F448482
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 460 | 236 | 443 | 100 |
Family's Representative Sequence
| Representative Sequence | 3300003574|Ga0007410J51695_1048772|Ga0007410J51695_10487728 |
| Length | 101 |
| Sequence | MAKKSMINRELKREKTVAKYAAKRAELKATIANGTASDEERMDAMLKLQALPRDASPVRQRNRCGLTGRPHGYFRKFGLSRNMLRLMVMQGDVPGVVKASW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2551306352 | Acinetobacter sp. GG2 | Isolate | Rhizosphere |
| 3 | 2639762793 | Acinetobacter calcoaceticus GK1 | Isolate | Rhizosphere |
| 4 | 2643221665 | Acinetobacter sp. Root1280 | Isolate | Unclassified |
| 5 | 2675903507 | Acinetobacter calcoaceticus GK2 | Isolate | Unclassified |
| 6 | 2744054655 | Acinetobacter sp. BMW17 | Isolate | Unclassified |
| 7 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 8 | 2773857770 | Acinetobacter sp. 3636 | Isolate | Unclassified |
| 9 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 10 | 2916699645 | Acinetobacter ursingii M3 | Isolate | Unclassified |
| 11 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 12 | 2919506607 | Acinetobacter sp. 3657 | Isolate | Unclassified |
| 13 | 2928515477 | Acinetobacter bereziniae 1375 | Isolate | Rhizosphere |
| 14 | 2984568884 | Acinetobacter baylyi SORGH_AS893 | Isolate | Aerial Root |
| 15 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
| 16 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 17 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 19 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 20 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005473 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 134 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 138 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 139 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 140 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 141 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 142 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 143 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 144 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 145 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 146 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 147 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 148 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 149 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 150 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 151 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 152 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 153 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 155 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 156 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 157 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 158 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 159 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 160 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 161 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 162 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 164 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 165 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 166 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 167 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 169 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 170 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 171 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 172 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 173 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 174 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 175 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 176 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 177 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 178 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 179 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 180 | 3300041445 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT | Metatranscriptome | Rhizoplane |
| 181 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 182 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 183 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 184 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 185 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 186 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 195 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 196 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 197 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 198 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 199 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 200 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 203 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 204 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 205 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 206 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
| 236 | 8033232454 | Acinetobacter radioresistens SA188 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.74 |
| Metatranscriptomes | 19.57 |
| Isolates | 3.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.22 |
| Bulb | 0 |
| Endosphere | 0.22 |
| Nodule | 0 |
| Rhizoplane | 3.26 |
| Rhizosphere | 89.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_863736 | 2162886007 | Bacteria | 7405 |
| 2 | Ga0007410J51695_1048772 | 3300003574 | Bacteria | 4471 |
| 3 | Ga0006562J51391_1016435 | 3300003578 | Bacteria | 4650 |
| 4 | Ga0058692_1000048 | 3300003856 | Bacteria | 110906 |
| 5 | Ga0065703_1000509 | 3300005272 | Bacteria | 21018 |
| 6 | Ga0065704_10002381 | 3300005289 | Bacteria | 14980 |
| 7 | Ga0070683_100024593 | 3300005329 | Bacteria | 5397 |
| 8 | Ga0070690_100034350 | 3300005330 | Bacteria | 3177 |
| 9 | Ga0070670_100077074 | 3300005331 | Bacteria | 2864 |
| 10 | Ga0070670_100754804 | 3300005331 | Bacteria | 877 |
| 11 | Ga0070670_101169775 | 3300005331 | Bacteria | 702 |
| 12 | Ga0068869_100357932 | 3300005334 | Bacteria | 1191 |
| 13 | Ga0068869_100382385 | 3300005334 | Bacteria | 1154 |
| 14 | Ga0068869_100508100 | 3300005334 | Bacteria | 1007 |
| 15 | Ga0070666_10011227 | 3300005335 | Bacteria | 5617 |
| 16 | Ga0070666_10228578 | 3300005335 | Bacteria | 1313 |
| 17 | Ga0070682_100013717 | 3300005337 | Bacteria | 4670 |
| 18 | Ga0070682_100075384 | 3300005337 | Bacteria | 2169 |
| 19 | Ga0068868_100005429 | 3300005338 | Bacteria | 8956 |
| 20 | Ga0070689_100172900 | 3300005340 | Bacteria | 1751 |
| 21 | Ga0070689_100506725 | 3300005340 | Bacteria | 1035 |
| 22 | Ga0070687_100104816 | 3300005343 | Bacteria | 1590 |
