12801170 3300004803 Unclassified 710
15 Ga0065714_10266894 3300005288 Bacteria 746
16 Ga0065704_10011437 3300005289 Bacteria 2163
17 Ga0065704_10030311 3300005289 Unclassified 995
18 Ga0065704_10362465 3300005289 Unclassified 795
19 Ga0065704_10597729 3300005289 Unclassified 609
20 Ga0065712_10279538 3300005290 Unclassified 875
21 Ga0065712_10594144 3300005290 Unclassified 594
22 Ga0065715_10115359 3300005293 Bacteria 2417
23 Ga0065715_10456662 3300005293 Bacteria 820
24 Ga0065715_10834446 3300005293 Unclassified 596
25 Ga0065715_10881824 3300005293 Unclassified 576
26 Ga0065715_11159585 3300005293 Unclassified 507
27 Ga0065707_10004883 3300005295 Bacteria 6941
28 Ga0065707_10095471 3300005295 Bacteria 3375
29 Ga0065707_10212686 3300005295 Unclassified 1258
30 Ga0070658_10074930 3300005327 Bacteria 2776
31 Ga0070676_10415935 3300005328 Unclassified 938
32 Ga0070676_10812310 3300005328 Unclassified 691
33 Ga0070690_100035956 3300005330 Bacteria 3111
34 Ga0070690_100042130 3300005330 Bacteria 2891
35 Ga0070670_100017641 3300005331 Bacteria 6125
36 Ga0070670_100977993 3300005331 Unclassified 769
37 Ga0070677_10759979 3300005333 Unclassified 550
38 Ga0068869_100785163 3300005334 Unclassified 817
39 Ga0068869_101792851 3300005334 Unclassified 549
40 Ga0070666_10694732 3300005335 Unclassified 746
41 Ga0070680_100716423 3300005336 Bacteria 861
42 Ga0070680_100735629 3300005336 Bacteria 849
43 Ga0068868_100484414 3300005338 Unclassified 1081
44 Ga0070689_100009074 3300005340 Bacteria 7039
45 Ga0070689_100021861 3300005340 Bacteria 4770
46 Ga0070687_100028729 3300005343 Unclassified 2700
47 Ga0070687_100074363 3300005343 Bacteria 1834
48 Ga0070692_10844517 3300005345 Unclassified 629
49 Ga0070668_100035975 3300005347 Bacteria 3778
50 Ga0070668_100394994 3300005347 Bacteria 1180
51 Ga0070669_100002373 3300005353 Bacteria 13619
52 Ga0070669_100703012 3300005353 Unclassified 854
53 Ga0070675_100000945 3300005354 Bacteria 20698
54 Ga0070675_100005076 3300005354 Bacteria 10047
55 Ga0070675_100356232 3300005354 Bacteria 1298
56 Ga0070675_100502484 3300005354 Unclassified 1093
57 Ga0070675_100624260 3300005354 Bacteria 978
58 Ga0070675_100627028 3300005354 Bacteria 976
59 Ga0070671_100194692 3300005355 Unclassified 1718
60 Ga0070671_100310767 3300005355 Bacteria 1342
61 Ga0070674_100955796 3300005356 Unclassified 749
62 Ga0070674_101133972 3300005356 Unclassified 692
63 Ga0070673_100227901 3300005364 Unclassified 1615
64 Ga0070673_100582595 3300005364 Bacteria 1019
65 Ga0070673_101278419 3300005364 Unclassified 689
66 Ga0070673_101392692 3300005364 Unclassified 660
67 Ga0070688_100862405 3300005365 Unclassified 712
68 Ga0070688_100928983 3300005365 Bacteria 688
69 Ga0070659_100970168 3300005366 Unclassified 745
70 Ga0070667_101711844 3300005367 Unclassified 591
71 Ga0070703_10090188 3300005406 Unclassified 1061
72 Ga0070703_10564937 3300005406 Bacteria 520
73 Ga0070701_10014334 3300005438 Bacteria 3631
74 Ga0070701_10224200 3300005438 Bacteria 1123
75 Ga0070705_100582048 3300005440 Unclassified 863
76 Ga0070700_100012555 3300005441 Bacteria 4732
77 Ga0070700_100113283 3300005441 Bacteria 1807
78 Ga0070700_100121609 3300005441 Unclassified 1750
79 Ga0070700_100220686 3300005441 Bacteria 1343
80 Ga0070700_100590628 3300005441 Unclassified 868
81 Ga0070700_100618076 3300005441 Unclassified 851
82 Ga0070700_101977895 3300005441 Unclassified 505
83 Ga0070694_100134342 3300005444 Unclassified 1791
84 Ga0070694_100399895 3300005444 Unclassified 1075
85 Ga0070694_101938281 3300005444 Unclassified 503
86 Ga0070662_100660094 3300005457 Unclassified 883
87 Ga0068867_100004438 3300005459 Bacteria 9868
88 Ga0068867_100233288 3300005459 Unclassified 1489
89 Ga0068867_100753445 3300005459 Unclassified 864
90 Ga0070685_10089191 3300005466 Bacteria 1864
91 Ga0070706_100844536 3300005467 Unclassified 847
