F448482

General Info

Members Datasets Scaffolds Average Seq Length
460 236 443 100

Family's Representative Sequence

Representative Sequence 3300003574|Ga0007410J51695_1048772|Ga0007410J51695_10487728
Length 101
Sequence MAKKSMINRELKREKTVAKYAAKRAELKATIANGTASDEERMDAMLKLQALPRDASPVRQRNRCGLTGRPHGYFRKFGLSRNMLRLMVMQGDVPGVVKASW

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
3 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
4 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
5 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
6 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
7 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
8 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
9 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
10 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
11 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
12 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
13 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
14 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
15 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
16 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
17 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
20 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005473 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v2 (version 2) Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
138 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
139 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
144 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
145 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
146 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
147 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
150 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
151 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
152 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
159 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
169 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
170 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
171 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
172 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
173 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
174 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
175 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
176 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
177 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
178 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
179 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
180 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
181 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
236 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 76.74
Metatranscriptomes 19.57
Isolates 3.7

Biome Distribution

Category Percentage (%)
Aerial Root 0.22
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 3.26
Rhizosphere 89.13
Stem 0
Stem Tuber 0
Unclassified 7.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_863736 2162886007 Bacteria 7405
2 Ga0007410J51695_1048772 3300003574 Bacteria 4471
3 Ga0006562J51391_1016435 3300003578 Bacteria 4650
4 Ga0058692_1000048 3300003856 Bacteria 110906
5 Ga0065703_1000509 3300005272 Bacteria 21018
6 Ga0065704_10002381 3300005289 Bacteria 14980
7 Ga0070683_100024593 3300005329 Bacteria 5397
8 Ga0070690_100034350 3300005330 Bacteria 3177
9 Ga0070670_100077074 3300005331 Bacteria 2864
10 Ga0070670_100754804 3300005331 Bacteria 877
11 Ga0070670_101169775 3300005331 Bacteria 702
12 Ga0068869_100357932 3300005334 Bacteria 1191
13 Ga0068869_100382385 3300005334 Bacteria 1154
14 Ga0068869_100508100 3300005334 Bacteria 1007
15 Ga0070666_10011227 3300005335 Bacteria 5617
16 Ga0070666_10228578 3300005335 Bacteria 1313
17 Ga0070682_100013717 3300005337 Bacteria 4670
18 Ga0070682_100075384 3300005337 Bacteria 2169
19 Ga0068868_100005429 3300005338 Bacteria 8956
20 Ga0070689_100172900 3300005340 Bacteria 1751
21 Ga0070689_100506725 3300005340 Bacteria 1035
22 Ga0070687_100104816 3300005343 Bacteria 1590
23 Ga0070661_100107400 3300005344 Bacteria 2081
24 Ga0070669_100000505 3300005353 Bacteria 29404
25 Ga0070669_100221774 3300005353 Bacteria 1495
26 Ga0070675_101450546 3300005354 Bacteria 633
27 Ga0070671_100008454 3300005355 Bacteria 8250
28 Ga0070673_100110708 3300005364 Bacteria 2277
29 Ga0070688_100749872 3300005365 Bacteria 760
30 Ga0070688_101399877 3300005365 Bacteria 567
31 Ga0070667_100015540 3300005367 Bacteria 6292
32 Ga0070710_10642265 3300005437 Bacteria 743
33 Ga0070694_100307297 3300005444 Bacteria 1217
34 Ga0070663_100226524 3300005455 Bacteria 1470
35 Ga0070662_100040865 3300005457 Bacteria 3304
36 Ga0070662_100535211 3300005457 Bacteria 980
37 Ga0070685_10369562 3300005466 Bacteria 985
38 Ga0074250_11948 3300005473 Bacteria 687
39 Ga0070672_100185254 3300005543 Bacteria 1736
40 Ga0070672_100677770 3300005543 Bacteria 902
41 Ga0070686_100023394 3300005544 Bacteria 3692
42 Ga0070696_100925958 3300005546 Bacteria 724
43 Ga0070693_100111456 3300005547 Bacteria 1684
44 Ga0070665_100925997 3300005548 Bacteria 884
45 Ga0068855_100841361 3300005563 Bacteria 973
46 Ga0070664_100028738 3300005564 Bacteria 4629
47 Ga0068854_102164420 3300005578 Bacteria 514
48 Ga0068856_100283695 3300005614 Bacteria 1673
49 Ga0070702_100116593 3300005615 Bacteria 1665
50 Ga0068852_101991483 3300005616 Bacteria 603
51 Ga0068859_100012907 3300005617 Bacteria 8391
52 Ga0068859_100283041 3300005617 Bacteria 1751
53 Ga0068859_100313396 3300005617 Bacteria 1663
54 Ga0068864_100022600 3300005618 Bacteria 5274
55 Ga0068861_100251922 3300005719 Bacteria 1507
56 Ga0068851_10401988 3300005834 Bacteria 806
57 Ga0068863_100052636 3300005841 Bacteria 3858
58 Ga0068863_100452045 3300005841 Bacteria 1261
59 Ga0068858_100006142 3300005842 Bacteria 11717
60 Ga0068858_100419666 3300005842 Bacteria 1287
61 Ga0068860_100030150 3300005843 Bacteria 5216
62 Ga0068862_100198947 3300005844 Bacteria 1806
63 Ga0070712_101692520 3300006175 Bacteria 554
64 Ga0075362_10485788 3300006177 Bacteria 630
65 Ga0097621_100068852 3300006237 Bacteria 2920
66 Ga0097621_101118206 3300006237 Bacteria 740
67 Ga0068871_100053404 3300006358 Bacteria 3275
68 Ga0068871_100325772 3300006358 Bacteria 1354
69 Ga0075428_100010646 3300006844 Bacteria 10221
70 Ga0075431_100168513 3300006847 Bacteria 2251
71 Ga0075434_101400889 3300006871 Bacteria 709
72 Ga0097620_100012907 3300006931 Bacteria 8391
73 Ga0097620_100283069 3300006931 Bacteria 1751
74 Ga0097620_100313389 3300006931 Bacteria 1663
75 Ga0105244_10009211 3300009036 Bacteria 6094
76 Ga0105244_10012698 3300009036 Bacteria 4966
77 Ga0105250_10113330 3300009092 Bacteria 1111
78 Ga0105250_10396505 3300009092 Bacteria 611
79 Ga0105240_10026944 3300009093 Bacteria 7534
80 Ga0105240_10821636 3300009093 Bacteria 1005
81 Ga0111539_11159170 3300009094 Bacteria 898
82 Ga0105245_10002979 3300009098 Bacteria 15190
83 Ga0105247_10000594 3300009101 Bacteria 29366
84 Ga0105247_10341315 3300009101 Bacteria 1051
85 Ga0114129_10594386 3300009147 Bacteria 1435
86 Ga0105243_10000654 3300009148 Bacteria 34296
87 Ga0105243_10327902 3300009148 Bacteria 1397
88 Ga0105241_10774151 3300009174 Bacteria 882
89 Ga0105248_10011163 3300009177 Bacteria 9910
90 Ga0105238_10104652 3300009551 Bacteria 2811
91 Ga0105249_10008730 3300009553 Bacteria 8840
92 Ga0105249_10692088 3300009553 Bacteria 1079
93 Ga0105239_10018943 3300010375 Bacteria 7607
94 Ga0105246_10002426 3300011119 Bacteria 11243
95 Ga0105246_10819778 3300011119 Bacteria 827
96 Ga0157371_11194056 3300013102 Bacteria 586
97 Ga0157374_10039413 3300013296 Bacteria 4348
98 Ga0157378_10355544 3300013297 Bacteria 1432
99 Ga0163162_10013077 3300013306 Bacteria 8103
100 Ga0157375_10002567 3300013308 Bacteria 15778
101 Ga0157375_11027467 3300013308 Bacteria 963
102 Ga0163163_10007782 3300014325 Bacteria 9471
103 Ga0157377_10029824 3300014745 Bacteria 2950
104 Ga0157379_10011980 3300014968 Bacteria 7576