| 23 | Ga0070661_100107400 | 3300005344 | Bacteria | 2081 |
| 24 | Ga0070669_100000505 | 3300005353 | Bacteria | 29404 |
| 25 | Ga0070669_100221774 | 3300005353 | Bacteria | 1495 |
| 26 | Ga0070675_101450546 | 3300005354 | Bacteria | 633 |
| 27 | Ga0070671_100008454 | 3300005355 | Bacteria | 8250 |
| 28 | Ga0070673_100110708 | 3300005364 | Bacteria | 2277 |
| 29 | Ga0070688_100749872 | 3300005365 | Bacteria | 760 |
| 30 | Ga0070688_101399877 | 3300005365 | Bacteria | 567 |
| 31 | Ga0070667_100015540 | 3300005367 | Bacteria | 6292 |
| 32 | Ga0070710_10642265 | 3300005437 | Bacteria | 743 |
| 33 | Ga0070694_100307297 | 3300005444 | Bacteria | 1217 |
| 34 | Ga0070663_100226524 | 3300005455 | Bacteria | 1470 |
| 35 | Ga0070662_100040865 | 3300005457 | Bacteria | 3304 |
| 36 | Ga0070662_100535211 | 3300005457 | Bacteria | 980 |
| 37 | Ga0070685_10369562 | 3300005466 | Bacteria | 985 |
| 38 | Ga0074250_11948 | 3300005473 | Bacteria | 687 |
| 39 | Ga0070672_100185254 | 3300005543 | Bacteria | 1736 |
| 40 | Ga0070672_100677770 | 3300005543 | Bacteria | 902 |
| 41 | Ga0070686_100023394 | 3300005544 | Bacteria | 3692 |
| 42 | Ga0070696_100925958 | 3300005546 | Bacteria | 724 |
| 43 | Ga0070693_100111456 | 3300005547 | Bacteria | 1684 |
| 44 | Ga0070665_100925997 | 3300005548 | Bacteria | 884 |
| 45 | Ga0068855_100841361 | 3300005563 | Bacteria | 973 |
| 46 | Ga0070664_100028738 | 3300005564 | Bacteria | 4629 |
| 47 | Ga0068854_102164420 | 3300005578 | Bacteria | 514 |
| 48 | Ga0068856_100283695 | 3300005614 | Bacteria | 1673 |
| 49 | Ga0070702_100116593 | 3300005615 | Bacteria | 1665 |
| 50 | Ga0068852_101991483 | 3300005616 | Bacteria | 603 |
| 51 | Ga0068859_100012907 | 3300005617 | Bacteria | 8391 |
| 52 | Ga0068859_100283041 | 3300005617 | Bacteria | 1751 |
| 53 | Ga0068859_100313396 | 3300005617 | Bacteria | 1663 |
| 54 | Ga0068864_100022600 | 3300005618 | Bacteria | 5274 |
| 55 | Ga0068861_100251922 | 3300005719 | Bacteria | 1507 |
| 56 | Ga0068851_10401988 | 3300005834 | Bacteria | 806 |
| 57 | Ga0068863_100052636 | 3300005841 | Bacteria | 3858 |
| 58 | Ga0068863_100452045 | 3300005841 | Bacteria | 1261 |
| 59 | Ga0068858_100006142 | 3300005842 | Bacteria | 11717 |
| 60 | Ga0068858_100419666 | 3300005842 | Bacteria | 1287 |
| 61 | Ga0068860_100030150 | 3300005843 | Bacteria | 5216 |
| 62 | Ga0068862_100198947 | 3300005844 | Bacteria | 1806 |
| 63 | Ga0070712_101692520 | 3300006175 | Bacteria | 554 |
| 64 | Ga0075362_10485788 | 3300006177 | Bacteria | 630 |
| 65 | Ga0097621_100068852 | 3300006237 | Bacteria | 2920 |
| 66 | Ga0097621_101118206 | 3300006237 | Bacteria | 740 |
| 67 | Ga0068871_100053404 | 3300006358 | Bacteria | 3275 |
| 68 | Ga0068871_100325772 | 3300006358 | Bacteria | 1354 |
| 69 | Ga0075428_100010646 | 3300006844 | Bacteria | 10221 |
| 70 | Ga0075431_100168513 | 3300006847 | Bacteria | 2251 |
| 71 | Ga0075434_101400889 | 3300006871 | Bacteria | 709 |
| 72 | Ga0097620_100012907 | 3300006931 | Bacteria | 8391 |
| 73 | Ga0097620_100283069 | 3300006931 | Bacteria | 1751 |
| 74 | Ga0097620_100313389 | 3300006931 | Bacteria | 1663 |
| 75 | Ga0105244_10009211 | 3300009036 | Bacteria | 6094 |
| 76 | Ga0105244_10012698 | 3300009036 | Bacteria | 4966 |
| 77 | Ga0105250_10113330 | 3300009092 | Bacteria | 1111 |
| 78 | Ga0105250_10396505 | 3300009092 | Bacteria | 611 |
| 79 | Ga0105240_10026944 | 3300009093 | Bacteria | 7534 |
| 80 | Ga0105240_10821636 | 3300009093 | Bacteria | 1005 |
| 81 | Ga0111539_11159170 | 3300009094 | Bacteria | 898 |
| 82 | Ga0105245_10002979 | 3300009098 | Bacteria | 15190 |
| 83 | Ga0105247_10000594 | 3300009101 | Bacteria | 29366 |
| 84 | Ga0105247_10341315 | 3300009101 | Bacteria | 1051 |
| 85 | Ga0114129_10594386 | 3300009147 | Bacteria | 1435 |
| 86 | Ga0105243_10000654 | 3300009148 | Bacteria | 34296 |
| 87 | Ga0105243_10327902 | 3300009148 | Bacteria | 1397 |
| 88 | Ga0105241_10774151 | 3300009174 | Bacteria | 882 |
| 89 | Ga0105248_10011163 | 3300009177 | Bacteria | 9910 |
| 90 | Ga0105238_10104652 | 3300009551 | Bacteria | 2811 |
| 91 | Ga0105249_10008730 | 3300009553 | Bacteria | 8840 |
| 92 | Ga0105249_10692088 | 3300009553 | Bacteria | 1079 |
| 93 | Ga0105239_10018943 | 3300010375 | Bacteria | 7607 |
| 94 | Ga0105246_10002426 | 3300011119 | Bacteria | 11243 |
| 95 | Ga0105246_10819778 | 3300011119 | Bacteria | 827 |
| 96 | Ga0157371_11194056 | 3300013102 | Bacteria | 586 |
| 97 | Ga0157374_10039413 | 3300013296 | Bacteria | 4348 |
| 98 | Ga0157378_10355544 | 3300013297 | Bacteria | 1432 |
| 99 | Ga0163162_10013077 | 3300013306 | Bacteria | 8103 |
| 100 | Ga0157375_10002567 | 3300013308 | Bacteria | 15778 |
| 101 | Ga0157375_11027467 | 3300013308 | Bacteria | 963 |
| 102 | Ga0163163_10007782 | 3300014325 | Bacteria | 9471 |
| 103 | Ga0157377_10029824 | 3300014745 | Bacteria | 2950 |
| 104 | Ga0157379_10011980 | 3300014968 | Bacteria | 7576 |
| 105 | Ga0157379_10700405 | 3300014968 | Bacteria | 951 |
| 106 | Ga0157376_10035934 | 3300014969 | Bacteria | 4010 |
| 107 | Ga0157376_10749619 | 3300014969 | Bacteria | 985 |
| 108 | Ga0157376_13126375 | 3300014969 | Bacteria | 501 |
| 109 | Ga0163161_11055801 | 3300017792 | Bacteria | 696 |
| 110 | Ga0207696_1001061 | 3300025711 | Bacteria | 16224 |
| 111 | Ga0207655_1002637 | 3300025728 | Bacteria | 14194 |
| 112 | Ga0207655_1011850 | 3300025728 | Bacteria | 5150 |
| 113 | Ga0207713_1001071 | 3300025735 | Bacteria | 23607 |
| 114 | Ga0207692_10532503 | 3300025898 | Bacteria | 749 |
| 115 | Ga0207710_10000101 | 3300025900 | Bacteria | 110473 |
| 116 | Ga0207710_10265326 | 3300025900 | Bacteria | 861 |
| 117 | Ga0207680_10048843 | 3300025903 | Bacteria | 2515 |
| 118 | Ga0207685_10058439 | 3300025905 | Bacteria | 1517 |
| 119 | Ga0207695_10006585 | 3300025913 | Bacteria | 15020 |
| 120 | Ga0207695_10741159 | 3300025913 | Bacteria | 863 |
| 121 | Ga0207662_10039765 | 3300025918 | Bacteria | 2760 |
| 122 | Ga0207649_10153392 | 3300025920 | Bacteria | 1589 |
| 123 | Ga0207646_10745188 | 3300025922 | Bacteria | 874 |
| 124 | Ga0207681_10016448 | 3300025923 | Bacteria | 4628 |
| 125 | Ga0207681_10696892 | 3300025923 | Bacteria | 844 |
| 126 | Ga0207694_10054062 | 3300025924 | Bacteria | 3115 |
| 127 | Ga0207650_10056029 | 3300025925 | Bacteria | 2928 |
| 128 | Ga0207650_10655884 | 3300025925 | Bacteria | 885 |
| 129 | Ga0207659_10415776 | 3300025926 | Bacteria | 1127 |
| 130 | Ga0207687_10024065 | 3300025927 | Bacteria | 4064 |
| 131 | Ga0207644_10015463 | 3300025931 | Bacteria | 5122 |
| 132 | Ga0207644_10957567 | 3300025931 | Bacteria | 718 |
| 133 | Ga0207706_10088894 | 3300025933 | Bacteria | 2716 |