92 Ga0070707_100189793 3300005468 Bacteria 2004
93 Ga0070707_100583334 3300005468 Bacteria 1080
94 Ga0070698_100032877 3300005471 Bacteria 5373
95 Ga0070698_100252745 3300005471 Bacteria 1695
96 Ga0070698_100423434 3300005471 Bacteria 1266
97 Ga0070698_100439951 3300005471 Unclassified 1239
98 Ga0070699_100052774 3300005518 Bacteria 3518
99 Ga0070699_100111947 3300005518 Bacteria 2397
100 Ga0070679_101000207 3300005530 Unclassified 780
101 Ga0070684_100242282 3300005535 Bacteria 1648
102 Ga0070697_100055819 3300005536 Bacteria 3212
103 Ga0070672_100019826 3300005543 Bacteria 4891
104 Ga0070672_100823157 3300005543 Unclassified 818
105 Ga0070672_100875037 3300005543 Unclassified 793
106 Ga0070672_101893954 3300005543 Bacteria 537
107 Ga0070686_100027943 3300005544 Bacteria 3417
108 Ga0070686_100519543 3300005544 Bacteria 927
109 Ga0070686_101440394 3300005544 Unclassified 579
110 Ga0070695_101282284 3300005545 Unclassified 605
111 Ga0070665_100496132 3300005548 Bacteria 1232
112 Ga0070704_100000510 3300005549 Bacteria 18516
113 Ga0070704_100021496 3300005549 Bacteria 4185
114 Ga0068855_100455716 3300005563 Bacteria 1395
115 Ga0070664_100002623 3300005564 Bacteria 14511
116 Ga0070664_100091985 3300005564 Bacteria 2626
117 Ga0070664_100925895 3300005564 Unclassified 818
118 Ga0070664_100986117 3300005564 Unclassified 792
119 Ga0068857_100040790 3300005577 Bacteria 4115
120 Ga0068857_100043038 3300005577 Bacteria 4006
121 Ga0068857_100184588 3300005577 Bacteria 1898
122 Ga0068854_100261413 3300005578 Bacteria 1386
123 Ga0068854_100617842 3300005578 Unclassified 927
124 Ga0068856_100839499 3300005614 Bacteria 938
125 Ga0070702_100834390 3300005615 Unclassified 716
126 Ga0068859_100001185 3300005617 Bacteria 26612
127 Ga0068859_100018320 3300005617 Bacteria 7039
128 Ga0068859_100954633 3300005617 Bacteria 940
129 Ga0068864_100055843 3300005618 Bacteria 3411
130 Ga0068864_100078019 3300005618 Unclassified 2898
131 Ga0068864_100112801 3300005618 Bacteria 2423
132 Ga0068861_100002970 3300005719 Bacteria 11186
133 Ga0068861_100005760 3300005719 Bacteria 8403
134 Ga0068861_100770759 3300005719 Unclassified 900
135 Ga0068861_101966140 3300005719 Unclassified 583
136 Ga0068861_102396702 3300005719 Unclassified 530
137 Ga0068870_10003848 3300005840 Bacteria 6395
138 Ga0068870_10066675 3300005840 Unclassified 1951
139 Ga0068870_10084673 3300005840 Bacteria 1760
140 Ga0068870_10329703 3300005840 Unclassified 973
141 Ga0068863_100242256 3300005841 Bacteria 1741
142 Ga0068863_100592329 3300005841 Unclassified 1097
143 Ga0068860_100192450 3300005843 Bacteria 1974
144 Ga0068860_100663014 3300005843 Unclassified 1051
145 Ga0068862_100000726 3300005844 Bacteria 33424
146 Ga0068862_100068256 3300005844 Bacteria 3067
147 Ga0081455_10774887 3300005937 Unclassified 604
148 Ga0070717_10572950 3300006028 Bacteria 1023
149 Ga0070717_11778342 3300006028 Unclassified 557
150 Ga0075432_10530246 3300006058 Unclassified 529
151 Ga0075366_10462238 3300006195 Unclassified 783
152 Ga0097621_100070677 3300006237 Bacteria 2883
153 Ga0097621_100184757 3300006237 Unclassified 1803
154 Ga0068871_100049653 3300006358 Bacteria 3392
155 Ga0068871_100724223 3300006358 Unclassified 913
156 Ga0068871_102142769 3300006358 Unclassified 533
157 Ga0075428_100043208 3300006844 Unclassified 4954
158 Ga0075428_100133020 3300006844 Bacteria 2705
159 Ga0075428_100209292 3300006844 Bacteria 2108
160 Ga0075428_100582950 3300006844 Unclassified 1195
161 Ga0075428_101583557 3300006844 Bacteria 685
162 Ga0075431_102117295 3300006847 Unclassified 517
163 Ga0075433_10163949 3300006852 Unclassified 1978
164 Ga0075433_10167203 3300006852 Unclassified 1957
165 Ga0075433_10349085 3300006852 Unclassified 1307
166 Ga0075433_10646438 3300006852 Bacteria 927
167 Ga0075433_11658458 3300006852 Unclassified 551
168 Ga0075433_11840294 3300006852 Unclassified 520