105 Ga0157379_10700405 3300014968 Bacteria 951
106 Ga0157376_10035934 3300014969 Bacteria 4010
107 Ga0157376_10749619 3300014969 Bacteria 985
108 Ga0157376_13126375 3300014969 Bacteria 501
109 Ga0163161_11055801 3300017792 Bacteria 696
110 Ga0207696_1001061 3300025711 Bacteria 16224
111 Ga0207655_1002637 3300025728 Bacteria 14194
112 Ga0207655_1011850 3300025728 Bacteria 5150
113 Ga0207713_1001071 3300025735 Bacteria 23607
114 Ga0207692_10532503 3300025898 Bacteria 749
115 Ga0207710_10000101 3300025900 Bacteria 110473
116 Ga0207710_10265326 3300025900 Bacteria 861
117 Ga0207680_10048843 3300025903 Bacteria 2515
118 Ga0207685_10058439 3300025905 Bacteria 1517
119 Ga0207695_10006585 3300025913 Bacteria 15020
120 Ga0207695_10741159 3300025913 Bacteria 863
121 Ga0207662_10039765 3300025918 Bacteria 2760
122 Ga0207649_10153392 3300025920 Bacteria 1589
123 Ga0207646_10745188 3300025922 Bacteria 874
124 Ga0207681_10016448 3300025923 Bacteria 4628
125 Ga0207681_10696892 3300025923 Bacteria 844
126 Ga0207694_10054062 3300025924 Bacteria 3115
127 Ga0207650_10056029 3300025925 Bacteria 2928
128 Ga0207650_10655884 3300025925 Bacteria 885
129 Ga0207659_10415776 3300025926 Bacteria 1127
130 Ga0207687_10024065 3300025927 Bacteria 4064
131 Ga0207644_10015463 3300025931 Bacteria 5122
132 Ga0207644_10957567 3300025931 Bacteria 718
133 Ga0207706_10088894 3300025933 Bacteria 2716
134 Ga0207706_10563810 3300025933 Bacteria 980
135 Ga0207709_10000016 3300025935 Bacteria 478406
136 Ga0207709_10294819 3300025935 Bacteria 1204
137 Ga0207670_10026879 3300025936 Bacteria 3632
138 Ga0207691_10551649 3300025940 Bacteria 977
139 Ga0207711_10039920 3300025941 Bacteria 3992
140 Ga0207689_10108021 3300025942 Bacteria 2287
141 Ga0207689_10288186 3300025942 Bacteria 1360
142 Ga0207689_10448929 3300025942 Bacteria 1078
143 Ga0207661_10006141 3300025944 Bacteria 8491
144 Ga0207679_10033457 3300025945 Bacteria 3617
145 Ga0207667_10703884 3300025949 Bacteria 1012
146 Ga0207712_10000551 3300025961 Bacteria 30254
147 Ga0207712_10574283 3300025961 Bacteria 972
148 Ga0207640_12038327 3300025981 Bacteria 520
149 Ga0207658_10040394 3300025986 Bacteria 3372
150 Ga0207677_10020657 3300026023 Bacteria 4003
151 Ga0207703_10034130 3300026035 Bacteria 4036
152 Ga0207678_10308701 3300026067 Bacteria 1360
153 Ga0207702_10107241 3300026078 Bacteria 2477
154 Ga0207641_10005619 3300026088 Bacteria 10682
155 Ga0207641_12169860 3300026088 Bacteria 556
156 Ga0207676_10003106 3300026095 Bacteria 11850
157 Ga0207675_100347254 3300026118 Bacteria 1453
158 Ga0207683_10083504 3300026121 Bacteria 2839
159 Ga0209371_1000024 3300027312 Bacteria 477286
160 Ga0207428_10702145 3300027907 Bacteria 723
161 Ga0268266_10003836 3300028379 Bacteria 14685
162 Ga0268266_10418626 3300028379 Bacteria 1269
163 Ga0268265_10179248 3300028380 Bacteria 1819
164 Ga0268265_11508802 3300028380 Bacteria 676
165 Ga0268264_10047743 3300028381 Bacteria 3560
166 Ga0265336_10070210 3300028666 Bacteria 1047
167 Ga0268256_1000026 3300030500 Bacteria 477260
168 Ga0265328_10092788 3300031239 Bacteria 1116
169 Ga0265331_10040404 3300031250 Bacteria 2269
170 Ga0265327_10001206 3300031251 Bacteria 34837
171 Ga0265327_10003993 3300031251 Bacteria 13449
172 Ga0265327_10005519 3300031251 Bacteria 10519
173 Ga0265327_10014149 3300031251 Bacteria 5238
174 Ga0265327_10136548 3300031251 Bacteria 1149
175 Ga0265327_10177474 3300031251 Bacteria 976
176 Ga0265327_10383183 3300031251 Bacteria 612
177 Ga0265327_10387481 3300031251 Bacteria 608
178 Ga0265316_10013473 3300031344 Bacteria 7260
179 Ga0265316_10187269 3300031344 Bacteria 1539
180 Ga0316575_10008308 3300031665 Bacteria 3777
181 Ga0316575_10104737 3300031665 Bacteria 1152
182 Ga0316575_10108836 3300031665 Bacteria 1130
183 Ga0316575_10122012 3300031665 Bacteria 1066
184 Ga0316575_10201595 3300031665 Bacteria 828
185 Ga0316575_10381376 3300031665 Bacteria 603
186 Ga0316579_10005295 3300031691 Bacteria 5195
187 Ga0316579_10009012 3300031691 Bacteria 4185
188 Ga0316579_10010128 3300031691 Bacteria 3978
189 Ga0316579_10285874 3300031691 Bacteria 797
190 Ga0316579_10539812 3300031691 Bacteria 564
191 Ga0316579_10609695 3300031691 Bacteria 528
192 Ga0316576_10046086 3300031727 Bacteria 3155
193 Ga0316576_10080384 3300031727 Bacteria 2417
194 Ga0316576_10138870 3300031727 Bacteria 1829
195 Ga0316576_10158986 3300031727 Bacteria 1704
196 Ga0316576_10351362 3300031727 Bacteria 1097
197 Ga0316576_11142556 3300031727 Bacteria 551
198 Ga0316578_10010128 3300031728 Bacteria 4880
199 Ga0316578_10039294 3300031728 Bacteria 2733
200 Ga0316578_10052415 3300031728 Bacteria 2390
201 Ga0316578_10083362 3300031728 Bacteria 1904
202 Ga0316578_10096296 3300031728 Bacteria 1771
203 Ga0316578_10281959 3300031728 Bacteria 995
204 Ga0316577_10043034 3300031733 Bacteria 2527
205 Ga0316577_10077469 3300031733 Bacteria 1857
206 Ga0316577_10098334 3300031733 Bacteria 1639
207 Ga0316577_10239931 3300031733 Bacteria 1025
208 Ga0316577_10527454 3300031733 Bacteria 671
209 Ga0307416_103444291 3300032002 Unclassified 529
210 Ga0316583_10013754 3300032133 Bacteria 2920
211 Ga0316583_10347540 3300032133 Bacteria 513
212 Ga0316585_10167951 3300032137 Bacteria 725
213 Ga0316585_10301369 3300032137 Bacteria 532
214 Ga0316580_10025904 3300032139 Bacteria 1813
215 Ga0316580_10150112 3300032139 Bacteria 715
216 Ga0316593_10000027 3300032168 Bacteria 15426
217 Ga0316593_10000032 3300032168 Bacteria 14610
218 Ga0316593_10000049 3300032168 Bacteria 13299
219 Ga0316593_10000058 3300032168 Bacteria 12691
220 Ga0316593_10000090 3300032168 Bacteria 11405
221 Ga0316593_10000167 3300032168 Bacteria 9674
222 Ga0316593_10000170 3300032168 Bacteria 9614
223 Ga0316593_10000325 3300032168 Bacteria 8199
224 Ga0316593_10000996 3300032168 Bacteria 5864
225 Ga0316593_10001237 3300032168 Bacteria 5509
226 Ga0316593_10001508 3300032168 Bacteria 5159
227 Ga0316593_10001816 3300032168 Bacteria 4873
228 Ga0316593_10002414 3300032168 Bacteria 4421
229 Ga0316593_10004460 3300032168 Bacteria 3596
230 Ga0316593_10004584 3300032168 Bacteria 3563
231 Ga0316593_10006375 3300032168 Bacteria 3178
232 Ga0316593_10010927 3300032168 Bacteria 2622
233 Ga0316593_10011448 3300032168 Bacteria 2577
234 Ga0316593_10023181 3300032168 Bacteria 1957
235 Ga0316593_10026699 3300032168 Bacteria 1848
236 Ga0316593_10032681 3300032168 Bacteria 1700
237 Ga0316593_10033248 3300032168 Bacteria 1688
238 Ga0316593_10054316 3300032168 Bacteria 1359
239 Ga0316593_10086301 3300032168 Bacteria 1101
240 Ga0316593_10124629 3300032168 Bacteria 927
241 Ga0316593_10146565 3300032168 Bacteria 857
242 Ga0316593_10148805 3300032168 Bacteria 851
243 Ga0316593_10158589 3300032168 Bacteria 825
244 Ga0316593_10171333 3300032168 Bacteria 796
245 Ga0316593_10281417 3300032168 Bacteria 627
246 Ga0316593_10435410 3300032168 Bacteria 510
247 Ga0316592_1000006 3300033524 Bacteria 14706
248 Ga0316592_1000008 3300033524 Bacteria 14268
249 Ga0316592_1000152 3300033524 Bacteria 7849
250 Ga0316592_1010944 3300033524 Bacteria 1836
251 Ga0316592_1017527 3300033524 Bacteria 1503
252 Ga0316592_1040428 3300033524 Bacteria 1031
253 Ga0316592_1153018 3300033524 Bacteria 545
254 Ga0316586_1000002 3300033527 Bacteria 13323
255 Ga0316586_1000040 3300033527 Bacteria 8841
256 Ga0316586_1010956 3300033527 Bacteria 1382
257 Ga0316586_1022231 3300033527 Bacteria 1053
258 Ga0316586_1101173 3300033527 Bacteria 551
259 Ga0316586_1112656 3300033527 Bacteria 526
260 Ga0316586_1118688 3300033527 Bacteria 515
261 Ga0316588_1000407 3300033528 Bacteria 5694
262 Ga0316588_1001039 3300033528 Bacteria 4362
263 Ga0316588_1001652 3300033528 Bacteria 3720
264 Ga0316588_1020382 3300033528 Bacteria 1501
265 Ga0316588_1030773 3300033528 Bacteria 1259
266 Ga0316588_1055630 3300033528 Bacteria 962
267 Ga0316587_1000021 3300033529 Bacteria 9386
268 Ga0316587_1000182 3300033529 Bacteria 5325
269 Ga0316587_1000541 3300033529 Bacteria 3919
270 Ga0316587_1001602 3300033529 Bacteria 2844
271 Ga0316587_1003531 3300033529 Bacteria 2201
272 Ga0316587_1012185 3300033529 Bacteria 1396