| 134 | Ga0207706_10563810 | 3300025933 | Bacteria | 980 |
| 135 | Ga0207709_10000016 | 3300025935 | Bacteria | 478406 |
| 136 | Ga0207709_10294819 | 3300025935 | Bacteria | 1204 |
| 137 | Ga0207670_10026879 | 3300025936 | Bacteria | 3632 |
| 138 | Ga0207691_10551649 | 3300025940 | Bacteria | 977 |
| 139 | Ga0207711_10039920 | 3300025941 | Bacteria | 3992 |
| 140 | Ga0207689_10108021 | 3300025942 | Bacteria | 2287 |
| 141 | Ga0207689_10288186 | 3300025942 | Bacteria | 1360 |
| 142 | Ga0207689_10448929 | 3300025942 | Bacteria | 1078 |
| 143 | Ga0207661_10006141 | 3300025944 | Bacteria | 8491 |
| 144 | Ga0207679_10033457 | 3300025945 | Bacteria | 3617 |
| 145 | Ga0207667_10703884 | 3300025949 | Bacteria | 1012 |
| 146 | Ga0207712_10000551 | 3300025961 | Bacteria | 30254 |
| 147 | Ga0207712_10574283 | 3300025961 | Bacteria | 972 |
| 148 | Ga0207640_12038327 | 3300025981 | Bacteria | 520 |
| 149 | Ga0207658_10040394 | 3300025986 | Bacteria | 3372 |
| 150 | Ga0207677_10020657 | 3300026023 | Bacteria | 4003 |
| 151 | Ga0207703_10034130 | 3300026035 | Bacteria | 4036 |
| 152 | Ga0207678_10308701 | 3300026067 | Bacteria | 1360 |
| 153 | Ga0207702_10107241 | 3300026078 | Bacteria | 2477 |
| 154 | Ga0207641_10005619 | 3300026088 | Bacteria | 10682 |
| 155 | Ga0207641_12169860 | 3300026088 | Bacteria | 556 |
| 156 | Ga0207676_10003106 | 3300026095 | Bacteria | 11850 |
| 157 | Ga0207675_100347254 | 3300026118 | Bacteria | 1453 |
| 158 | Ga0207683_10083504 | 3300026121 | Bacteria | 2839 |
| 159 | Ga0209371_1000024 | 3300027312 | Bacteria | 477286 |
| 160 | Ga0207428_10702145 | 3300027907 | Bacteria | 723 |
| 161 | Ga0268266_10003836 | 3300028379 | Bacteria | 14685 |
| 162 | Ga0268266_10418626 | 3300028379 | Bacteria | 1269 |
| 163 | Ga0268265_10179248 | 3300028380 | Bacteria | 1819 |
| 164 | Ga0268265_11508802 | 3300028380 | Bacteria | 676 |
| 165 | Ga0268264_10047743 | 3300028381 | Bacteria | 3560 |
| 166 | Ga0265336_10070210 | 3300028666 | Bacteria | 1047 |
| 167 | Ga0268256_1000026 | 3300030500 | Bacteria | 477260 |
| 168 | Ga0265328_10092788 | 3300031239 | Bacteria | 1116 |
| 169 | Ga0265331_10040404 | 3300031250 | Bacteria | 2269 |
| 170 | Ga0265327_10001206 | 3300031251 | Bacteria | 34837 |
| 171 | Ga0265327_10003993 | 3300031251 | Bacteria | 13449 |
| 172 | Ga0265327_10005519 | 3300031251 | Bacteria | 10519 |
| 173 | Ga0265327_10014149 | 3300031251 | Bacteria | 5238 |
| 174 | Ga0265327_10136548 | 3300031251 | Bacteria | 1149 |
| 175 | Ga0265327_10177474 | 3300031251 | Bacteria | 976 |
| 176 | Ga0265327_10383183 | 3300031251 | Bacteria | 612 |
| 177 | Ga0265327_10387481 | 3300031251 | Bacteria | 608 |
| 178 | Ga0265316_10013473 | 3300031344 | Bacteria | 7260 |
| 179 | Ga0265316_10187269 | 3300031344 | Bacteria | 1539 |
| 180 | Ga0316575_10008308 | 3300031665 | Bacteria | 3777 |
| 181 | Ga0316575_10104737 | 3300031665 | Bacteria | 1152 |
| 182 | Ga0316575_10108836 | 3300031665 | Bacteria | 1130 |
| 183 | Ga0316575_10122012 | 3300031665 | Bacteria | 1066 |
| 184 | Ga0316575_10201595 | 3300031665 | Bacteria | 828 |
| 185 | Ga0316575_10381376 | 3300031665 | Bacteria | 603 |
| 186 | Ga0316579_10005295 | 3300031691 | Bacteria | 5195 |
| 187 | Ga0316579_10009012 | 3300031691 | Bacteria | 4185 |
| 188 | Ga0316579_10010128 | 3300031691 | Bacteria | 3978 |
| 189 | Ga0316579_10285874 | 3300031691 | Bacteria | 797 |
| 190 | Ga0316579_10539812 | 3300031691 | Bacteria | 564 |
| 191 | Ga0316579_10609695 | 3300031691 | Bacteria | 528 |
| 192 | Ga0316576_10046086 | 3300031727 | Bacteria | 3155 |
| 193 | Ga0316576_10080384 | 3300031727 | Bacteria | 2417 |
| 194 | Ga0316576_10138870 | 3300031727 | Bacteria | 1829 |
| 195 | Ga0316576_10158986 | 3300031727 | Bacteria | 1704 |
| 196 | Ga0316576_10351362 | 3300031727 | Bacteria | 1097 |
| 197 | Ga0316576_11142556 | 3300031727 | Bacteria | 551 |
| 198 | Ga0316578_10010128 | 3300031728 | Bacteria | 4880 |
| 199 | Ga0316578_10039294 | 3300031728 | Bacteria | 2733 |
| 200 | Ga0316578_10052415 | 3300031728 | Bacteria | 2390 |
| 201 | Ga0316578_10083362 | 3300031728 | Bacteria | 1904 |
| 202 | Ga0316578_10096296 | 3300031728 | Bacteria | 1771 |
| 203 | Ga0316578_10281959 | 3300031728 | Bacteria | 995 |
| 204 | Ga0316577_10043034 | 3300031733 | Bacteria | 2527 |
| 205 | Ga0316577_10077469 | 3300031733 | Bacteria | 1857 |
| 206 | Ga0316577_10098334 | 3300031733 | Bacteria | 1639 |
| 207 | Ga0316577_10239931 | 3300031733 | Bacteria | 1025 |
| 208 | Ga0316577_10527454 | 3300031733 | Bacteria | 671 |
| 209 | Ga0307416_103444291 | 3300032002 | Unclassified | 529 |
| 210 | Ga0316583_10013754 | 3300032133 | Bacteria | 2920 |
| 211 | Ga0316583_10347540 | 3300032133 | Bacteria | 513 |
| 212 | Ga0316585_10167951 | 3300032137 | Bacteria | 725 |
| 213 | Ga0316585_10301369 | 3300032137 | Bacteria | 532 |
| 214 | Ga0316580_10025904 | 3300032139 | Bacteria | 1813 |
| 215 | Ga0316580_10150112 | 3300032139 | Bacteria | 715 |
| 216 | Ga0316593_10000027 | 3300032168 | Bacteria | 15426 |
| 217 | Ga0316593_10000032 | 3300032168 | Bacteria | 14610 |
| 218 | Ga0316593_10000049 | 3300032168 | Bacteria | 13299 |
| 219 | Ga0316593_10000058 | 3300032168 | Bacteria | 12691 |
| 220 | Ga0316593_10000090 | 3300032168 | Bacteria | 11405 |
| 221 | Ga0316593_10000167 | 3300032168 | Bacteria | 9674 |
| 222 | Ga0316593_10000170 | 3300032168 | Bacteria | 9614 |
| 223 | Ga0316593_10000325 | 3300032168 | Bacteria | 8199 |
| 224 | Ga0316593_10000996 | 3300032168 | Bacteria | 5864 |
| 225 | Ga0316593_10001237 | 3300032168 | Bacteria | 5509 |
| 226 | Ga0316593_10001508 | 3300032168 | Bacteria | 5159 |
| 227 | Ga0316593_10001816 | 3300032168 | Bacteria | 4873 |
| 228 | Ga0316593_10002414 | 3300032168 | Bacteria | 4421 |
| 229 | Ga0316593_10004460 | 3300032168 | Bacteria | 3596 |
| 230 | Ga0316593_10004584 | 3300032168 | Bacteria | 3563 |
| 231 | Ga0316593_10006375 | 3300032168 | Bacteria | 3178 |
| 232 | Ga0316593_10010927 | 3300032168 | Bacteria | 2622 |
| 233 | Ga0316593_10011448 | 3300032168 | Bacteria | 2577 |
| 234 | Ga0316593_10023181 | 3300032168 | Bacteria | 1957 |
| 235 | Ga0316593_10026699 | 3300032168 | Bacteria | 1848 |
| 236 | Ga0316593_10032681 | 3300032168 | Bacteria | 1700 |
| 237 | Ga0316593_10033248 | 3300032168 | Bacteria | 1688 |
| 238 | Ga0316593_10054316 | 3300032168 | Bacteria | 1359 |
| 239 | Ga0316593_10086301 | 3300032168 | Bacteria | 1101 |
| 240 | Ga0316593_10124629 | 3300032168 | Bacteria | 927 |
| 241 | Ga0316593_10146565 | 3300032168 | Bacteria | 857 |
| 242 | Ga0316593_10148805 | 3300032168 | Bacteria | 851 |
| 243 | Ga0316593_10158589 | 3300032168 | Bacteria | 825 |
| 244 | Ga0316593_10171333 | 3300032168 | Bacteria | 796 |