169 Ga0075434_100000142 3300006871 Bacteria 43872
170 Ga0075434_100061283 3300006871 Bacteria 3743
171 Ga0075434_100071618 3300006871 Bacteria 3457
172 Ga0075434_100085004 3300006871 Bacteria 3163
173 Ga0075434_100151218 3300006871 Bacteria 2342
174 Ga0075429_100076184 3300006880 Bacteria 2922
175 Ga0075429_100080209 3300006880 Bacteria 2845
176 Ga0075429_100540995 3300006880 Bacteria 1021
177 Ga0068865_100278816 3300006881 Bacteria 1330
178 Ga0068865_100649796 3300006881 Unclassified 896
179 Ga0068865_101135906 3300006881 Unclassified 689
180 Ga0075436_100187428 3300006914 Unclassified 1463
181 Ga0075436_100965051 3300006914 Unclassified 639
182 Ga0097620_100001185 3300006931 Bacteria 26612
183 Ga0097620_100018319 3300006931 Bacteria 7039
184 Ga0097620_100954639 3300006931 Bacteria 940
185 Ga0075435_100007899 3300007076 Bacteria 7613
186 Ga0075435_100274723 3300007076 Unclassified 1438
187 Ga0075435_100320070 3300007076 Bacteria 1328
188 Ga0075435_100635033 3300007076 Unclassified 927
189 Ga0111539_10003390 3300009094 Bacteria 20996
190 Ga0111539_10044805 3300009094 Bacteria 5297
191 Ga0111539_10063049 3300009094 Unclassified 4386
192 Ga0111539_10312168 3300009094 Bacteria 1830
193 Ga0111539_11526581 3300009094 Bacteria 775
194 Ga0111539_11740384 3300009094 Unclassified 723
195 Ga0105245_10900133 3300009098 Bacteria 926
196 Ga0105245_12133688 3300009098 Unclassified 614
197 Ga0105245_12351064 3300009098 Unclassified 586
198 Ga0114129_10001006 3300009147 Bacteria 36715
199 Ga0114129_10034240 3300009147 Bacteria 7173
200 Ga0114129_10072709 3300009147 Bacteria 4793
201 Ga0114129_10248642 3300009147 Bacteria 2388
202 Ga0114129_10959189 3300009147 Bacteria 1080
203 Ga0105243_10009980 3300009148 Bacteria 7217
204 Ga0105243_10209616 3300009148 Bacteria 1715
205 Ga0105242_10937044 3300009176 Unclassified 869
206 Ga0105248_10610908 3300009177 Unclassified 1230
207 Ga0105248_11358733 3300009177 Unclassified 804
208 Ga0105248_12110626 3300009177 Unclassified 641
209 Ga0105249_10006443 3300009553 Bacteria 10207
210 Ga0105249_10154305 3300009553 Unclassified 2213
211 Ga0105246_10487974 3300011119 Unclassified 1044
212 Ga0157374_11734601 3300013296 Unclassified 649
213 Ga0157378_10052378 3300013297 Bacteria 3632
214 Ga0157378_12462448 3300013297 Unclassified 572
215 Ga0163162_10043259 3300013306 Bacteria 4510
216 Ga0163162_10111448 3300013306 Bacteria 2834
217 Ga0157375_10002375 3300013308 Bacteria 16292
218 Ga0157375_10061569 3300013308 Bacteria 3727
219 Ga0157375_10409222 3300013308 Unclassified 1523
220 Ga0157375_11428911 3300013308 Unclassified 815
221 Ga0157375_11717338 3300013308 Unclassified 743
222 Ga0157375_11980016 3300013308 Unclassified 692
223 Ga0163163_10045674 3300014325 Bacteria 4300
224 Ga0163163_11434072 3300014325 Bacteria 752
225 Ga0157380_10049631 3300014326 Bacteria 3311
226 Ga0157380_10953377 3300014326 Unclassified 888
227 Ga0157380_12762734 3300014326 Bacteria 557
228 Ga0157377_10020272 3300014745 Bacteria 3481
229 Ga0157377_10094468 3300014745 Bacteria 1771
230 Ga0157377_10548424 3300014745 Unclassified 816
231 Ga0157377_10558776 3300014745 Bacteria 810
232 Ga0157379_11431482 3300014968 Unclassified 671
233 Ga0157376_10043455 3300014969 Unclassified 3688
234 Ga0157376_10883834 3300014969 Unclassified 911
235 Ga0157376_11393806 3300014969 Unclassified 732
236 Ga0207697_10049260 3300025315 Unclassified 1739
237 Ga0207653_10080638 3300025885 Unclassified 1126
238 Ga0207688_10031274 3300025901 Bacteria 2938
239 Ga0207647_10041181 3300025904 Bacteria 2906
240 Ga0207647_10362643 3300025904 Unclassified 820
241 Ga0207645_10135329 3300025907 Bacteria 1605
242 Ga0207645_10722207 3300025907 Unclassified 677
243 Ga0207643_10001437 3300025908 Bacteria 13671
244 Ga0207643_10010806 3300025908 Bacteria 4924
245 Ga0207643_10534139 3300025908 Unclassified 752
246 Ga0207705_10140669 3300025909 Unclassified 1802