273 Ga0316587_1013463 3300033529 Bacteria 1340
274 Ga0316587_1019625 3300033529 Bacteria 1144
275 Ga0316587_1020450 3300033529 Bacteria 1123
276 Ga0316587_1026148 3300033529 Bacteria 1016
277 Ga0316596_1000013 3300033541 Bacteria 16477
278 Ga0316596_1000016 3300033541 Bacteria 15149
279 Ga0316596_1000064 3300033541 Bacteria 12159
280 Ga0316596_1000070 3300033541 Bacteria 11847
281 Ga0316596_1000296 3300033541 Bacteria 7867
282 Ga0316596_1000780 3300033541 Bacteria 5864
283 Ga0316596_1000880 3300033541 Bacteria 5653
284 Ga0316596_1002088 3300033541 Bacteria 4213
285 Ga0316596_1002127 3300033541 Bacteria 4184
286 Ga0316596_1002164 3300033541 Bacteria 4160
287 Ga0316596_1004415 3300033541 Bacteria 3154
288 Ga0316596_1005400 3300033541 Bacteria 2918
289 Ga0316596_1005567 3300033541 Bacteria 2883
290 Ga0316596_1007429 3300033541 Bacteria 2589
291 Ga0316596_1009072 3300033541 Bacteria 2384
292 Ga0316596_1010052 3300033541 Bacteria 2282
293 Ga0316596_1017275 3300033541 Bacteria 1813
294 Ga0316596_1021389 3300033541 Bacteria 1649
295 Ga0316596_1033398 3300033541 Bacteria 1340
296 Ga0316596_1036743 3300033541 Bacteria 1280
297 Ga0316596_1048472 3300033541 Bacteria 1122
298 Ga0316596_1062612 3300033541 Bacteria 993
299 Ga0316596_1068931 3300033541 Bacteria 947
300 Ga0316596_1076795 3300033541 Bacteria 896
301 Ga0316596_1111008 3300033541 Bacteria 744
302 Ga0316596_1234139 3300033541 Bacteria 516
303 Ga0373928_0108360 3300035084 Bacteria 732
304 Ga0373951_0102257 3300035091 Bacteria 763
305 Ga0373939_0125460 3300035114 Bacteria 910
306 Ga0373957_0382505 3300035120 Bacteria 604
307 Ga0373946_0063374 3300035171 Bacteria 1579
308 Ga0373955_0008911 3300035172 Bacteria 4679
309 Ga0316574_0000085 3300035398 Bacteria 26529
310 Ga0316574_0005225 3300035398 Bacteria 6904
311 Ga0316574_0009540 3300035398 Bacteria 5440
312 Ga0316574_0030582 3300035398 Bacteria 3262
313 Ga0316574_0038892 3300035398 Bacteria 2922
314 Ga0316574_0046395 3300035398 Bacteria 2694
315 Ga0316574_0046734 3300035398 Bacteria 2685
316 Ga0316574_0091649 3300035398 Bacteria 1938
317 Ga0316574_0107737 3300035398 Bacteria 1785
318 Ga0316574_0148638 3300035398 Bacteria 1510
319 Ga0316574_0234958 3300035398 Bacteria 1172
320 Ga0316574_0280949 3300035398 Bacteria 1060
321 Ga0316574_0381436 3300035398 Bacteria 889
322 Ga0316574_0803693 3300035398 Bacteria 572
323 Ga0316574_0915592 3300035398 Bacteria 530
324 Ga0373931_0157093 3300035691 Bacteria 1330
325 Ga0373933_0012546 3300035724 Bacteria 4683
326 Ga0373937_0003777 3300036401 Bacteria 12804
327 Ga0373937_0036176 3300036401 Bacteria 4498
328 Ga0316582_0002224 3300036647 Bacteria 9011
329 Ga0316582_0012337 3300036647 Bacteria 4764
330 Ga0316582_0015971 3300036647 Bacteria 4307
331 Ga0316582_0027328 3300036647 Bacteria 3445
332 Ga0316582_0043630 3300036647 Bacteria 2814
333 Ga0316582_0093922 3300036647 Bacteria 1978
334 Ga0316582_0328203 3300036647 Bacteria 1052
335 Ga0316582_0484157 3300036647 Bacteria 853
336 Ga0316582_0506024 3300036647 Bacteria 832
337 Ga0316582_0510128 3300036647 Bacteria 829
338 Ga0316582_0670180 3300036647 Bacteria 713
339 Ga0316582_0723242 3300036647 Bacteria 683
340 Ga0316582_1059501 3300036647 Bacteria 553
341 Ga0316582_1078174 3300036647 Bacteria 548
342 Ga0316584_0004999 3300036712 Bacteria 8833
343 Ga0316584_0022696 3300036712 Bacteria 4580
344 Ga0316584_0047543 3300036712 Bacteria 3205
345 Ga0316584_0086007 3300036712 Bacteria 2354
346 Ga0316584_0096606 3300036712 Bacteria 2212
347 Ga0316584_0112247 3300036712 Bacteria 2039
348 Ga0316584_0133058 3300036712 Bacteria 1857
349 Ga0316584_0227563 3300036712 Bacteria 1368
350 Ga0316584_0347997 3300036712 Bacteria 1065
351 Ga0316584_0600317 3300036712 Bacteria 763
352 Ga0316584_0849276 3300036712 Bacteria 617
353 Ga0316581_0003763 3300037588 Bacteria 3809
354 Ga0316581_0008237 3300037588 Bacteria 2829
355 Ga0316581_0025276 3300037588 Bacteria 1766
356 Ga0316581_0138989 3300037588 Bacteria 749
357 Ga0400484_10568 3300038725 Bacteria 4359
358 Ga0400484_27221 3300038725 Bacteria 11015
359 Ga0400484_30405 3300038725 Bacteria 18960
360 Ga0400490_10179 3300038726 Bacteria 1256
361 Ga0400490_19939 3300038726 Bacteria 2587
362 Ga0400491_28158 3300038727 Bacteria 6406
363 Ga0400485_14862 3300038735 Bacteria 1612
364 Ga0400488_21953 3300038741 Bacteria 1813
365 Ga0400488_44035 3300038741 Bacteria 1632
366 Ga0400488_59057 3300038741 Bacteria 3347
367 Ga0400486_28699 3300038742 Bacteria 1294
368 Ga0400483_039054 3300039062 Bacteria 8935
369 Ga0400483_126920 3300039062 Bacteria 1392
370 Ga0400483_140144 3300039062 Bacteria 16717
371 Ga0400483_211411 3300039062 Bacteria 9795
372 Ga0400489_28031 3300039093 Bacteria 1227
373 Ga0400487_00820 3300039110 Bacteria 3258
374 Ga0400487_33555 3300039110 Bacteria 69184
375 Ga0400487_52986 3300039110 Bacteria 2662
376 Ga0400487_54841 3300039110 Bacteria 3504
377 Ga0451792_02650 3300041445 Bacteria 621
378 Ga0451791_1202564 3300041451 Bacteria 523
379 Ga0451577_0000210 3300042876 Bacteria 122637
380 Ga0451577_0030002 3300042876 Bacteria 4913
381 Ga0451577_0687018 3300042876 Bacteria 927
382 Ga0453683_0303740 3300044673 Bacteria 1021
383 Ga0453684_0002807 3300044712 Bacteria 41156
384 Ga0453684_0243156 3300044712 Bacteria 2071
385 Ga0453684_0396694 3300044712 Bacteria 1546
386 Ga0453684_0430561 3300044712 Bacteria 1472
387 Ga0453684_0717014 3300044712 Bacteria 1085
388 Ga0451576_0000741 3300045051 Bacteria 65303
389 Ga0451576_0034235 3300045051 Bacteria 5396
390 Ga0495592_0606822 3300046454 Bacteria 667
391 Ga0495603_0070158 3300046455 Bacteria 2060
392 Ga0495639_0098111 3300046475 Bacteria 1381
393 Ga0495586_0335799 3300046535 Bacteria 867
394 Ga0495634_0144354 3300046642 Bacteria 1509
395 Ga0495647_0021612 3300046681 Bacteria 2318
396 Ga0495613_0975708 3300046689 Bacteria 545
397 Ga0496100_0354713 3300048903 Bacteria 1108
398 Ga0496102_0514626 3300048905 Bacteria 1119
399 Ga0496103_0782535 3300048906 Bacteria 602
400 Ga0496104_0007967 3300048907 Bacteria 9396
401 Ga0496105_0485056 3300048908 Bacteria 972
402 Ga0496106_0273703 3300048909 Bacteria 1352
403 Ga0496107_0360499 3300048910 Bacteria 1082
404 Ga0496108_0044062 3300048911 Bacteria 3726
405 Ga0496109_0017303 3300048912 Bacteria 6315
406 Ga0496110_0268143 3300048913 Bacteria 1554
407 Ga0496112_0024825 3300048915 Bacteria 5749
408 Ga0496113_0050042 3300048916 Bacteria 3114
409 Ga0496114_0011260 3300048917 Bacteria 7141
410 Ga0501033_0004532 3300049570 Bacteria 11123
411 Ga0501034_0010161 3300049571 Bacteria 9819
412 Ga0501034_0376669 3300049571 Bacteria 1345
413 Ga0501036_0160990 3300049572 Bacteria 1892
414 Ga0501036_1107948 3300049572 Bacteria 647
415 Ga0501037_0005647 3300049573 Bacteria 9114
416 Ga0501038_0005917 3300049574 Bacteria 11307
417 Ga0501039_0010315 3300049575 Bacteria 7126
418 Ga0501039_0280498 3300049575 Bacteria 1310
419 Ga0501040_1126193 3300049576 Bacteria 569
420 Ga0501042_0666563 3300049578 Bacteria 756
421 Ga0501043_0007921 3300049579 Bacteria 8396
422 Ga0501046_0251935 3300049580 Bacteria 1299
423 Ga0501047_0072714 3300049581 Bacteria 3309
424 Ga0501048_0077989 3300049582 Bacteria 2338
425 Ga0501068_0068874 3300049584 Bacteria 2157
426 Ga0501071_0241170 3300049587 Bacteria 1363
427 Ga0501072_0417940 3300049588 Bacteria 1063
428 Ga0501072_0729659 3300049588 Bacteria 778
429 Ga0501073_0008863 3300049589 Bacteria 7436
430 Ga0501074_0014241 3300049590 Bacteria 5783
431 Ga0501075_0959849 3300049591 Bacteria 650
432 Ga0501076_1573468 3300049592 Bacteria 539
433 Ga0501080_0011521 3300049742 Bacteria 8096
434 Ga0501083_0089232 3300049744 Bacteria 2037
435 Ga0501035_0093976 3300049822 Bacteria 2637
436 Ga0501044_0206310 3300049823 Bacteria 1921
437 nmdc:mga05p37_686811_c1 3300050507 Bacteria 1140
438 nmdc:mga08y16_943718_c1 3300050511 Bacteria 846
439 nmdc:mga0n895_781330_c1 3300050512 Bacteria 946
440 Ga0495601_0002921 3300053077 Bacteria 9729
441 Ga0495601_0125414 3300053077 Bacteria 1670
442 Ga0501084_0008596 3300054114 Bacteria 8442
443 Ga0501082_0157434 3300060353 Bacteria 1973