| 245 | Ga0316593_10281417 | 3300032168 | Bacteria | 627 |
| 246 | Ga0316593_10435410 | 3300032168 | Bacteria | 510 |
| 247 | Ga0316592_1000006 | 3300033524 | Bacteria | 14706 |
| 248 | Ga0316592_1000008 | 3300033524 | Bacteria | 14268 |
| 249 | Ga0316592_1000152 | 3300033524 | Bacteria | 7849 |
| 250 | Ga0316592_1010944 | 3300033524 | Bacteria | 1836 |
| 251 | Ga0316592_1017527 | 3300033524 | Bacteria | 1503 |
| 252 | Ga0316592_1040428 | 3300033524 | Bacteria | 1031 |
| 253 | Ga0316592_1153018 | 3300033524 | Bacteria | 545 |
| 254 | Ga0316586_1000002 | 3300033527 | Bacteria | 13323 |
| 255 | Ga0316586_1000040 | 3300033527 | Bacteria | 8841 |
| 256 | Ga0316586_1010956 | 3300033527 | Bacteria | 1382 |
| 257 | Ga0316586_1022231 | 3300033527 | Bacteria | 1053 |
| 258 | Ga0316586_1101173 | 3300033527 | Bacteria | 551 |
| 259 | Ga0316586_1112656 | 3300033527 | Bacteria | 526 |
| 260 | Ga0316586_1118688 | 3300033527 | Bacteria | 515 |
| 261 | Ga0316588_1000407 | 3300033528 | Bacteria | 5694 |
| 262 | Ga0316588_1001039 | 3300033528 | Bacteria | 4362 |
| 263 | Ga0316588_1001652 | 3300033528 | Bacteria | 3720 |
| 264 | Ga0316588_1020382 | 3300033528 | Bacteria | 1501 |
| 265 | Ga0316588_1030773 | 3300033528 | Bacteria | 1259 |
| 266 | Ga0316588_1055630 | 3300033528 | Bacteria | 962 |
| 267 | Ga0316587_1000021 | 3300033529 | Bacteria | 9386 |
| 268 | Ga0316587_1000182 | 3300033529 | Bacteria | 5325 |
| 269 | Ga0316587_1000541 | 3300033529 | Bacteria | 3919 |
| 270 | Ga0316587_1001602 | 3300033529 | Bacteria | 2844 |
| 271 | Ga0316587_1003531 | 3300033529 | Bacteria | 2201 |
| 272 | Ga0316587_1012185 | 3300033529 | Bacteria | 1396 |
| 273 | Ga0316587_1013463 | 3300033529 | Bacteria | 1340 |
| 274 | Ga0316587_1019625 | 3300033529 | Bacteria | 1144 |
| 275 | Ga0316587_1020450 | 3300033529 | Bacteria | 1123 |
| 276 | Ga0316587_1026148 | 3300033529 | Bacteria | 1016 |
| 277 | Ga0316596_1000013 | 3300033541 | Bacteria | 16477 |
| 278 | Ga0316596_1000016 | 3300033541 | Bacteria | 15149 |
| 279 | Ga0316596_1000064 | 3300033541 | Bacteria | 12159 |
| 280 | Ga0316596_1000070 | 3300033541 | Bacteria | 11847 |
| 281 | Ga0316596_1000296 | 3300033541 | Bacteria | 7867 |
| 282 | Ga0316596_1000780 | 3300033541 | Bacteria | 5864 |
| 283 | Ga0316596_1000880 | 3300033541 | Bacteria | 5653 |
| 284 | Ga0316596_1002088 | 3300033541 | Bacteria | 4213 |
| 285 | Ga0316596_1002127 | 3300033541 | Bacteria | 4184 |
| 286 | Ga0316596_1002164 | 3300033541 | Bacteria | 4160 |
| 287 | Ga0316596_1004415 | 3300033541 | Bacteria | 3154 |
| 288 | Ga0316596_1005400 | 3300033541 | Bacteria | 2918 |
| 289 | Ga0316596_1005567 | 3300033541 | Bacteria | 2883 |
| 290 | Ga0316596_1007429 | 3300033541 | Bacteria | 2589 |
| 291 | Ga0316596_1009072 | 3300033541 | Bacteria | 2384 |
| 292 | Ga0316596_1010052 | 3300033541 | Bacteria | 2282 |
| 293 | Ga0316596_1017275 | 3300033541 | Bacteria | 1813 |
| 294 | Ga0316596_1021389 | 3300033541 | Bacteria | 1649 |
| 295 | Ga0316596_1033398 | 3300033541 | Bacteria | 1340 |
| 296 | Ga0316596_1036743 | 3300033541 | Bacteria | 1280 |
| 297 | Ga0316596_1048472 | 3300033541 | Bacteria | 1122 |
| 298 | Ga0316596_1062612 | 3300033541 | Bacteria | 993 |
| 299 | Ga0316596_1068931 | 3300033541 | Bacteria | 947 |
| 300 | Ga0316596_1076795 | 3300033541 | Bacteria | 896 |
| 301 | Ga0316596_1111008 | 3300033541 | Bacteria | 744 |
| 302 | Ga0316596_1234139 | 3300033541 | Bacteria | 516 |
| 303 | Ga0373928_0108360 | 3300035084 | Bacteria | 732 |
| 304 | Ga0373951_0102257 | 3300035091 | Bacteria | 763 |
| 305 | Ga0373939_0125460 | 3300035114 | Bacteria | 910 |
| 306 | Ga0373957_0382505 | 3300035120 | Bacteria | 604 |
| 307 | Ga0373946_0063374 | 3300035171 | Bacteria | 1579 |
| 308 | Ga0373955_0008911 | 3300035172 | Bacteria | 4679 |
| 309 | Ga0316574_0000085 | 3300035398 | Bacteria | 26529 |
| 310 | Ga0316574_0005225 | 3300035398 | Bacteria | 6904 |
| 311 | Ga0316574_0009540 | 3300035398 | Bacteria | 5440 |
| 312 | Ga0316574_0030582 | 3300035398 | Bacteria | 3262 |
| 313 | Ga0316574_0038892 | 3300035398 | Bacteria | 2922 |
| 314 | Ga0316574_0046395 | 3300035398 | Bacteria | 2694 |
| 315 | Ga0316574_0046734 | 3300035398 | Bacteria | 2685 |
| 316 | Ga0316574_0091649 | 3300035398 | Bacteria | 1938 |
| 317 | Ga0316574_0107737 | 3300035398 | Bacteria | 1785 |
| 318 | Ga0316574_0148638 | 3300035398 | Bacteria | 1510 |
| 319 | Ga0316574_0234958 | 3300035398 | Bacteria | 1172 |
| 320 | Ga0316574_0280949 | 3300035398 | Bacteria | 1060 |
| 321 | Ga0316574_0381436 | 3300035398 | Bacteria | 889 |
| 322 | Ga0316574_0803693 | 3300035398 | Bacteria | 572 |
| 323 | Ga0316574_0915592 | 3300035398 | Bacteria | 530 |
| 324 | Ga0373931_0157093 | 3300035691 | Bacteria | 1330 |
| 325 | Ga0373933_0012546 | 3300035724 | Bacteria | 4683 |
| 326 | Ga0373937_0003777 | 3300036401 | Bacteria | 12804 |
| 327 | Ga0373937_0036176 | 3300036401 | Bacteria | 4498 |
| 328 | Ga0316582_0002224 | 3300036647 | Bacteria | 9011 |
| 329 | Ga0316582_0012337 | 3300036647 | Bacteria | 4764 |
| 330 | Ga0316582_0015971 | 3300036647 | Bacteria | 4307 |
| 331 | Ga0316582_0027328 | 3300036647 | Bacteria | 3445 |
| 332 | Ga0316582_0043630 | 3300036647 | Bacteria | 2814 |
| 333 | Ga0316582_0093922 | 3300036647 | Bacteria | 1978 |
| 334 | Ga0316582_0328203 | 3300036647 | Bacteria | 1052 |
| 335 | Ga0316582_0484157 | 3300036647 | Bacteria | 853 |
| 336 | Ga0316582_0506024 | 3300036647 | Bacteria | 832 |
| 337 | Ga0316582_0510128 | 3300036647 | Bacteria | 829 |
| 338 | Ga0316582_0670180 | 3300036647 | Bacteria | 713 |
| 339 | Ga0316582_0723242 | 3300036647 | Bacteria | 683 |
| 340 | Ga0316582_1059501 | 3300036647 | Bacteria | 553 |
| 341 | Ga0316582_1078174 | 3300036647 | Bacteria | 548 |
| 342 | Ga0316584_0004999 | 3300036712 | Bacteria | 8833 |
| 343 | Ga0316584_0022696 | 3300036712 | Bacteria | 4580 |
| 344 | Ga0316584_0047543 | 3300036712 | Bacteria | 3205 |
| 345 | Ga0316584_0086007 | 3300036712 | Bacteria | 2354 |
| 346 | Ga0316584_0096606 | 3300036712 | Bacteria | 2212 |
| 347 | Ga0316584_0112247 | 3300036712 | Bacteria | 2039 |
| 348 | Ga0316584_0133058 | 3300036712 | Bacteria | 1857 |
| 349 | Ga0316584_0227563 | 3300036712 | Bacteria | 1368 |
| 350 | Ga0316584_0347997 | 3300036712 | Bacteria | 1065 |
| 351 | Ga0316584_0600317 | 3300036712 | Bacteria | 763 |
| 352 | Ga0316584_0849276 | 3300036712 | Bacteria | 617 |
| 353 | Ga0316581_0003763 | 3300037588 | Bacteria | 3809 |
| 354 | Ga0316581_0008237 | 3300037588 | Bacteria | 2829 |
| 355 | Ga0316581_0025276 | 3300037588 | Bacteria | 1766 |
| 356 | Ga0316581_0138989 | 3300037588 | Bacteria | 749 |
| 357 | Ga0400484_10568 | 3300038725 | Bacteria | 4359 |