247 Ga0207684_10533582 3300025910 Bacteria 1005
248 Ga0207660_11636982 3300025917 Unclassified 518
249 Ga0207662_10034611 3300025918 Bacteria 2948
250 Ga0207662_10071893 3300025918 Bacteria 2095
251 Ga0207662_10101278 3300025918 Bacteria 1785
252 Ga0207662_11018278 3300025918 Unclassified 588
253 Ga0207646_10412360 3300025922 Bacteria 1220
254 Ga0207646_10559455 3300025922 Bacteria 1028
255 Ga0207681_10014046 3300025923 Bacteria 4964
256 Ga0207681_10016666 3300025923 Bacteria 4601
257 Ga0207650_10008819 3300025925 Bacteria 6892
258 Ga0207650_10539123 3300025925 Unclassified 978
259 Ga0207659_10000556 3300025926 Bacteria 22376
260 Ga0207659_10003041 3300025926 Bacteria 10009
261 Ga0207659_10053926 3300025926 Bacteria 2869
262 Ga0207659_10346658 3300025926 Unclassified 1231
263 Ga0207659_11138895 3300025926 Unclassified 671
264 Ga0207659_11463195 3300025926 Bacteria 585
265 Ga0207687_10945235 3300025927 Bacteria 738
266 Ga0207700_11264216 3300025928 Unclassified 658
267 Ga0207644_10338759 3300025931 Unclassified 1219
268 Ga0207690_10706735 3300025932 Unclassified 829
269 Ga0207706_10090826 3300025933 Bacteria 2685
270 Ga0207706_10160980 3300025933 Unclassified 1973
271 Ga0207706_10237130 3300025933 Unclassified 1595
272 Ga0207706_10660321 3300025933 Unclassified 895
273 Ga0207686_10734409 3300025934 Unclassified 787
274 Ga0207709_10013170 3300025935 Bacteria 4561
275 Ga0207709_10428136 3300025935 Bacteria 1018
276 Ga0207670_10005403 3300025936 Bacteria 7010
277 Ga0207670_10008734 3300025936 Bacteria 5736
278 Ga0207669_10948110 3300025937 Unclassified 721
279 Ga0207669_11306296 3300025937 Unclassified 616
280 Ga0207669_11423514 3300025937 Unclassified 590
281 Ga0207704_11335670 3300025938 Unclassified 613
282 Ga0207691_10196702 3300025940 Bacteria 1756
283 Ga0207691_10427218 3300025940 Unclassified 1129
284 Ga0207691_10617882 3300025940 Unclassified 917
285 Ga0207711_11076029 3300025941 Unclassified 745
286 Ga0207711_11318136 3300025941 Unclassified 664
287 Ga0207689_10110732 3300025942 Bacteria 2256
288 Ga0207679_10027476 3300025945 Unclassified 3935
289 Ga0207679_10349286 3300025945 Bacteria 1289
290 Ga0207679_11344641 3300025945 Unclassified 655
291 Ga0207679_11752490 3300025945 Unclassified 568
292 Ga0207651_10033645 3300025960 Bacteria 3309
293 Ga0207651_10194583 3300025960 Bacteria 1620
294 Ga0207651_10356787 3300025960 Unclassified 1233
295 Ga0207651_10457220 3300025960 Bacteria 1096
296 Ga0207651_11357611 3300025960 Unclassified 639
297 Ga0207712_10005268 3300025961 Bacteria 8176
298 Ga0207712_11325045 3300025961 Unclassified 644
299 Ga0207668_10071257 3300025972 Unclassified 2482
300 Ga0207668_10515882 3300025972 Bacteria 1030
301 Ga0207640_10630005 3300025981 Bacteria 911
302 Ga0207703_10021579 3300026035 Bacteria 5043
303 Ga0207708_10018342 3300026075 Bacteria 5271
304 Ga0207708_10044304 3300026075 Unclassified 3390
305 Ga0207708_10289139 3300026075 Unclassified 1330
306 Ga0207708_10736373 3300026075 Unclassified 845
307 Ga0207708_10826371 3300026075 Unclassified 799
308 Ga0207708_11845890 3300026075 Unclassified 530
309 Ga0207708_11919644 3300026075 Unclassified 519
310 Ga0207702_10965802 3300026078 Bacteria 845
311 Ga0207702_11939001 3300026078 Unclassified 580
312 Ga0207641_10048256 3300026088 Bacteria 3594
313 Ga0207641_10058012 3300026088 Unclassified 3294
314 Ga0207641_10199115 3300026088 Bacteria 1846
315 Ga0207641_10431322 3300026088 Bacteria 1271
316 Ga0207648_10001387 3300026089 Bacteria 26689
317 Ga0207648_10002512 3300026089 Bacteria 19691
318 Ga0207676_10018525 3300026095 Bacteria 5062
319 Ga0207676_10059074 3300026095 Bacteria 3027
320 Ga0207676_10063363 3300026095 Bacteria 2936
321 Ga0207676_11271996 3300026095 Unclassified 730
322 Ga0207674_10020445 3300026116 Bacteria 7153
323 Ga0207674_10856727 3300026116 Unclassified 876