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2919506607 2919509837 82
2 3300013297 Ga0157378_10355544 Ga0157378_103555444 84
3 3300005473 Ga0074250_11948 Ga0074250_119481 85
4 3300032168 Ga0316593_10000167 Ga0316593_1000016713 85
5 3300035398 Ga0316574_0915592 Ga0316574_0915592_252_509 85
6 3300048906 Ga0496103_0782535 Ga0496103_0782535_325_582 85
7 3300033524 Ga0316592_1017527 Ga0316592_10175271 86
8 3300039062 Ga0400483_126920 Ga0400483_126920_754_1059 88
9 3300033541 Ga0316596_1005400 Ga0316596_10054002 89
10 3300032168 Ga0316593_10171333 Ga0316593_101713331 94
11 3300005340 Ga0070689_100506725 Ga0070689_1005067252 96
12 3300005617 Ga0068859_100283041 Ga0068859_1002830412 96
13 3300005841 Ga0068863_100452045 Ga0068863_1004520453 96
14 3300005842 Ga0068858_100419666 Ga0068858_1004196663 96
15 3300006237 Ga0097621_101118206 Ga0097621_1011182062 96
16 3300006358 Ga0068871_100325772 Ga0068871_1003257722 96
17 3300006931 Ga0097620_100283069 Ga0097620_1002830692 96
18 3300014969 Ga0157376_13126375 Ga0157376_131263752 96
19 3300026088 Ga0207641_12169860 Ga0207641_121698602 96
20 3300028666 Ga0265336_10070210 Ga0265336_100702103 96
21 3300031344 Ga0265316_10013473 Ga0265316_1001347316 96
22 3300032002 Ga0307416_103444291 Ga0307416_1034442911 96
23 3300032168 Ga0316593_10124629 Ga0316593_101246292 96
24 3300032168 Ga0316593_10148805 Ga0316593_101488052 96
25 3300035398 Ga0316574_0005225 Ga0316574_0005225_130_420 96
26 3300036647 Ga0316582_0670180 Ga0316582_0670180_409_699 96
27 3300036647 Ga0316582_1059501 Ga0316582_1059501_133_423 96
28 3300036712 Ga0316584_0849276 Ga0316584_0849276_229_519 96
29 iso_pu_bacteria 2551306352 2552747533 97
30 iso_pu_bacteria 2639762793 2640735797 97
31 iso_pu_bacteria 2643221665 2644361950 97
32 iso_pu_bacteria 2675903507 2678229060 97
33 iso_pu_bacteria 2744054655 2745159947 97
34 iso_pu_bacteria 2773857761 2774390396 97
35 iso_pu_bacteria 2773857770 2774437749 97
36 iso_pu_bacteria 2894510363 2894510840 97
37 iso_pu_bacteria 2916699645 2916700222 97
38 iso_pu_bacteria 2919182534 2919184750 97
39 iso_pu_bacteria 2928515477 2928517469 97
40 iso_pu_bacteria 2984568884 2984571905 97
41 iso_pu_bacteria 2989392574 2989393094 97
42 iso_pu_bacteria 3007252601 3007255618 97
43 iso_pu_bacteria 8001522603 8001524074 97
44 iso_pu_bacteria 8033232454 8033234121 97
45 2162886007 SwRhRL2b_contig_863736 SwRhRL2b_0206.00000640 101
46 3300003574 Ga0007410J51695_1048772 Ga0007410J51695_10487728 101
47 3300003578 Ga0006562J51391_1016435 Ga0006562J51391_10164358 101
48 3300003856 Ga0058692_1000048 Ga0058692_100004852 101
49 3300005272 Ga0065703_1000509 Ga0065703_100050923 101
50 3300005289 Ga0065704_10002381 Ga0065704_1000238116 101
51 3300005329 Ga0070683_100024593 Ga0070683_10002459311 101
52 3300005330 Ga0070690_100034350 Ga0070690_1000343504 101
53 3300005331 Ga0070670_100077074 Ga0070670_1000770743 101
54 3300005331 Ga0070670_100754804 Ga0070670_1007548041 101
55 3300005331 Ga0070670_101169775 Ga0070670_1011697751 101
56 3300005334 Ga0068869_100357932 Ga0068869_1003579322 101
57 3300005334 Ga0068869_100382385 Ga0068869_1003823853 101
58 3300005334 Ga0068869_100508100 Ga0068869_1005081002 101
59 3300005335 Ga0070666_10011227 Ga0070666_100112278 101
60 3300005335 Ga0070666_10228578 Ga0070666_102285782 101
61 3300005337 Ga0070682_100013717 Ga0070682_10001371710 101
62 3300005337 Ga0070682_100075384 Ga0070682_1000753842 101
63 3300005338 Ga0068868_100005429 Ga0068868_10000542910 101
64 3300005340 Ga0070689_100172900 Ga0070689_1001729002 101
65 3300005343 Ga0070687_100104816 Ga0070687_1001048162 101
66 3300005344 Ga0070661_100107400 Ga0070661_1001074002 101
67 3300005353 Ga0070669_100000505 Ga0070669_10000050537 101
68 3300005353 Ga0070669_100221774 Ga0070669_1002217743 101
69 3300005354 Ga0070675_101450546 Ga0070675_1014505462 101
70 3300005355 Ga0070671_100008454 Ga0070671_1000084547 101
71 3300005364 Ga0070673_100110708 Ga0070673_1001107082 101
72 3300005365 Ga0070688_100749872 Ga0070688_1007498722 101
73 3300005365 Ga0070688_101399877 Ga0070688_1013998771 101
74 3300005367 Ga0070667_100015540 Ga0070667_1000155408 101
75 3300005437 Ga0070710_10642265 Ga0070710_106422651 101
76 3300005444 Ga0070694_100307297 Ga0070694_1003072971 101
77 3300005455 Ga0070663_100226524 Ga0070663_1002265241 101
78 3300005457 Ga0070662_100040865 Ga0070662_1000408654 101
79 3300005457 Ga0070662_100535211 Ga0070662_1005352112 101
80 3300005466 Ga0070685_10369562 Ga0070685_103695621 101
81 3300005543 Ga0070672_100185254 Ga0070672_1001852543 101
82 3300005543 Ga0070672_100677770 Ga0070672_1006777701 101
83 3300005544 Ga0070686_100023394 Ga0070686_1000233942 101
84 3300005546 Ga0070696_100925958 Ga0070696_1009259582 101
85 3300005547 Ga0070693_100111456 Ga0070693_1001114563 101
86 3300005548 Ga0070665_100925997 Ga0070665_1009259972 101
87 3300005563 Ga0068855_100841361 Ga0068855_1008413612 101
88 3300005564 Ga0070664_100028738 Ga0070664_1000287388 101
89 3300005578 Ga0068854_102164420 Ga0068854_1021644201 101
90 3300005614 Ga0068856_100283695 Ga0068856_1002836952 101
91 3300005615 Ga0070702_100116593 Ga0070702_1001165933 101
92 3300005616 Ga0068852_101991483 Ga0068852_1019914831 101
93 3300005617 Ga0068859_100012907 Ga0068859_1000129075 101
94 3300005617 Ga0068859_100313396 Ga0068859_1003133963 101
95 3300005618 Ga0068864_100022600 Ga0068864_1000226008 101
96 3300005719 Ga0068861_100251922 Ga0068861_1002519223 101
97 3300005834 Ga0068851_10401988 Ga0068851_104019881 101
98 3300005841 Ga0068863_100052636 Ga0068863_1000526365 101
99 3300005842 Ga0068858_100006142 Ga0068858_1000061429 101
100 3300005843 Ga0068860_100030150 Ga0068860_1000301507 101
101 3300005844 Ga0068862_100198947 Ga0068862_1001989473 101
102 3300006175 Ga0070712_101692520 Ga0070712_1016925202 101
103 3300006177 Ga0075362_10485788 Ga0075362_104857881 101
104 3300006237 Ga0097621_100068852 Ga0097621_1000688522 101
105 3300006358 Ga0068871_100053404 Ga0068871_1000534047 101
106 3300006844 Ga0075428_100010646 Ga0075428_10001064615 101
107 3300006847 Ga0075431_100168513 Ga0075431_1001685136 101
108 3300006871 Ga0075434_101400889 Ga0075434_1014008892 101
109 3300006931 Ga0097620_100012907 Ga0097620_10001290714 101
110 3300006931 Ga0097620_100313389 Ga0097620_1003133893 101
111 3300009036 Ga0105244_10009211 Ga0105244_1000921111 101
112 3300009036 Ga0105244_10012698 Ga0105244_100126989 101
113 3300009092 Ga0105250_10113330 Ga0105250_101133302 101
114 3300009092 Ga0105250_10396505 Ga0105250_103965052 101
115 3300009093 Ga0105240_10026944 Ga0105240_1002694411 101
116 3300009093 Ga0105240_10821636 Ga0105240_108216362 101
117 3300009094 Ga0111539_11159170 Ga0111539_111591701 101
118 3300009098 Ga0105245_10002979 Ga0105245_1000297916 101
119 3300009101 Ga0105247_10000594 Ga0105247_1000059422 101
120 3300009101 Ga0105247_10341315 Ga0105247_103413152 101