| 358 | Ga0400484_27221 | 3300038725 | Bacteria | 11015 |
| 359 | Ga0400484_30405 | 3300038725 | Bacteria | 18960 |
| 360 | Ga0400490_10179 | 3300038726 | Bacteria | 1256 |
| 361 | Ga0400490_19939 | 3300038726 | Bacteria | 2587 |
| 362 | Ga0400491_28158 | 3300038727 | Bacteria | 6406 |
| 363 | Ga0400485_14862 | 3300038735 | Bacteria | 1612 |
| 364 | Ga0400488_21953 | 3300038741 | Bacteria | 1813 |
| 365 | Ga0400488_44035 | 3300038741 | Bacteria | 1632 |
| 366 | Ga0400488_59057 | 3300038741 | Bacteria | 3347 |
| 367 | Ga0400486_28699 | 3300038742 | Bacteria | 1294 |
| 368 | Ga0400483_039054 | 3300039062 | Bacteria | 8935 |
| 369 | Ga0400483_126920 | 3300039062 | Bacteria | 1392 |
| 370 | Ga0400483_140144 | 3300039062 | Bacteria | 16717 |
| 371 | Ga0400483_211411 | 3300039062 | Bacteria | 9795 |
| 372 | Ga0400489_28031 | 3300039093 | Bacteria | 1227 |
| 373 | Ga0400487_00820 | 3300039110 | Bacteria | 3258 |
| 374 | Ga0400487_33555 | 3300039110 | Bacteria | 69184 |
| 375 | Ga0400487_52986 | 3300039110 | Bacteria | 2662 |
| 376 | Ga0400487_54841 | 3300039110 | Bacteria | 3504 |
| 377 | Ga0451792_02650 | 3300041445 | Bacteria | 621 |
| 378 | Ga0451791_1202564 | 3300041451 | Bacteria | 523 |
| 379 | Ga0451577_0000210 | 3300042876 | Bacteria | 122637 |
| 380 | Ga0451577_0030002 | 3300042876 | Bacteria | 4913 |
| 381 | Ga0451577_0687018 | 3300042876 | Bacteria | 927 |
| 382 | Ga0453683_0303740 | 3300044673 | Bacteria | 1021 |
| 383 | Ga0453684_0002807 | 3300044712 | Bacteria | 41156 |
| 384 | Ga0453684_0243156 | 3300044712 | Bacteria | 2071 |
| 385 | Ga0453684_0396694 | 3300044712 | Bacteria | 1546 |
| 386 | Ga0453684_0430561 | 3300044712 | Bacteria | 1472 |
| 387 | Ga0453684_0717014 | 3300044712 | Bacteria | 1085 |
| 388 | Ga0451576_0000741 | 3300045051 | Bacteria | 65303 |
| 389 | Ga0451576_0034235 | 3300045051 | Bacteria | 5396 |
| 390 | Ga0495592_0606822 | 3300046454 | Bacteria | 667 |
| 391 | Ga0495603_0070158 | 3300046455 | Bacteria | 2060 |
| 392 | Ga0495639_0098111 | 3300046475 | Bacteria | 1381 |
| 393 | Ga0495586_0335799 | 3300046535 | Bacteria | 867 |
| 394 | Ga0495634_0144354 | 3300046642 | Bacteria | 1509 |
| 395 | Ga0495647_0021612 | 3300046681 | Bacteria | 2318 |
| 396 | Ga0495613_0975708 | 3300046689 | Bacteria | 545 |
| 397 | Ga0496100_0354713 | 3300048903 | Bacteria | 1108 |
| 398 | Ga0496102_0514626 | 3300048905 | Bacteria | 1119 |
| 399 | Ga0496103_0782535 | 3300048906 | Bacteria | 602 |
| 400 | Ga0496104_0007967 | 3300048907 | Bacteria | 9396 |
| 401 | Ga0496105_0485056 | 3300048908 | Bacteria | 972 |
| 402 | Ga0496106_0273703 | 3300048909 | Bacteria | 1352 |
| 403 | Ga0496107_0360499 | 3300048910 | Bacteria | 1082 |
| 404 | Ga0496108_0044062 | 3300048911 | Bacteria | 3726 |
| 405 | Ga0496109_0017303 | 3300048912 | Bacteria | 6315 |
| 406 | Ga0496110_0268143 | 3300048913 | Bacteria | 1554 |
| 407 | Ga0496112_0024825 | 3300048915 | Bacteria | 5749 |
| 408 | Ga0496113_0050042 | 3300048916 | Bacteria | 3114 |
| 409 | Ga0496114_0011260 | 3300048917 | Bacteria | 7141 |
| 410 | Ga0501033_0004532 | 3300049570 | Bacteria | 11123 |
| 411 | Ga0501034_0010161 | 3300049571 | Bacteria | 9819 |
| 412 | Ga0501034_0376669 | 3300049571 | Bacteria | 1345 |
| 413 | Ga0501036_0160990 | 3300049572 | Bacteria | 1892 |
| 414 | Ga0501036_1107948 | 3300049572 | Bacteria | 647 |
| 415 | Ga0501037_0005647 | 3300049573 | Bacteria | 9114 |
| 416 | Ga0501038_0005917 | 3300049574 | Bacteria | 11307 |
| 417 | Ga0501039_0010315 | 3300049575 | Bacteria | 7126 |
| 418 | Ga0501039_0280498 | 3300049575 | Bacteria | 1310 |
| 419 | Ga0501040_1126193 | 3300049576 | Bacteria | 569 |
| 420 | Ga0501042_0666563 | 3300049578 | Bacteria | 756 |
| 421 | Ga0501043_0007921 | 3300049579 | Bacteria | 8396 |
| 422 | Ga0501046_0251935 | 3300049580 | Bacteria | 1299 |
| 423 | Ga0501047_0072714 | 3300049581 | Bacteria | 3309 |
| 424 | Ga0501048_0077989 | 3300049582 | Bacteria | 2338 |
| 425 | Ga0501068_0068874 | 3300049584 | Bacteria | 2157 |
| 426 | Ga0501071_0241170 | 3300049587 | Bacteria | 1363 |
| 427 | Ga0501072_0417940 | 3300049588 | Bacteria | 1063 |
| 428 | Ga0501072_0729659 | 3300049588 | Bacteria | 778 |
| 429 | Ga0501073_0008863 | 3300049589 | Bacteria | 7436 |
| 430 | Ga0501074_0014241 | 3300049590 | Bacteria | 5783 |
| 431 | Ga0501075_0959849 | 3300049591 | Bacteria | 650 |
| 432 | Ga0501076_1573468 | 3300049592 | Bacteria | 539 |
| 433 | Ga0501080_0011521 | 3300049742 | Bacteria | 8096 |
| 434 | Ga0501083_0089232 | 3300049744 | Bacteria | 2037 |
| 435 | Ga0501035_0093976 | 3300049822 | Bacteria | 2637 |
| 436 | Ga0501044_0206310 | 3300049823 | Bacteria | 1921 |
| 437 | nmdc:mga05p37_686811_c1 | 3300050507 | Bacteria | 1140 |
| 438 | nmdc:mga08y16_943718_c1 | 3300050511 | Bacteria | 846 |
| 439 | nmdc:mga0n895_781330_c1 | 3300050512 | Bacteria | 946 |
| 440 | Ga0495601_0002921 | 3300053077 | Bacteria | 9729 |
| 441 | Ga0495601_0125414 | 3300053077 | Bacteria | 1670 |
| 442 | Ga0501084_0008596 | 3300054114 | Bacteria | 8442 |
| 443 | Ga0501082_0157434 | 3300060353 | Bacteria | 1973 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2919506607 | 2919509837 | 82 |
| 2 | 3300013297 | Ga0157378_10355544 | Ga0157378_103555444 | 84 |
| 3 | 3300005473 | Ga0074250_11948 | Ga0074250_119481 | 85 |
| 4 | 3300032168 | Ga0316593_10000167 | Ga0316593_1000016713 | 85 |
| 5 | 3300035398 | Ga0316574_0915592 | Ga0316574_0915592_252_509 | 85 |
| 6 | 3300048906 | Ga0496103_0782535 | Ga0496103_0782535_325_582 | 85 |
| 7 | 3300033524 | Ga0316592_1017527 | Ga0316592_10175271 | 86 |
| 8 | 3300039062 | Ga0400483_126920 | Ga0400483_126920_754_1059 | 88 |
| 9 | 3300033541 | Ga0316596_1005400 | Ga0316596_10054002 | 89 |
| 10 | 3300032168 | Ga0316593_10171333 | Ga0316593_101713331 | 94 |
| 11 | 3300005340 | Ga0070689_100506725 | Ga0070689_1005067252 | 96 |
| 12 | 3300005617 | Ga0068859_100283041 | Ga0068859_1002830412 | 96 |
| 13 | 3300005841 | Ga0068863_100452045 | Ga0068863_1004520453 | 96 |
| 14 | 3300005842 | Ga0068858_100419666 | Ga0068858_1004196663 | 96 |
| 15 | 3300006237 | Ga0097621_101118206 | Ga0097621_1011182062 | 96 |
| 16 | 3300006358 | Ga0068871_100325772 | Ga0068871_1003257722 | 96 |
| 17 | 3300006931 | Ga0097620_100283069 | Ga0097620_1002830692 | 96 |
| 18 | 3300014969 | Ga0157376_13126375 | Ga0157376_131263752 | 96 |
| 19 | 3300026088 | Ga0207641_12169860 | Ga0207641_121698602 | 96 |
| 20 | 3300028666 | Ga0265336_10070210 | Ga0265336_100702103 | 96 |
| 21 | 3300031344 | Ga0265316_10013473 | Ga0265316_1001347316 | 96 |
| 22 | 3300032002 | Ga0307416_103444291 | Ga0307416_1034442911 | 96 |
| 23 | 3300032168 | Ga0316593_10124629 | Ga0316593_101246292 | 96 |