324 Ga0207675_100000211 3300026118 Bacteria 54453
325 Ga0207675_100013171 3300026118 Bacteria 7719
326 Ga0207675_100260187 3300026118 Bacteria 1681
327 Ga0207675_101885890 3300026118 Unclassified 616
328 Ga0209998_10090362 3300027717 Unclassified 750
329 Ga0207428_10000257 3300027907 Bacteria 72841
330 Ga0207428_10038855 3300027907 Unclassified 3866
331 Ga0207428_10068440 3300027907 Bacteria 2793
332 Ga0207428_10632074 3300027907 Bacteria 769
333 Ga0268265_10000425 3300028380 Bacteria 45228
334 Ga0268265_10002327 3300028380 Bacteria 14428
335 Ga0268264_10089406 3300028381 Bacteria 2652
336 Ga0268264_11165209 3300028381 Unclassified 780
337 Ga0268264_11518628 3300028381 Bacteria 680
338 Ga0307408_100425562 3300031548 Bacteria 1146
339 Ga0307405_10234738 3300031731 Unclassified 1354
340 Ga0307413_10419144 3300031824 Bacteria 1054
341 Ga0307410_10325868 3300031852 Unclassified 1220
342 Ga0307414_11956413 3300032004 Bacteria 547
343 Ga0307411_10029402 3300032005 Bacteria 3354
344 Ga0373949_0114583 3300035090 Unclassified 751
345 Ga0451577_0694813 3300042876 Bacteria 922
346 Ga0451576_0106951 3300045051 Unclassified 2910
347 Ga0451576_0107246 3300045051 Unclassified 2906
348 Ga0451576_0824651 3300045051 Bacteria 974
349 Ga0495584_0243747 3300046491 Unclassified 914
350 Ga0495584_0522333 3300046491 Unclassified 605
351 Ga0495585_0578821 3300046492 Unclassified 529
352 Ga0495621_0005804 3300046539 Bacteria 3568
353 Ga0495621_0051237 3300046539 Bacteria 1477
354 Ga0495633_0172326 3300046558 Unclassified 997
355 Ga0495656_0370366 3300046615 Bacteria 745
356 Ga0495659_0002769 3300046664 Bacteria 5642
357 Ga0495659_0014244 3300046664 Unclassified 2602
358 Ga0495659_0082076 3300046664 Bacteria 1225
359 Ga0495659_0114681 3300046664 Bacteria 1055
360 Ga0495659_0402567 3300046664 Unclassified 591
361 Ga0495661_0352752 3300046665 Unclassified 724
362 Ga0495669_0028735 3300046684 Bacteria 2436
363 Ga0495669_0564421 3300046684 Unclassified 554
364 Ga0495669_0645389 3300046684 Unclassified 515
365 Ga0495670_0068792 3300046691 Bacteria 1790
366 Ga0495670_0500779 3300046691 Unclassified 660
367 Ga0495636_0023378 3300047318 Bacteria 2502
368 Ga0495677_0139874 3300047445 Bacteria 929
369 Ga0496104_0258367 3300048907 Bacteria 1655
370 Ga0496112_0001230 3300048915 Bacteria 19312
371 Ga0496113_1506179 3300048916 Unclassified 519
372 Ga0501308_077407 3300049128 Unclassified 525
373 Ga0501309_039917 3300049129 Unclassified 715
374 Ga0501304_016507 3300049160 Unclassified 699
375 Ga0501304_042501 3300049160 Unclassified 511
376 Ga0501305_048323 3300049161 Unclassified 709
377 Ga0501305_057615 3300049161 Unclassified 663
378 Ga0501311_105925 3300049527 Unclassified 502
379 Ga0501312_099153 3300049528 Unclassified 545
380 Ga0501316_058722 3300049532 Unclassified 566
381 Ga0501038_0518677 3300049574 Bacteria 910
382 nmdc:mga05p37_1077_c1 3300050507 Bacteria 31291
383 nmdc:mga05p37_11522_c1 3300050507 Bacteria 10534
384 nmdc:mga05p37_17763_c2 3300050507 Bacteria 6270
385 nmdc:mga05p37_712817_c1 3300050507 Unclassified 1112
386 nmdc:mga09592_133151_c1 3300050508 Bacteria 2140
387 nmdc:mga09592_135083_c1 3300050508 Unclassified 2124
388 nmdc:mga09592_393717_c1 3300050508 Unclassified 1198
389 nmdc:mga09592_50139_c1 3300050508 Bacteria 3521
390 nmdc:mga06r32_1987756_c1 3300050510 Unclassified 515
391 nmdc:mga08y16_1515_c1 3300050511 Bacteria 23370
392 nmdc:mga08y16_2700_c1 3300050511 Bacteria 18215
393 nmdc:mga08y16_382231_c1 3300050511 Bacteria 1443
394 nmdc:mga08y16_866261_c1 3300050511 Bacteria 892
395 nmdc:mga0n895_12439_c1 3300050512 Bacteria 7634
396 nmdc:mga0n895_1621970_c1 3300050512 Unclassified 611
397 nmdc:mga0n895_2145418_c1 3300050512 Unclassified 515
398 nmdc:mga0n895_3342_c1 3300050512 Bacteria 12897
399 nmdc:mga0n895_549840_c1 3300050512 Unclassified 1160
400 nmdc:mga0n895_57633_c1 3300050512 Bacteria 3829