121 3300009147 Ga0114129_10594386 Ga0114129_105943863 101
122 3300009148 Ga0105243_10000654 Ga0105243_1000065439 101
123 3300009148 Ga0105243_10327902 Ga0105243_103279021 101
124 3300009174 Ga0105241_10774151 Ga0105241_107741512 101
125 3300009177 Ga0105248_10011163 Ga0105248_1001116316 101
126 3300009551 Ga0105238_10104652 Ga0105238_101046525 101
127 3300009553 Ga0105249_10008730 Ga0105249_1000873011 101
128 3300009553 Ga0105249_10692088 Ga0105249_106920881 101
129 3300010375 Ga0105239_10018943 Ga0105239_1001894311 101
130 3300011119 Ga0105246_10002426 Ga0105246_100024269 101
131 3300011119 Ga0105246_10819778 Ga0105246_108197781 101
132 3300013102 Ga0157371_11194056 Ga0157371_111940562 101
133 3300013296 Ga0157374_10039413 Ga0157374_100394137 101
134 3300013306 Ga0163162_10013077 Ga0163162_100130777 101
135 3300013308 Ga0157375_10002567 Ga0157375_1000256716 101
136 3300013308 Ga0157375_11027467 Ga0157375_110274672 101
137 3300014325 Ga0163163_10007782 Ga0163163_100077826 101
138 3300014745 Ga0157377_10029824 Ga0157377_100298246 101
139 3300014968 Ga0157379_10011980 Ga0157379_100119805 101
140 3300014968 Ga0157379_10700405 Ga0157379_107004052 101
141 3300014969 Ga0157376_10035934 Ga0157376_100359344 101
142 3300014969 Ga0157376_10749619 Ga0157376_107496192 101
143 3300017792 Ga0163161_11055801 Ga0163161_110558012 101
144 3300025711 Ga0207696_1001061 Ga0207696_100106117 101
145 3300025728 Ga0207655_1002637 Ga0207655_100263714 101
146 3300025728 Ga0207655_1011850 Ga0207655_10118507 101
147 3300025735 Ga0207713_1001071 Ga0207713_100107123 101
148 3300025898 Ga0207692_10532503 Ga0207692_105325032 101
149 3300025900 Ga0207710_10000101 Ga0207710_1000010155 101
150 3300025900 Ga0207710_10265326 Ga0207710_102653262 101
151 3300025903 Ga0207680_10048843 Ga0207680_100488435 101
152 3300025905 Ga0207685_10058439 Ga0207685_100584392 101
153 3300025913 Ga0207695_10006585 Ga0207695_1000658518 101
154 3300025913 Ga0207695_10741159 Ga0207695_107411592 101
155 3300025918 Ga0207662_10039765 Ga0207662_100397653 101
156 3300025920 Ga0207649_10153392 Ga0207649_101533924 101
157 3300025922 Ga0207646_10745188 Ga0207646_107451882 101
158 3300025923 Ga0207681_10016448 Ga0207681_100164482 101
159 3300025923 Ga0207681_10696892 Ga0207681_106968922 101
160 3300025924 Ga0207694_10054062 Ga0207694_100540627 101
161 3300025925 Ga0207650_10056029 Ga0207650_100560295 101
162 3300025925 Ga0207650_10655884 Ga0207650_106558841 101
163 3300025926 Ga0207659_10415776 Ga0207659_104157762 101
164 3300025927 Ga0207687_10024065 Ga0207687_100240656 101
165 3300025931 Ga0207644_10015463 Ga0207644_100154636 101
166 3300025931 Ga0207644_10957567 Ga0207644_109575671 101
167 3300025933 Ga0207706_10088894 Ga0207706_100888943 101
168 3300025933 Ga0207706_10563810 Ga0207706_105638102 101
169 3300025935 Ga0207709_10000016 Ga0207709_1000001654 101
170 3300025935 Ga0207709_10294819 Ga0207709_102948192 101
171 3300025936 Ga0207670_10026879 Ga0207670_100268795 101
172 3300025940 Ga0207691_10551649 Ga0207691_105516491 101
173 3300025941 Ga0207711_10039920 Ga0207711_100399205 101
174 3300025942 Ga0207689_10108021 Ga0207689_101080214 101
175 3300025942 Ga0207689_10288186 Ga0207689_102881862 101
176 3300025942 Ga0207689_10448929 Ga0207689_104489291 101
177 3300025944 Ga0207661_10006141 Ga0207661_100061415 101
178 3300025945 Ga0207679_10033457 Ga0207679_100334575 101
179 3300025949 Ga0207667_10703884 Ga0207667_107038842 101
180 3300025961 Ga0207712_10000551 Ga0207712_1000055132 101
181 3300025961 Ga0207712_10574283 Ga0207712_105742831 101
182 3300025981 Ga0207640_12038327 Ga0207640_120383271 101
183 3300025986 Ga0207658_10040394 Ga0207658_100403942 101
184 3300026023 Ga0207677_10020657 Ga0207677_100206575 101
185 3300026035 Ga0207703_10034130 Ga0207703_100341305 101
186 3300026067 Ga0207678_10308701 Ga0207678_103087013 101
187 3300026078 Ga0207702_10107241 Ga0207702_101072413 101
188 3300026088 Ga0207641_10005619 Ga0207641_100056198 101
189 3300026095 Ga0207676_10003106 Ga0207676_1000310614 101
190 3300026118 Ga0207675_100347254 Ga0207675_1003472542 101
191 3300026121 Ga0207683_10083504 Ga0207683_100835042 101
192 3300027312 Ga0209371_1000024 Ga0209371_1000024423 101
193 3300027907 Ga0207428_10702145 Ga0207428_107021452 101
194 3300028379 Ga0268266_10003836 Ga0268266_1000383615 101
195 3300028379 Ga0268266_10418626 Ga0268266_104186262 101
196 3300028380 Ga0268265_10179248 Ga0268265_101792483 101
197 3300028380 Ga0268265_11508802 Ga0268265_115088022 101
198 3300028381 Ga0268264_10047743 Ga0268264_100477432 101
199 3300030500 Ga0268256_1000026 Ga0268256_1000026423 101
200 3300031239 Ga0265328_10092788 Ga0265328_100927882 101
201 3300031250 Ga0265331_10040404 Ga0265331_100404045 101
202 3300031251 Ga0265327_10001206 Ga0265327_1000120616 101
203 3300031251 Ga0265327_10003993 Ga0265327_1000399313 101
204 3300031251 Ga0265327_10005519 Ga0265327_1000551914 101
205 3300031251 Ga0265327_10014149 Ga0265327_100141498 101
206 3300031251 Ga0265327_10136548 Ga0265327_101365483 101
207 3300031251 Ga0265327_10177474 Ga0265327_101774742 101
208 3300031251 Ga0265327_10383183 Ga0265327_103831831 101
209 3300031251 Ga0265327_10387481 Ga0265327_103874812 101
210 3300031344 Ga0265316_10187269 Ga0265316_101872694 101
211 3300031665 Ga0316575_10008308 Ga0316575_100083082 101
212 3300031665 Ga0316575_10104737 Ga0316575_101047372 101
213 3300031665 Ga0316575_10108836 Ga0316575_101088362 101
214 3300031665 Ga0316575_10122012 Ga0316575_101220123 101
215 3300031665 Ga0316575_10201595 Ga0316575_102015952 101
216 3300031665 Ga0316575_10381376 Ga0316575_103813762 101
217 3300031691 Ga0316579_10005295 Ga0316579_1000529511 101
218 3300031691 Ga0316579_10009012 Ga0316579_100090128 101
219 3300031691 Ga0316579_10010128 Ga0316579_100101282 101
220 3300031691 Ga0316579_10285874 Ga0316579_102858742 101
221 3300031691 Ga0316579_10539812 Ga0316579_105398121 101
222 3300031691 Ga0316579_10609695 Ga0316579_106096952 101
223 3300031727 Ga0316576_10046086 Ga0316576_100460862 101
224 3300031727 Ga0316576_10080384 Ga0316576_100803846 101
225 3300031727 Ga0316576_10138870 Ga0316576_101388702 101
226 3300031727 Ga0316576_10158986 Ga0316576_101589864 101
227 3300031727 Ga0316576_10351362 Ga0316576_103513622 101
228 3300031727 Ga0316576_11142556 Ga0316576_111425561 101
229 3300031728 Ga0316578_10010128 Ga0316578_100101282 101
230 3300031728 Ga0316578_10039294 Ga0316578_100392943 101
231 3300031728 Ga0316578_10052415 Ga0316578_100524154 101
232 3300031728 Ga0316578_10083362 Ga0316578_100833623 101
233 3300031728 Ga0316578_10096296 Ga0316578_100962963 101
234 3300031728 Ga0316578_10281959 Ga0316578_102819591 101
235 3300031733 Ga0316577_10043034 Ga0316577_100430345 101
236 3300031733 Ga0316577_10077469 Ga0316577_100774693 101
237 3300031733 Ga0316577_10098334 Ga0316577_100983342 101