| 24 | 3300032168 | Ga0316593_10148805 | Ga0316593_101488052 | 96 |
| 25 | 3300035398 | Ga0316574_0005225 | Ga0316574_0005225_130_420 | 96 |
| 26 | 3300036647 | Ga0316582_0670180 | Ga0316582_0670180_409_699 | 96 |
| 27 | 3300036647 | Ga0316582_1059501 | Ga0316582_1059501_133_423 | 96 |
| 28 | 3300036712 | Ga0316584_0849276 | Ga0316584_0849276_229_519 | 96 |
| 29 | iso_pu_bacteria | 2551306352 | 2552747533 | 97 |
| 30 | iso_pu_bacteria | 2639762793 | 2640735797 | 97 |
| 31 | iso_pu_bacteria | 2643221665 | 2644361950 | 97 |
| 32 | iso_pu_bacteria | 2675903507 | 2678229060 | 97 |
| 33 | iso_pu_bacteria | 2744054655 | 2745159947 | 97 |
| 34 | iso_pu_bacteria | 2773857761 | 2774390396 | 97 |
| 35 | iso_pu_bacteria | 2773857770 | 2774437749 | 97 |
| 36 | iso_pu_bacteria | 2894510363 | 2894510840 | 97 |
| 37 | iso_pu_bacteria | 2916699645 | 2916700222 | 97 |
| 38 | iso_pu_bacteria | 2919182534 | 2919184750 | 97 |
| 39 | iso_pu_bacteria | 2928515477 | 2928517469 | 97 |
| 40 | iso_pu_bacteria | 2984568884 | 2984571905 | 97 |
| 41 | iso_pu_bacteria | 2989392574 | 2989393094 | 97 |
| 42 | iso_pu_bacteria | 3007252601 | 3007255618 | 97 |
| 43 | iso_pu_bacteria | 8001522603 | 8001524074 | 97 |
| 44 | iso_pu_bacteria | 8033232454 | 8033234121 | 97 |
| 45 | 2162886007 | SwRhRL2b_contig_863736 | SwRhRL2b_0206.00000640 | 101 |
| 46 | 3300003574 | Ga0007410J51695_1048772 | Ga0007410J51695_10487728 | 101 |
| 47 | 3300003578 | Ga0006562J51391_1016435 | Ga0006562J51391_10164358 | 101 |
| 48 | 3300003856 | Ga0058692_1000048 | Ga0058692_100004852 | 101 |
| 49 | 3300005272 | Ga0065703_1000509 | Ga0065703_100050923 | 101 |
| 50 | 3300005289 | Ga0065704_10002381 | Ga0065704_1000238116 | 101 |
| 51 | 3300005329 | Ga0070683_100024593 | Ga0070683_10002459311 | 101 |
| 52 | 3300005330 | Ga0070690_100034350 | Ga0070690_1000343504 | 101 |
| 53 | 3300005331 | Ga0070670_100077074 | Ga0070670_1000770743 | 101 |
| 54 | 3300005331 | Ga0070670_100754804 | Ga0070670_1007548041 | 101 |
| 55 | 3300005331 | Ga0070670_101169775 | Ga0070670_1011697751 | 101 |
| 56 | 3300005334 | Ga0068869_100357932 | Ga0068869_1003579322 | 101 |
| 57 | 3300005334 | Ga0068869_100382385 | Ga0068869_1003823853 | 101 |
| 58 | 3300005334 | Ga0068869_100508100 | Ga0068869_1005081002 | 101 |
| 59 | 3300005335 | Ga0070666_10011227 | Ga0070666_100112278 | 101 |
| 60 | 3300005335 | Ga0070666_10228578 | Ga0070666_102285782 | 101 |
| 61 | 3300005337 | Ga0070682_100013717 | Ga0070682_10001371710 | 101 |
| 62 | 3300005337 | Ga0070682_100075384 | Ga0070682_1000753842 | 101 |
| 63 | 3300005338 | Ga0068868_100005429 | Ga0068868_10000542910 | 101 |
| 64 | 3300005340 | Ga0070689_100172900 | Ga0070689_1001729002 | 101 |
| 65 | 3300005343 | Ga0070687_100104816 | Ga0070687_1001048162 | 101 |
| 66 | 3300005344 | Ga0070661_100107400 | Ga0070661_1001074002 | 101 |
| 67 | 3300005353 | Ga0070669_100000505 | Ga0070669_10000050537 | 101 |
| 68 | 3300005353 | Ga0070669_100221774 | Ga0070669_1002217743 | 101 |
| 69 | 3300005354 | Ga0070675_101450546 | Ga0070675_1014505462 | 101 |
| 70 | 3300005355 | Ga0070671_100008454 | Ga0070671_1000084547 | 101 |
| 71 | 3300005364 | Ga0070673_100110708 | Ga0070673_1001107082 | 101 |
| 72 | 3300005365 | Ga0070688_100749872 | Ga0070688_1007498722 | 101 |
| 73 | 3300005365 | Ga0070688_101399877 | Ga0070688_1013998771 | 101 |
| 74 | 3300005367 | Ga0070667_100015540 | Ga0070667_1000155408 | 101 |
| 75 | 3300005437 | Ga0070710_10642265 | Ga0070710_106422651 | 101 |
| 76 | 3300005444 | Ga0070694_100307297 | Ga0070694_1003072971 | 101 |
| 77 | 3300005455 | Ga0070663_100226524 | Ga0070663_1002265241 | 101 |
| 78 | 3300005457 | Ga0070662_100040865 | Ga0070662_1000408654 | 101 |
| 79 | 3300005457 | Ga0070662_100535211 | Ga0070662_1005352112 | 101 |
| 80 | 3300005466 | Ga0070685_10369562 | Ga0070685_103695621 | 101 |
| 81 | 3300005543 | Ga0070672_100185254 | Ga0070672_1001852543 | 101 |
| 82 | 3300005543 | Ga0070672_100677770 | Ga0070672_1006777701 | 101 |
| 83 | 3300005544 | Ga0070686_100023394 | Ga0070686_1000233942 | 101 |
| 84 | 3300005546 | Ga0070696_100925958 | Ga0070696_1009259582 | 101 |
| 85 | 3300005547 | Ga0070693_100111456 | Ga0070693_1001114563 | 101 |
| 86 | 3300005548 | Ga0070665_100925997 | Ga0070665_1009259972 | 101 |
| 87 | 3300005563 | Ga0068855_100841361 | Ga0068855_1008413612 | 101 |
| 88 | 3300005564 | Ga0070664_100028738 | Ga0070664_1000287388 | 101 |
| 89 | 3300005578 | Ga0068854_102164420 | Ga0068854_1021644201 | 101 |
| 90 | 3300005614 | Ga0068856_100283695 | Ga0068856_1002836952 | 101 |
| 91 | 3300005615 | Ga0070702_100116593 | Ga0070702_1001165933 | 101 |
| 92 | 3300005616 | Ga0068852_101991483 | Ga0068852_1019914831 | 101 |
| 93 | 3300005617 | Ga0068859_100012907 | Ga0068859_1000129075 | 101 |
| 94 | 3300005617 | Ga0068859_100313396 | Ga0068859_1003133963 | 101 |
| 95 | 3300005618 | Ga0068864_100022600 | Ga0068864_1000226008 | 101 |
| 96 | 3300005719 | Ga0068861_100251922 | Ga0068861_1002519223 | 101 |
| 97 | 3300005834 | Ga0068851_10401988 | Ga0068851_104019881 | 101 |
| 98 | 3300005841 | Ga0068863_100052636 | Ga0068863_1000526365 | 101 |
| 99 | 3300005842 | Ga0068858_100006142 | Ga0068858_1000061429 | 101 |
| 100 | 3300005843 | Ga0068860_100030150 | Ga0068860_1000301507 | 101 |
| 101 | 3300005844 | Ga0068862_100198947 | Ga0068862_1001989473 | 101 |
| 102 | 3300006175 | Ga0070712_101692520 | Ga0070712_1016925202 | 101 |
| 103 | 3300006177 | Ga0075362_10485788 | Ga0075362_104857881 | 101 |
| 104 | 3300006237 | Ga0097621_100068852 | Ga0097621_1000688522 | 101 |
| 105 | 3300006358 | Ga0068871_100053404 | Ga0068871_1000534047 | 101 |
| 106 | 3300006844 | Ga0075428_100010646 | Ga0075428_10001064615 | 101 |
| 107 | 3300006847 | Ga0075431_100168513 | Ga0075431_1001685136 | 101 |
| 108 | 3300006871 | Ga0075434_101400889 | Ga0075434_1014008892 | 101 |
| 109 | 3300006931 | Ga0097620_100012907 | Ga0097620_10001290714 | 101 |
| 110 | 3300006931 | Ga0097620_100313389 | Ga0097620_1003133893 | 101 |
| 111 | 3300009036 | Ga0105244_10009211 | Ga0105244_1000921111 | 101 |
| 112 | 3300009036 | Ga0105244_10012698 | Ga0105244_100126989 | 101 |
| 113 | 3300009092 | Ga0105250_10113330 | Ga0105250_101133302 | 101 |
| 114 | 3300009092 | Ga0105250_10396505 | Ga0105250_103965052 | 101 |
| 115 | 3300009093 | Ga0105240_10026944 | Ga0105240_1002694411 | 101 |
| 116 | 3300009093 | Ga0105240_10821636 | Ga0105240_108216362 | 101 |
| 117 | 3300009094 | Ga0111539_11159170 | Ga0111539_111591701 | 101 |
| 118 | 3300009098 | Ga0105245_10002979 | Ga0105245_1000297916 | 101 |
| 119 | 3300009101 | Ga0105247_10000594 | Ga0105247_1000059422 | 101 |