401 nmdc:mga0n895_6977_c1 3300050512 Bacteria 9644
402 nmdc:mga0rr50_12401_c1 3300050513 Bacteria 5508
403 nmdc:mga0rr50_260151_c1 3300050513 Unclassified 1444
404 nmdc:mga0rr50_382250_c1 3300050513 Bacteria 1187
405 nmdc:mga08x19_766040_c1 3300050514 Unclassified 685
406 nmdc:mga0a205_111512_c1 3300050515 Bacteria 2634
407 nmdc:mga0a205_1354763_c1 3300050515 Unclassified 559
408 nmdc:mga0a205_147710_c1 3300050515 Unclassified 1963
409 nmdc:mga0a205_622111_c1 3300050515 Bacteria 932
410 Ga0587066_111869 3300059490 Bacteria 634
411 Ga0587070_086340 3300059491 Bacteria 698
412 Ga0587073_0196660 3300059492 Bacteria 602
413 Ga0587077_120539 3300059493 Bacteria 654
414 Ga0587082_121599 3300059504 Bacteria 590
415 Ga0587083_0258792 3300059505 Bacteria 521
416 Ga0587085_053477 3300059506 Bacteria 743
417 Ga0587089_099658 3300059509 Bacteria 526
418 Ga0587091_181323 3300059511 Bacteria 554
419 Ga0587092_077952 3300059512 Bacteria 650
420 Ga0587094_105129 3300059513 Bacteria 550
421 Ga0587125_043355 3300059607 Bacteria 615
422 Ga0587101_090164 3300059623 Bacteria 595
423 Ga0587109_182280 3300059624 Bacteria 537
424 Ga0587115_092578 3300059626 Bacteria 551
425 Ga0587062_110004 3300059639 Bacteria 546
426 Ga0587067_151643 3300059640 Bacteria 582
427 Ga0587075_094360 3300059644 Bacteria 589
428 Ga0587076_101630 3300059645 Bacteria 643
429 Ga0587079_160238 3300059647 Bacteria 588
430 Ga0587071_041340 3300060344 Bacteria 925
431 Ga0068860_100823114
432 SwRhRL2b_contig_2647419
433 JGI24746J21847_1039451
434 Ga0058859_11613651
435 Ga0058859_11763726
436 Ga0058859_11779674
437 Ga0058859_11828318
438 Ga0058863_11737588
439 Ga0058863_11854033
440 Ga0058861_11862060
441 Ga0058860_12081722
442 Ga0058860_12084719
443 Ga0058860_12167350
444 Ga0058862_12801170
445 Ga0065714_10266894
446 Ga0065704_10011437
447 Ga0065704_10030311
448 Ga0065704_10362465
449 Ga0065704_10597729
450 Ga0065712_10279538
451 Ga0065712_10594144
452 Ga0065715_10115359
453 Ga0065715_10456662
454 Ga0065715_10834446
455 Ga0065715_10881824
456 Ga0065715_11159585
457 Ga0065707_10004883
458 Ga0065707_10095471
459 Ga0065707_10212686
460 Ga0070658_10074930
461 Ga0070676_10415935
462 Ga0070676_10812310
463 Ga0070690_100035956
464 Ga0070690_100042130
465 Ga0070670_100017641
466 Ga0070670_100977993
467 Ga0070677_10759979
468 Ga0068869_100785163
469 Ga0068869_101792851
470 Ga0070666_10694732
471 Ga0070680_100716423
472 Ga0070680_100735629
473 Ga0068868_100484414
474 Ga0070689_100009074
475 Ga0070689_100021861
476 Ga0070687_100028729
477 Ga0070687_100074363
478 Ga0070692_10844517
479 Ga0070668_100035975
480 Ga0070668_100394994
481 Ga0070669_100002373
482 Ga0070669_100703012
483 Ga0070675_100000945
484 Ga0070675_100005076
485 Ga0070675_100356232
486 Ga0070675_100502484
487 Ga0070675_100624260
488 Ga0070675_100627028
489 Ga0070671_100194692
490 Ga0070671_100310767
491 Ga0070674_100955796
492 Ga0070674_101133972
493 Ga0070673_100227901
494 Ga0070673_100582595
495 Ga0070673_101278419
496 Ga0070673_101392692
497 Ga0070688_100862405
498 Ga0070688_100928983
499 Ga0070659_100970168
500 Ga0070667_101711844
501 Ga0070703_10090188
502 Ga0070703_10564937
503 Ga0070701_10014334
504 Ga0070701_10224200
505 Ga0070705_100582048
506 Ga0070700_100012555
507 Ga0070700_100113283
508 Ga0070700_100121609
509 Ga0070700_100220686
510 Ga0070700_100590628
511 Ga0070700_100618076
512 Ga0070700_101977895
513 Ga0070694_100134342
514 Ga0070694_100399895
515 Ga0070694_101938281
516 Ga0070662_100660094
517 Ga0068867_100004438
518 Ga0068867_100233288
519 Ga0068867_100753445
520 Ga0070685_10089191
521 Ga0070706_100844536
522 Ga0070707_100189793
523 Ga0070707_100583334
524 Ga0070698_100032877
525 Ga0070698_100252745
526 Ga0070698_100423434
527 Ga0070698_100439951
528 Ga0070699_100052774
529 Ga0070699_100111947
530 Ga0070679_101000207
531 Ga0070684_100242282
532 Ga0070697_100055819