238 3300031733 Ga0316577_10239931 Ga0316577_102399312 101
239 3300031733 Ga0316577_10527454 Ga0316577_105274542 101
240 3300032133 Ga0316583_10013754 Ga0316583_100137548 101
241 3300032133 Ga0316583_10347540 Ga0316583_103475402 101
242 3300032137 Ga0316585_10167951 Ga0316585_101679512 101
243 3300032137 Ga0316585_10301369 Ga0316585_103013692 101
244 3300032139 Ga0316580_10025904 Ga0316580_100259042 101
245 3300032139 Ga0316580_10150112 Ga0316580_101501122 101
246 3300032168 Ga0316593_10000027 Ga0316593_1000002714 101
247 3300032168 Ga0316593_10000032 Ga0316593_1000003214 101
248 3300032168 Ga0316593_10000049 Ga0316593_1000004913 101
249 3300032168 Ga0316593_10000058 Ga0316593_1000005813 101
250 3300032168 Ga0316593_10000090 Ga0316593_1000009014 101
251 3300032168 Ga0316593_10000170 Ga0316593_1000017013 101
252 3300032168 Ga0316593_10000325 Ga0316593_100003251 101
253 3300032168 Ga0316593_10000996 Ga0316593_100009967 101
254 3300032168 Ga0316593_10001237 Ga0316593_100012374 101
255 3300032168 Ga0316593_10001508 Ga0316593_100015088 101
256 3300032168 Ga0316593_10001816 Ga0316593_100018162 101
257 3300032168 Ga0316593_10002414 Ga0316593_100024141 101
258 3300032168 Ga0316593_10004460 Ga0316593_100044607 101
259 3300032168 Ga0316593_10004584 Ga0316593_100045848 101
260 3300032168 Ga0316593_10006375 Ga0316593_100063756 101
261 3300032168 Ga0316593_10010927 Ga0316593_100109274 101
262 3300032168 Ga0316593_10011448 Ga0316593_100114481 101
263 3300032168 Ga0316593_10023181 Ga0316593_100231812 101
264 3300032168 Ga0316593_10026699 Ga0316593_100266993 101
265 3300032168 Ga0316593_10032681 Ga0316593_100326814 101
266 3300032168 Ga0316593_10033248 Ga0316593_100332482 101
267 3300032168 Ga0316593_10054316 Ga0316593_100543163 101
268 3300032168 Ga0316593_10086301 Ga0316593_100863013 101
269 3300032168 Ga0316593_10146565 Ga0316593_101465652 101
270 3300032168 Ga0316593_10158589 Ga0316593_101585892 101
271 3300032168 Ga0316593_10281417 Ga0316593_102814172 101
272 3300032168 Ga0316593_10435410 Ga0316593_104354101 101
273 3300033524 Ga0316592_1000006 Ga0316592_100000616 101
274 3300033524 Ga0316592_1000008 Ga0316592_100000816 101
275 3300033524 Ga0316592_1000152 Ga0316592_100015213 101
276 3300033524 Ga0316592_1010944 Ga0316592_10109442 101
277 3300033524 Ga0316592_1040428 Ga0316592_10404283 101
278 3300033524 Ga0316592_1153018 Ga0316592_11530181 101
279 3300033527 Ga0316586_1000002 Ga0316586_100000211 101
280 3300033527 Ga0316586_1000040 Ga0316586_10000405 101
281 3300033527 Ga0316586_1010956 Ga0316586_10109561 101
282 3300033527 Ga0316586_1022231 Ga0316586_10222313 101
283 3300033527 Ga0316586_1101173 Ga0316586_11011731 101
284 3300033527 Ga0316586_1112656 Ga0316586_11126561 101
285 3300033527 Ga0316586_1118688 Ga0316586_11186882 101
286 3300033528 Ga0316588_1000407 Ga0316588_10004075 101
287 3300033528 Ga0316588_1001039 Ga0316588_10010398 101
288 3300033528 Ga0316588_1001652 Ga0316588_10016524 101
289 3300033528 Ga0316588_1020382 Ga0316588_10203822 101
290 3300033528 Ga0316588_1030773 Ga0316588_10307733 101
291 3300033528 Ga0316588_1055630 Ga0316588_10556302 101
292 3300033529 Ga0316587_1000021 Ga0316587_100002116 101
293 3300033529 Ga0316587_1000182 Ga0316587_10001824 101
294 3300033529 Ga0316587_1000541 Ga0316587_10005416 101
295 3300033529 Ga0316587_1001602 Ga0316587_10016025 101
296 3300033529 Ga0316587_1003531 Ga0316587_10035312 101
297 3300033529 Ga0316587_1012185 Ga0316587_10121852 101
298 3300033529 Ga0316587_1013463 Ga0316587_10134633 101
299 3300033529 Ga0316587_1019625 Ga0316587_10196252 101
300 3300033529 Ga0316587_1020450 Ga0316587_10204502 101
301 3300033529 Ga0316587_1026148 Ga0316587_10261482 101
302 3300033541 Ga0316596_1000013 Ga0316596_100001316 101
303 3300033541 Ga0316596_1000016 Ga0316596_100001614 101
304 3300033541 Ga0316596_1000064 Ga0316596_10000648 101
305 3300033541 Ga0316596_1000070 Ga0316596_100007013 101
306 3300033541 Ga0316596_1000296 Ga0316596_10002965 101
307 3300033541 Ga0316596_1000780 Ga0316596_10007804 101
308 3300033541 Ga0316596_1000880 Ga0316596_10008803 101
309 3300033541 Ga0316596_1002088 Ga0316596_10020885 101
310 3300033541 Ga0316596_1002127 Ga0316596_10021277 101
311 3300033541 Ga0316596_1002164 Ga0316596_10021642 101
312 3300033541 Ga0316596_1004415 Ga0316596_10044158 101
313 3300033541 Ga0316596_1005567 Ga0316596_10055675 101
314 3300033541 Ga0316596_1007429 Ga0316596_10074296 101
315 3300033541 Ga0316596_1009072 Ga0316596_10090724 101
316 3300033541 Ga0316596_1010052 Ga0316596_10100522 101
317 3300033541 Ga0316596_1017275 Ga0316596_10172754 101
318 3300033541 Ga0316596_1021389 Ga0316596_10213892 101
319 3300033541 Ga0316596_1033398 Ga0316596_10333981 101
320 3300033541 Ga0316596_1036743 Ga0316596_10367432 101
321 3300033541 Ga0316596_1048472 Ga0316596_10484723 101
322 3300033541 Ga0316596_1062612 Ga0316596_10626122 101
323 3300033541 Ga0316596_1068931 Ga0316596_10689311 101
324 3300033541 Ga0316596_1076795 Ga0316596_10767953 101
325 3300033541 Ga0316596_1111008 Ga0316596_11110082 101
326 3300033541 Ga0316596_1234139 Ga0316596_12341392 101
327 3300035084 Ga0373928_0108360 Ga0373928_0108360_222_527 101
328 3300035091 Ga0373951_0102257 Ga0373951_0102257_155_460 101
329 3300035114 Ga0373939_0125460 Ga0373939_0125460_31_336 101
330 3300035120 Ga0373957_0382505 Ga0373957_0382505_142_447 101
331 3300035171 Ga0373946_0063374 Ga0373946_0063374_744_1049 101
332 3300035172 Ga0373955_0008911 Ga0373955_0008911_4150_4455 101
333 3300035398 Ga0316574_0000085 Ga0316574_0000085_11414_11719 101
334 3300035398 Ga0316574_0009540 Ga0316574_0009540_3360_3665 101
335 3300035398 Ga0316574_0030582 Ga0316574_0030582_1357_1662 101
336 3300035398 Ga0316574_0038892 Ga0316574_0038892_1276_1581 101
337 3300035398 Ga0316574_0046395 Ga0316574_0046395_697_1002 101
338 3300035398 Ga0316574_0046734 Ga0316574_0046734_2370_2675 101
339 3300035398 Ga0316574_0091649 Ga0316574_0091649_395_700 101
340 3300035398 Ga0316574_0107737 Ga0316574_0107737_550_855 101
341 3300035398 Ga0316574_0148638 Ga0316574_0148638_69_374 101
342 3300035398 Ga0316574_0234958 Ga0316574_0234958_373_678 101
343 3300035398 Ga0316574_0280949 Ga0316574_0280949_329_634 101
344 3300035398 Ga0316574_0381436 Ga0316574_0381436_379_684 101
345 3300035398 Ga0316574_0803693 Ga0316574_0803693_20_325 101
346 3300035691 Ga0373931_0157093 Ga0373931_0157093_491_796 101
347 3300035724 Ga0373933_0012546 Ga0373933_0012546_3793_4098 101
348 3300036401 Ga0373937_0003777 Ga0373937_0003777_8557_8862 101
349 3300036401 Ga0373937_0036176 Ga0373937_0036176_2636_2941 101
350 3300036647 Ga0316582_0002224 Ga0316582_0002224_987_1292 101
351 3300036647 Ga0316582_0012337 Ga0316582_0012337_365_670 101
352 3300036647 Ga0316582_0015971 Ga0316582_0015971_3193_3498 101
353 3300036647 Ga0316582_0027328 Ga0316582_0027328_516_821 101