| 120 | 3300009101 | Ga0105247_10341315 | Ga0105247_103413152 | 101 |
| 121 | 3300009147 | Ga0114129_10594386 | Ga0114129_105943863 | 101 |
| 122 | 3300009148 | Ga0105243_10000654 | Ga0105243_1000065439 | 101 |
| 123 | 3300009148 | Ga0105243_10327902 | Ga0105243_103279021 | 101 |
| 124 | 3300009174 | Ga0105241_10774151 | Ga0105241_107741512 | 101 |
| 125 | 3300009177 | Ga0105248_10011163 | Ga0105248_1001116316 | 101 |
| 126 | 3300009551 | Ga0105238_10104652 | Ga0105238_101046525 | 101 |
| 127 | 3300009553 | Ga0105249_10008730 | Ga0105249_1000873011 | 101 |
| 128 | 3300009553 | Ga0105249_10692088 | Ga0105249_106920881 | 101 |
| 129 | 3300010375 | Ga0105239_10018943 | Ga0105239_1001894311 | 101 |
| 130 | 3300011119 | Ga0105246_10002426 | Ga0105246_100024269 | 101 |
| 131 | 3300011119 | Ga0105246_10819778 | Ga0105246_108197781 | 101 |
| 132 | 3300013102 | Ga0157371_11194056 | Ga0157371_111940562 | 101 |
| 133 | 3300013296 | Ga0157374_10039413 | Ga0157374_100394137 | 101 |
| 134 | 3300013306 | Ga0163162_10013077 | Ga0163162_100130777 | 101 |
| 135 | 3300013308 | Ga0157375_10002567 | Ga0157375_1000256716 | 101 |
| 136 | 3300013308 | Ga0157375_11027467 | Ga0157375_110274672 | 101 |
| 137 | 3300014325 | Ga0163163_10007782 | Ga0163163_100077826 | 101 |
| 138 | 3300014745 | Ga0157377_10029824 | Ga0157377_100298246 | 101 |
| 139 | 3300014968 | Ga0157379_10011980 | Ga0157379_100119805 | 101 |
| 140 | 3300014968 | Ga0157379_10700405 | Ga0157379_107004052 | 101 |
| 141 | 3300014969 | Ga0157376_10035934 | Ga0157376_100359344 | 101 |
| 142 | 3300014969 | Ga0157376_10749619 | Ga0157376_107496192 | 101 |
| 143 | 3300017792 | Ga0163161_11055801 | Ga0163161_110558012 | 101 |
| 144 | 3300025711 | Ga0207696_1001061 | Ga0207696_100106117 | 101 |
| 145 | 3300025728 | Ga0207655_1002637 | Ga0207655_100263714 | 101 |
| 146 | 3300025728 | Ga0207655_1011850 | Ga0207655_10118507 | 101 |
| 147 | 3300025735 | Ga0207713_1001071 | Ga0207713_100107123 | 101 |
| 148 | 3300025898 | Ga0207692_10532503 | Ga0207692_105325032 | 101 |
| 149 | 3300025900 | Ga0207710_10000101 | Ga0207710_1000010155 | 101 |
| 150 | 3300025900 | Ga0207710_10265326 | Ga0207710_102653262 | 101 |
| 151 | 3300025903 | Ga0207680_10048843 | Ga0207680_100488435 | 101 |
| 152 | 3300025905 | Ga0207685_10058439 | Ga0207685_100584392 | 101 |
| 153 | 3300025913 | Ga0207695_10006585 | Ga0207695_1000658518 | 101 |
| 154 | 3300025913 | Ga0207695_10741159 | Ga0207695_107411592 | 101 |
| 155 | 3300025918 | Ga0207662_10039765 | Ga0207662_100397653 | 101 |
| 156 | 3300025920 | Ga0207649_10153392 | Ga0207649_101533924 | 101 |
| 157 | 3300025922 | Ga0207646_10745188 | Ga0207646_107451882 | 101 |
| 158 | 3300025923 | Ga0207681_10016448 | Ga0207681_100164482 | 101 |
| 159 | 3300025923 | Ga0207681_10696892 | Ga0207681_106968922 | 101 |
| 160 | 3300025924 | Ga0207694_10054062 | Ga0207694_100540627 | 101 |
| 161 | 3300025925 | Ga0207650_10056029 | Ga0207650_100560295 | 101 |
| 162 | 3300025925 | Ga0207650_10655884 | Ga0207650_106558841 | 101 |
| 163 | 3300025926 | Ga0207659_10415776 | Ga0207659_104157762 | 101 |
| 164 | 3300025927 | Ga0207687_10024065 | Ga0207687_100240656 | 101 |
| 165 | 3300025931 | Ga0207644_10015463 | Ga0207644_100154636 | 101 |
| 166 | 3300025931 | Ga0207644_10957567 | Ga0207644_109575671 | 101 |
| 167 | 3300025933 | Ga0207706_10088894 | Ga0207706_100888943 | 101 |
| 168 | 3300025933 | Ga0207706_10563810 | Ga0207706_105638102 | 101 |
| 169 | 3300025935 | Ga0207709_10000016 | Ga0207709_1000001654 | 101 |
| 170 | 3300025935 | Ga0207709_10294819 | Ga0207709_102948192 | 101 |
| 171 | 3300025936 | Ga0207670_10026879 | Ga0207670_100268795 | 101 |
| 172 | 3300025940 | Ga0207691_10551649 | Ga0207691_105516491 | 101 |
| 173 | 3300025941 | Ga0207711_10039920 | Ga0207711_100399205 | 101 |
| 174 | 3300025942 | Ga0207689_10108021 | Ga0207689_101080214 | 101 |
| 175 | 3300025942 | Ga0207689_10288186 | Ga0207689_102881862 | 101 |
| 176 | 3300025942 | Ga0207689_10448929 | Ga0207689_104489291 | 101 |
| 177 | 3300025944 | Ga0207661_10006141 | Ga0207661_100061415 | 101 |
| 178 | 3300025945 | Ga0207679_10033457 | Ga0207679_100334575 | 101 |
| 179 | 3300025949 | Ga0207667_10703884 | Ga0207667_107038842 | 101 |
| 180 | 3300025961 | Ga0207712_10000551 | Ga0207712_1000055132 | 101 |
| 181 | 3300025961 | Ga0207712_10574283 | Ga0207712_105742831 | 101 |
| 182 | 3300025981 | Ga0207640_12038327 | Ga0207640_120383271 | 101 |
| 183 | 3300025986 | Ga0207658_10040394 | Ga0207658_100403942 | 101 |
| 184 | 3300026023 | Ga0207677_10020657 | Ga0207677_100206575 | 101 |
| 185 | 3300026035 | Ga0207703_10034130 | Ga0207703_100341305 | 101 |
| 186 | 3300026067 | Ga0207678_10308701 | Ga0207678_103087013 | 101 |
| 187 | 3300026078 | Ga0207702_10107241 | Ga0207702_101072413 | 101 |
| 188 | 3300026088 | Ga0207641_10005619 | Ga0207641_100056198 | 101 |
| 189 | 3300026095 | Ga0207676_10003106 | Ga0207676_1000310614 | 101 |
| 190 | 3300026118 | Ga0207675_100347254 | Ga0207675_1003472542 | 101 |
| 191 | 3300026121 | Ga0207683_10083504 | Ga0207683_100835042 | 101 |
| 192 | 3300027312 | Ga0209371_1000024 | Ga0209371_1000024423 | 101 |
| 193 | 3300027907 | Ga0207428_10702145 | Ga0207428_107021452 | 101 |
| 194 | 3300028379 | Ga0268266_10003836 | Ga0268266_1000383615 | 101 |
| 195 | 3300028379 | Ga0268266_10418626 | Ga0268266_104186262 | 101 |
| 196 | 3300028380 | Ga0268265_10179248 | Ga0268265_101792483 | 101 |
| 197 | 3300028380 | Ga0268265_11508802 | Ga0268265_115088022 | 101 |
| 198 | 3300028381 | Ga0268264_10047743 | Ga0268264_100477432 | 101 |
| 199 | 3300030500 | Ga0268256_1000026 | Ga0268256_1000026423 | 101 |
| 200 | 3300031239 | Ga0265328_10092788 | Ga0265328_100927882 | 101 |
| 201 | 3300031250 | Ga0265331_10040404 | Ga0265331_100404045 | 101 |
| 202 | 3300031251 | Ga0265327_10001206 | Ga0265327_1000120616 | 101 |
| 203 | 3300031251 | Ga0265327_10003993 | Ga0265327_1000399313 | 101 |
| 204 | 3300031251 | Ga0265327_10005519 | Ga0265327_1000551914 | 101 |
| 205 | 3300031251 | Ga0265327_10014149 | Ga0265327_100141498 | 101 |
| 206 | 3300031251 | Ga0265327_10136548 | Ga0265327_101365483 | 101 |
| 207 | 3300031251 | Ga0265327_10177474 | Ga0265327_101774742 | 101 |
| 208 | 3300031251 | Ga0265327_10383183 | Ga0265327_103831831 | 101 |
| 209 | 3300031251 | Ga0265327_10387481 | Ga0265327_103874812 | 101 |
| 210 | 3300031344 | Ga0265316_10187269 | Ga0265316_101872694 | 101 |
| 211 | 3300031665 | Ga0316575_10008308 | Ga0316575_100083082 | 101 |
| 212 | 3300031665 | Ga0316575_10104737 | Ga0316575_101047372 | 101 |
| 213 | 3300031665 | Ga0316575_10108836 | Ga0316575_101088362 | 101 |
| 214 | 3300031665 | Ga0316575_10122012 | Ga0316575_101220123 | 101 |