533 Ga0070672_100019826
534 Ga0070672_100823157
535 Ga0070672_100875037
536 Ga0070672_101893954
537 Ga0070686_100027943
538 Ga0070686_100519543
539 Ga0070686_101440394
540 Ga0070695_101282284
541 Ga0070665_100496132
542 Ga0070704_100000510
543 Ga0070704_100021496
544 Ga0068855_100455716
545 Ga0070664_100002623
546 Ga0070664_100091985
547 Ga0070664_100925895
548 Ga0070664_100986117
549 Ga0068857_100040790
550 Ga0068857_100043038
551 Ga0068857_100184588
552 Ga0068854_100261413
553 Ga0068854_100617842
554 Ga0068856_100839499
555 Ga0070702_100834390
556 Ga0068859_100001185
557 Ga0068859_100018320
558 Ga0068859_100954633
559 Ga0068864_100055843
560 Ga0068864_100078019
561 Ga0068864_100112801
562 Ga0068861_100002970
563 Ga0068861_100005760
564 Ga0068861_100770759
565 Ga0068861_101966140
566 Ga0068861_102396702
567 Ga0068870_10003848
568 Ga0068870_10066675
569 Ga0068870_10084673
570 Ga0068870_10329703
571 Ga0068863_100242256
572 Ga0068863_100592329
573 Ga0068860_100192450
574 Ga0068860_100663014
575 Ga0068862_100000726
576 Ga0068862_100068256
577 Ga0081455_10774887
578 Ga0070717_10572950
579 Ga0070717_11778342
580 Ga0075432_10530246
581 Ga0075366_10462238
582 Ga0097621_100070677
583 Ga0097621_100184757
584 Ga0068871_100049653
585 Ga0068871_100724223
586 Ga0068871_102142769
587 Ga0075428_100043208
588 Ga0075428_100133020
589 Ga0075428_100209292
590 Ga0075428_100582950
591 Ga0075428_101583557
592 Ga0075431_102117295
593 Ga0075433_10163949
594 Ga0075433_10167203
595 Ga0075433_10349085
596 Ga0075433_10646438
597 Ga0075433_11658458
598 Ga0075433_11840294
599 Ga0075434_100000142
600 Ga0075434_100061283
601 Ga0075434_100071618
602 Ga0075434_100085004
603 Ga0075434_100151218
604 Ga0075429_100076184
605 Ga0075429_100080209
606 Ga0075429_100540995
607 Ga0068865_100278816
608 Ga0068865_100649796
609 Ga0068865_101135906
610 Ga0075436_100187428
611 Ga0075436_100965051
612 Ga0097620_100001185
613 Ga0097620_100018319
614 Ga0097620_100954639
615 Ga0075435_100007899
616 Ga0075435_100274723
617 Ga0075435_100320070
618 Ga0075435_100635033
619 Ga0111539_10003390
620 Ga0111539_10044805
621 Ga0111539_10063049
622 Ga0111539_10312168
623 Ga0111539_11526581
624 Ga0111539_11740384
625 Ga0105245_10900133
626 Ga0105245_12133688
627 Ga0105245_12351064
628 Ga0114129_10001006
629 Ga0114129_10034240
630 Ga0114129_10072709
631 Ga0114129_10248642
632 Ga0114129_10959189
633 Ga0105243_10009980
634 Ga0105243_10209616
635 Ga0105242_10937044
636 Ga0105248_10610908
637 Ga0105248_11358733
638 Ga0105248_12110626
639 Ga0105249_10006443
640 Ga0105249_10154305
641 Ga0105246_10487974
642 Ga0157374_11734601
643 Ga0157378_10052378
644 Ga0157378_12462448
645 Ga0163162_10043259
646 Ga0163162_10111448
647 Ga0157375_10002375
648 Ga0157375_10061569
649 Ga0157375_10409222
650 Ga0157375_11428911
651 Ga0157375_11717338
652 Ga0157375_11980016
653 Ga0163163_10045674
654 Ga0163163_11434072
655 Ga0157380_10049631
656 Ga0157380_10953377
657 Ga0157380_12762734
658 Ga0157377_10020272
659 Ga0157377_10094468
660 Ga0157377_10548424
661 Ga0157377_10558776
662 Ga0157379_11431482
663 Ga0157376_10043455
664 Ga0157376_10883834
665 Ga0157376_11393806
666 Ga0207697_10049260
667 Ga0207653_10080638
668 Ga0207688_10031274
669 Ga0207647_10041181
670 Ga0207647_10362643
671 Ga0207645_10135329
672 Ga0207645_10722207
673 Ga0207643_10001437
674 Ga0207643_10010806
675 Ga0207643_10534139
676 Ga0207705_10140669
677 Ga0207684_10533582
678 Ga0207660_11636982
679 Ga0207662_10034611
680 Ga0207662_10071893
681 Ga0207662_10101278
682 Ga0207662_11018278
683 Ga0207646_10412360
684 Ga0207646_10559455
685 Ga0207681_10014046
686 Ga0207681_10016666
687 Ga0207650_10008819
688 Ga0207650_10539123
689 Ga0207659_10000556
690 Ga0207659_10003041
691 Ga0207659_10053926
692 Ga0207659_10346658
693 Ga0207659_11138895
694 Ga0207659_11463195
695 Ga0207687_10945235
696 Ga0207700_11264216
697 Ga0207644_10338759