354 3300036647 Ga0316582_0043630 Ga0316582_0043630_128_433 101
355 3300036647 Ga0316582_0093922 Ga0316582_0093922_1208_1513 101
356 3300036647 Ga0316582_0328203 Ga0316582_0328203_445_750 101
357 3300036647 Ga0316582_0484157 Ga0316582_0484157_533_838 101
358 3300036647 Ga0316582_0506024 Ga0316582_0506024_117_422 101
359 3300036647 Ga0316582_0510128 Ga0316582_0510128_47_352 101
360 3300036647 Ga0316582_0723242 Ga0316582_0723242_250_555 101
361 3300036647 Ga0316582_1078174 Ga0316582_1078174_121_426 101
362 3300036712 Ga0316584_0004999 Ga0316584_0004999_3742_4047 101
363 3300036712 Ga0316584_0022696 Ga0316584_0022696_84_389 101
364 3300036712 Ga0316584_0047543 Ga0316584_0047543_2809_3114 101
365 3300036712 Ga0316584_0086007 Ga0316584_0086007_1952_2257 101
366 3300036712 Ga0316584_0096606 Ga0316584_0096606_143_448 101
367 3300036712 Ga0316584_0112247 Ga0316584_0112247_1215_1520 101
368 3300036712 Ga0316584_0133058 Ga0316584_0133058_659_964 101
369 3300036712 Ga0316584_0227563 Ga0316584_0227563_613_918 101
370 3300036712 Ga0316584_0347997 Ga0316584_0347997_89_394 101
371 3300036712 Ga0316584_0600317 Ga0316584_0600317_294_599 101
372 3300037588 Ga0316581_0003763 Ga0316581_0003763_933_1238 101
373 3300037588 Ga0316581_0008237 Ga0316581_0008237_2020_2325 101
374 3300037588 Ga0316581_0025276 Ga0316581_0025276_852_1157 101
375 3300037588 Ga0316581_0138989 Ga0316581_0138989_261_566 101
376 3300038725 Ga0400484_10568 Ga0400484_10568_1469_1774 101
377 3300038725 Ga0400484_27221 Ga0400484_27221_3449_3754 101
378 3300038725 Ga0400484_30405 Ga0400484_30405_7890_8195 101
379 3300038726 Ga0400490_10179 Ga0400490_10179_263_568 101
380 3300038726 Ga0400490_19939 Ga0400490_19939_1235_1540 101
381 3300038727 Ga0400491_28158 Ga0400491_28158_2715_3020 101
382 3300038735 Ga0400485_14862 Ga0400485_14862_1210_1515 101
383 3300038741 Ga0400488_21953 Ga0400488_21953_1419_1724 101
384 3300038741 Ga0400488_44035 Ga0400488_44035_33_338 101
385 3300038741 Ga0400488_59057 Ga0400488_59057_1703_2008 101
386 3300038742 Ga0400486_28699 Ga0400486_28699_129_434 101
387 3300039062 Ga0400483_039054 Ga0400483_039054_8113_8418 101
388 3300039062 Ga0400483_140144 Ga0400483_140144_7020_7325 101
389 3300039062 Ga0400483_211411 Ga0400483_211411_1796_2101 101
390 3300039093 Ga0400489_28031 Ga0400489_28031_465_770 101
391 3300039110 Ga0400487_00820 Ga0400487_00820_1885_2190 101
392 3300039110 Ga0400487_33555 Ga0400487_33555_68313_68618 101
393 3300039110 Ga0400487_52986 Ga0400487_52986_1982_2287 101
394 3300039110 Ga0400487_54841 Ga0400487_54841_2063_2368 101
395 3300041445 Ga0451792_02650 Ga0451792_02650_20_325 101
396 3300041451 Ga0451791_1202564 Ga0451791_1202564_65_370 101
397 3300042876 Ga0451577_0000210 Ga0451577_0000210_115036_115341 101
398 3300042876 Ga0451577_0030002 Ga0451577_0030002_4062_4367 101
399 3300042876 Ga0451577_0687018 Ga0451577_0687018_390_695 101
400 3300044673 Ga0453683_0303740 Ga0453683_0303740_557_862 101
401 3300044712 Ga0453684_0002807 Ga0453684_0002807_36403_36708 101
402 3300044712 Ga0453684_0243156 Ga0453684_0243156_956_1261 101
403 3300044712 Ga0453684_0396694 Ga0453684_0396694_782_1087 101
404 3300044712 Ga0453684_0430561 Ga0453684_0430561_212_517 101
405 3300044712 Ga0453684_0717014 Ga0453684_0717014_415_720 101
406 3300045051 Ga0451576_0000741 Ga0451576_0000741_37722_38027 101
407 3300045051 Ga0451576_0034235 Ga0451576_0034235_1402_1707 101
408 3300046454 Ga0495592_0606822 Ga0495592_0606822_223_528 101
409 3300046455 Ga0495603_0070158 Ga0495603_0070158_1647_1952 101
410 3300046475 Ga0495639_0098111 Ga0495639_0098111_573_878 101
411 3300046535 Ga0495586_0335799 Ga0495586_0335799_169_474 101
412 3300046642 Ga0495634_0144354 Ga0495634_0144354_325_630 101
413 3300046681 Ga0495647_0021612 Ga0495647_0021612_649_954 101
414 3300046689 Ga0495613_0975708 Ga0495613_0975708_223_528 101
415 3300048903 Ga0496100_0354713 Ga0496100_0354713_188_493 101
416 3300048905 Ga0496102_0514626 Ga0496102_0514626_387_692 101
417 3300048907 Ga0496104_0007967 Ga0496104_0007967_2903_3208 101
418 3300048908 Ga0496105_0485056 Ga0496105_0485056_607_912 101
419 3300048909 Ga0496106_0273703 Ga0496106_0273703_187_492 101
420 3300048910 Ga0496107_0360499 Ga0496107_0360499_633_938 101
421 3300048911 Ga0496108_0044062 Ga0496108_0044062_1532_1837 101
422 3300048912 Ga0496109_0017303 Ga0496109_0017303_3083_3388 101
423 3300048913 Ga0496110_0268143 Ga0496110_0268143_458_763 101
424 3300048915 Ga0496112_0024825 Ga0496112_0024825_4814_5119 101
425 3300048916 Ga0496113_0050042 Ga0496113_0050042_2016_2321 101
426 3300048917 Ga0496114_0011260 Ga0496114_0011260_6622_6927 101
427 3300049570 Ga0501033_0004532 Ga0501033_0004532_880_1185 101
428 3300049571 Ga0501034_0010161 Ga0501034_0010161_3074_3379 101
429 3300049571 Ga0501034_0376669 Ga0501034_0376669_1022_1327 101
430 3300049572 Ga0501036_0160990 Ga0501036_0160990_65_370 101
431 3300049572 Ga0501036_1107948 Ga0501036_1107948_122_427 101
432 3300049573 Ga0501037_0005647 Ga0501037_0005647_1340_1645 101
433 3300049574 Ga0501038_0005917 Ga0501038_0005917_9473_9778 101
434 3300049575 Ga0501039_0010315 Ga0501039_0010315_4301_4606 101
435 3300049575 Ga0501039_0280498 Ga0501039_0280498_508_813 101
436 3300049576 Ga0501040_1126193 Ga0501040_1126193_123_428 101
437 3300049578 Ga0501042_0666563 Ga0501042_0666563_425_730 101
438 3300049579 Ga0501043_0007921 Ga0501043_0007921_7971_8276 101
439 3300049580 Ga0501046_0251935 Ga0501046_0251935_39_344 101
440 3300049581 Ga0501047_0072714 Ga0501047_0072714_1441_1746 101
441 3300049582 Ga0501048_0077989 Ga0501048_0077989_1418_1723 101
442 3300049584 Ga0501068_0068874 Ga0501068_0068874_1078_1383 101
443 3300049587 Ga0501071_0241170 Ga0501071_0241170_349_654 101
444 3300049588 Ga0501072_0417940 Ga0501072_0417940_444_749 101
445 3300049588 Ga0501072_0729659 Ga0501072_0729659_425_730 101
446 3300049589 Ga0501073_0008863 Ga0501073_0008863_3046_3351 101
447 3300049590 Ga0501074_0014241 Ga0501074_0014241_4731_5036 101
448 3300049591 Ga0501075_0959849 Ga0501075_0959849_97_402 101
449 3300049592 Ga0501076_1573468 Ga0501076_1573468_163_468 101
450 3300049742 Ga0501080_0011521 Ga0501080_0011521_6693_6998 101
451 3300049744 Ga0501083_0089232 Ga0501083_0089232_926_1231 101
452 3300049822 Ga0501035_0093976 Ga0501035_0093976_1771_2076 101
453 3300049823 Ga0501044_0206310 Ga0501044_0206310_1468_1773 101
454 3300050507 nmdc:mga05p37_686811_c1 nmdc:mga05p37_686811_c1_322_627 101
455 3300050511 nmdc:mga08y16_943718_c1 nmdc:mga08y16_943718_c1_31_336 101
456 3300050512 nmdc:mga0n895_781330_c1 nmdc:mga0n895_781330_c1_474_779 101
457 3300053077 Ga0495601_0002921 Ga0495601_0002921_6300_6605 101
458 3300053077 Ga0495601_0125414 Ga0495601_0125414_846_1151 101
459 3300054114 Ga0501084_0008596 Ga0501084_0008596_863_1168 101
460 3300060353 Ga0501082_0157434 Ga0501082_0157434_1266_1571 101

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00253

Ribosomal_S14

Ribosomal protein S14p/S29e

47

100

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuf-assembly1.cif.gz_A structure of the spoiiq-spoiiiah pore forming complex. 0.9784 18 50
7vzg-assembly1.cif.gz_A structure of the acidobacteria homodimeric reaction center bound with cytochrome c (the larger form) 0.8703 4 49
6dkm-assembly1.cif.gz_A dhd131 0.859 2 49
6dkm-assembly2.cif.gz_C dhd131 0.8529 2 49
6inr-assembly1.cif.gz_A the crystal structure of phytoplasmal effector causing phyllody symptoms 1 (phyl1) 0.7816 5 49
ID Description Score Start End Superfamily
af_Q9U1M8_1198_1314_1.25.40.530 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;MyTH4 domain 0.9989 24 49 1.25.40.530
af_A0A5K1K948_10_246_1.20.190.20 Mainly Alpha;Up-down Bundle;Delta-Endotoxin; domain 1;14-3-3 domain 0.9913 10 47 1.20.190.20
af_Q9VPS5_207_391_3.50.7.10 Alpha Beta;3-Layer(bba) Sandwich;GroEL;GroEL 0.94 21 50 3.50.7.10
1x4tA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.8612 10 49 1.10.287.660
af_Q9Y4R8_507_628_1.25.40.720 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tel2 C-terminal domain 0.8066 16 49 1.25.40.720
ID Description Score Start End GO Terms
AF-A0A1E1W100-F1-model_v4 Inhibitor of growth protein N-terminal histone-binding domain-containing protein 0.9453 2 49 GO:0005634
GO:0035064
GO:0045893
AF-A0A177WUT1-F1-model_v4 Uncharacterized protein 0.8227 7 64
AF-A0A811PPL6-F1-model_v4 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial (EC 1.3.5.1) 0.7892 9 69 GO:0003735
GO:0005743
GO:0005840
GO:0006099
GO:0006412
GO:0009055
GO:0016491
GO:0022904
GO:0045273
GO:0046872
GO:0051537
GO:0051538
GO:0051539
GO:1990904
AF-A0A5J5WZY3-F1-model_v4 Small ribosomal subunit protein uS14m (Ribosomal protein S14, mitochondrial) 0.7616 8 62 GO:0003735
GO:0005739
GO:0006412
GO:0015935
AF-A0A383B3S2-F1-model_v4 30S ribosomal protein S14 0.7607 4 57

Feature Viewer

pLDDT pTM Quality
75.61 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map