698 Ga0207690_10706735
699 Ga0207706_10090826
700 Ga0207706_10160980
701 Ga0207706_10237130
702 Ga0207706_10660321
703 Ga0207686_10734409
704 Ga0207709_10013170
705 Ga0207709_10428136
706 Ga0207670_10005403
707 Ga0207670_10008734
708 Ga0207669_10948110
709 Ga0207669_11306296
710 Ga0207669_11423514
711 Ga0207704_11335670
712 Ga0207691_10196702
713 Ga0207691_10427218
714 Ga0207691_10617882
715 Ga0207711_11076029
716 Ga0207711_11318136
717 Ga0207689_10110732
718 Ga0207679_10027476
719 Ga0207679_10349286
720 Ga0207679_11344641
721 Ga0207679_11752490
722 Ga0207651_10033645
723 Ga0207651_10194583
724 Ga0207651_10356787
725 Ga0207651_10457220
726 Ga0207651_11357611
727 Ga0207712_10005268
728 Ga0207712_11325045
729 Ga0207668_10071257
730 Ga0207668_10515882
731 Ga0207640_10630005
732 Ga0207703_10021579
733 Ga0207708_10018342
734 Ga0207708_10044304
735 Ga0207708_10289139
736 Ga0207708_10736373
737 Ga0207708_10826371
738 Ga0207708_11845890
739 Ga0207708_11919644
740 Ga0207702_10965802
741 Ga0207702_11939001
742 Ga0207641_10048256
743 Ga0207641_10058012
744 Ga0207641_10199115
745 Ga0207641_10431322
746 Ga0207648_10001387
747 Ga0207648_10002512
748 Ga0207676_10018525
749 Ga0207676_10059074
750 Ga0207676_10063363
751 Ga0207676_11271996
752 Ga0207674_10020445
753 Ga0207674_10856727
754 Ga0207675_100000211
755 Ga0207675_100013171
756 Ga0207675_100260187
757 Ga0207675_101885890
758 Ga0209998_10090362
759 Ga0207428_10000257
760 Ga0207428_10038855
761 Ga0207428_10068440
762 Ga0207428_10632074
763 Ga0268265_10000425
764 Ga0268265_10002327
765 Ga0268264_10089406
766 Ga0268264_11165209
767 Ga0268264_11518628
768 Ga0307408_100425562
769 Ga0307405_10234738
770 Ga0307413_10419144
771 Ga0307410_10325868
772 Ga0307414_11956413
773 Ga0307411_10029402
774 Ga0373949_0114583
775 Ga0451577_0694813
776 Ga0451576_0106951
777 Ga0451576_0107246
778 Ga0451576_0824651
779 Ga0495584_0243747
780 Ga0495584_0522333
781 Ga0495585_0578821
782 Ga0495621_0005804
783 Ga0495621_0051237
784 Ga0495633_0172326
785 Ga0495656_0370366
786 Ga0495659_0002769
787 Ga0495659_0014244
788 Ga0495659_0082076
789 Ga0495659_0114681
790 Ga0495659_0402567
791 Ga0495661_0352752
792 Ga0495669_0028735
793 Ga0495669_0564421
794 Ga0495669_0645389
795 Ga0495670_0068792
796 Ga0495670_0500779
797 Ga0495636_0023378
798 Ga0495677_0139874
799 Ga0496104_0258367
800 Ga0496112_0001230
801 Ga0496113_1506179
802 Ga0501308_077407
803 Ga0501309_039917
804 Ga0501304_016507
805 Ga0501304_042501
806 Ga0501305_048323
807 Ga0501305_057615
808 Ga0501311_105925
809 Ga0501312_099153
810 Ga0501316_058722
811 Ga0501038_0518677
812 nmdc:mga05p37_1077_c1
813 nmdc:mga05p37_11522_c1
814 nmdc:mga05p37_17763_c2
815 nmdc:mga05p37_712817_c1
816 nmdc:mga09592_133151_c1
817 nmdc:mga09592_135083_c1
818 nmdc:mga09592_393717_c1
819 nmdc:mga09592_50139_c1
820 nmdc:mga06r32_1987756_c1
821 nmdc:mga08y16_1515_c1
822 nmdc:mga08y16_2700_c1
823 nmdc:mga08y16_382231_c1
824 nmdc:mga08y16_866261_c1
825 nmdc:mga0n895_12439_c1
826 nmdc:mga0n895_1621970_c1
827 nmdc:mga0n895_2145418_c1
828 nmdc:mga0n895_3342_c1
829 nmdc:mga0n895_549840_c1
830 nmdc:mga0n895_57633_c1
831 nmdc:mga0n895_6977_c1
832 nmdc:mga0rr50_12401_c1
833 nmdc:mga0rr50_260151_c1
834 nmdc:mga0rr50_382250_c1
835 nmdc:mga08x19_766040_c1
836 nmdc:mga0a205_111512_c1
837 nmdc:mga0a205_1354763_c1
838 nmdc:mga0a205_147710_c1
839 nmdc:mga0a205_622111_c1
840 Ga0587066_111869
841 Ga0587070_086340
842 Ga0587073_0196660
843 Ga0587077_120539
844 Ga0587082_121599
845 Ga0587083_0258792
846 Ga0587085_053477
847 Ga0587089_099658
848 Ga0587091_181323
849 Ga0587092_077952
850 Ga0587094_105129
851 Ga0587125_043355
852 Ga0587101_090164
853 Ga0587109_182280
854 Ga0587115_092578
855 Ga0587062_110004
856 Ga0587067_151643
857 Ga0587075_094360
858 Ga0587076_101630
859 Ga0587079_160238
860 Ga0587071_041340

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map