| 215 | 3300031665 | Ga0316575_10201595 | Ga0316575_102015952 | 101 |
| 216 | 3300031665 | Ga0316575_10381376 | Ga0316575_103813762 | 101 |
| 217 | 3300031691 | Ga0316579_10005295 | Ga0316579_1000529511 | 101 |
| 218 | 3300031691 | Ga0316579_10009012 | Ga0316579_100090128 | 101 |
| 219 | 3300031691 | Ga0316579_10010128 | Ga0316579_100101282 | 101 |
| 220 | 3300031691 | Ga0316579_10285874 | Ga0316579_102858742 | 101 |
| 221 | 3300031691 | Ga0316579_10539812 | Ga0316579_105398121 | 101 |
| 222 | 3300031691 | Ga0316579_10609695 | Ga0316579_106096952 | 101 |
| 223 | 3300031727 | Ga0316576_10046086 | Ga0316576_100460862 | 101 |
| 224 | 3300031727 | Ga0316576_10080384 | Ga0316576_100803846 | 101 |
| 225 | 3300031727 | Ga0316576_10138870 | Ga0316576_101388702 | 101 |
| 226 | 3300031727 | Ga0316576_10158986 | Ga0316576_101589864 | 101 |
| 227 | 3300031727 | Ga0316576_10351362 | Ga0316576_103513622 | 101 |
| 228 | 3300031727 | Ga0316576_11142556 | Ga0316576_111425561 | 101 |
| 229 | 3300031728 | Ga0316578_10010128 | Ga0316578_100101282 | 101 |
| 230 | 3300031728 | Ga0316578_10039294 | Ga0316578_100392943 | 101 |
| 231 | 3300031728 | Ga0316578_10052415 | Ga0316578_100524154 | 101 |
| 232 | 3300031728 | Ga0316578_10083362 | Ga0316578_100833623 | 101 |
| 233 | 3300031728 | Ga0316578_10096296 | Ga0316578_100962963 | 101 |
| 234 | 3300031728 | Ga0316578_10281959 | Ga0316578_102819591 | 101 |
| 235 | 3300031733 | Ga0316577_10043034 | Ga0316577_100430345 | 101 |
| 236 | 3300031733 | Ga0316577_10077469 | Ga0316577_100774693 | 101 |
| 237 | 3300031733 | Ga0316577_10098334 | Ga0316577_100983342 | 101 |
| 238 | 3300031733 | Ga0316577_10239931 | Ga0316577_102399312 | 101 |
| 239 | 3300031733 | Ga0316577_10527454 | Ga0316577_105274542 | 101 |
| 240 | 3300032133 | Ga0316583_10013754 | Ga0316583_100137548 | 101 |
| 241 | 3300032133 | Ga0316583_10347540 | Ga0316583_103475402 | 101 |
| 242 | 3300032137 | Ga0316585_10167951 | Ga0316585_101679512 | 101 |
| 243 | 3300032137 | Ga0316585_10301369 | Ga0316585_103013692 | 101 |
| 244 | 3300032139 | Ga0316580_10025904 | Ga0316580_100259042 | 101 |
| 245 | 3300032139 | Ga0316580_10150112 | Ga0316580_101501122 | 101 |
| 246 | 3300032168 | Ga0316593_10000027 | Ga0316593_1000002714 | 101 |
| 247 | 3300032168 | Ga0316593_10000032 | Ga0316593_1000003214 | 101 |
| 248 | 3300032168 | Ga0316593_10000049 | Ga0316593_1000004913 | 101 |
| 249 | 3300032168 | Ga0316593_10000058 | Ga0316593_1000005813 | 101 |
| 250 | 3300032168 | Ga0316593_10000090 | Ga0316593_1000009014 | 101 |
| 251 | 3300032168 | Ga0316593_10000170 | Ga0316593_1000017013 | 101 |
| 252 | 3300032168 | Ga0316593_10000325 | Ga0316593_100003251 | 101 |
| 253 | 3300032168 | Ga0316593_10000996 | Ga0316593_100009967 | 101 |
| 254 | 3300032168 | Ga0316593_10001237 | Ga0316593_100012374 | 101 |
| 255 | 3300032168 | Ga0316593_10001508 | Ga0316593_100015088 | 101 |
| 256 | 3300032168 | Ga0316593_10001816 | Ga0316593_100018162 | 101 |
| 257 | 3300032168 | Ga0316593_10002414 | Ga0316593_100024141 | 101 |
| 258 | 3300032168 | Ga0316593_10004460 | Ga0316593_100044607 | 101 |
| 259 | 3300032168 | Ga0316593_10004584 | Ga0316593_100045848 | 101 |
| 260 | 3300032168 | Ga0316593_10006375 | Ga0316593_100063756 | 101 |
| 261 | 3300032168 | Ga0316593_10010927 | Ga0316593_100109274 | 101 |
| 262 | 3300032168 | Ga0316593_10011448 | Ga0316593_100114481 | 101 |
| 263 | 3300032168 | Ga0316593_10023181 | Ga0316593_100231812 | 101 |
| 264 | 3300032168 | Ga0316593_10026699 | Ga0316593_100266993 | 101 |
| 265 | 3300032168 | Ga0316593_10032681 | Ga0316593_100326814 | 101 |
| 266 | 3300032168 | Ga0316593_10033248 | Ga0316593_100332482 | 101 |
| 267 | 3300032168 | Ga0316593_10054316 | Ga0316593_100543163 | 101 |
| 268 | 3300032168 | Ga0316593_10086301 | Ga0316593_100863013 | 101 |
| 269 | 3300032168 | Ga0316593_10146565 | Ga0316593_101465652 | 101 |
| 270 | 3300032168 | Ga0316593_10158589 | Ga0316593_101585892 | 101 |
| 271 | 3300032168 | Ga0316593_10281417 | Ga0316593_102814172 | 101 |
| 272 | 3300032168 | Ga0316593_10435410 | Ga0316593_104354101 | 101 |
| 273 | 3300033524 | Ga0316592_1000006 | Ga0316592_100000616 | 101 |
| 274 | 3300033524 | Ga0316592_1000008 | Ga0316592_100000816 | 101 |
| 275 | 3300033524 | Ga0316592_1000152 | Ga0316592_100015213 | 101 |
| 276 | 3300033524 | Ga0316592_1010944 | Ga0316592_10109442 | 101 |
| 277 | 3300033524 | Ga0316592_1040428 | Ga0316592_10404283 | 101 |
| 278 | 3300033524 | Ga0316592_1153018 | Ga0316592_11530181 | 101 |
| 279 | 3300033527 | Ga0316586_1000002 | Ga0316586_100000211 | 101 |
| 280 | 3300033527 | Ga0316586_1000040 | Ga0316586_10000405 | 101 |
| 281 | 3300033527 | Ga0316586_1010956 | Ga0316586_10109561 | 101 |
| 282 | 3300033527 | Ga0316586_1022231 | Ga0316586_10222313 | 101 |
| 283 | 3300033527 | Ga0316586_1101173 | Ga0316586_11011731 | 101 |
| 284 | 3300033527 | Ga0316586_1112656 | Ga0316586_11126561 | 101 |
| 285 | 3300033527 | Ga0316586_1118688 | Ga0316586_11186882 | 101 |
| 286 | 3300033528 | Ga0316588_1000407 | Ga0316588_10004075 | 101 |
| 287 | 3300033528 | Ga0316588_1001039 | Ga0316588_10010398 | 101 |
| 288 | 3300033528 | Ga0316588_1001652 | Ga0316588_10016524 | 101 |
| 289 | 3300033528 | Ga0316588_1020382 | Ga0316588_10203822 | 101 |
| 290 | 3300033528 | Ga0316588_1030773 | Ga0316588_10307733 | 101 |
| 291 | 3300033528 | Ga0316588_1055630 | Ga0316588_10556302 | 101 |
| 292 | 3300033529 | Ga0316587_1000021 | Ga0316587_100002116 | 101 |
| 293 | 3300033529 | Ga0316587_1000182 | Ga0316587_10001824 | 101 |
| 294 | 3300033529 | Ga0316587_1000541 | Ga0316587_10005416 | 101 |
| 295 | 3300033529 | Ga0316587_1001602 | Ga0316587_10016025 | 101 |
| 296 | 3300033529 | Ga0316587_1003531 | Ga0316587_10035312 | 101 |
| 297 | 3300033529 | Ga0316587_1012185 | Ga0316587_10121852 | 101 |
| 298 | 3300033529 | Ga0316587_1013463 | Ga0316587_10134633 | 101 |
| 299 | 3300033529 | Ga0316587_1019625 | Ga0316587_10196252 | 101 |
| 300 | 3300033529 | Ga0316587_1020450 | Ga0316587_10204502 | 101 |
| 301 | 3300033529 | Ga0316587_1026148 | Ga0316587_10261482 | 101 |
| 302 | 3300033541 | Ga0316596_1000013 | Ga0316596_100001316 | 101 |
| 303 | 3300033541 | Ga0316596_1000016 | Ga0316596_100001614 | 101 |
| 304 | 3300033541 | Ga0316596_1000064 | Ga0316596_10000648 | 101 |
| 305 | 3300033541 | Ga0316596_1000070 | Ga0316596_100007013 | 101 |
| 306 | 3300033541 | Ga0316596_1000296 | Ga0316596_10002965 | 101 |
| 307 | 3300033541 | Ga0316596_1000780 | Ga0316596_10007804 | 101 |
| 308 | 3300033541 | Ga0316596_1000880 | Ga0316596_10008803 | 101 |
| 309 | 3300033541 | Ga0316596_1002088 | Ga0316596_10020885 | 101 |
| 310 | 3300033541 | Ga0316596_1002127 | Ga0316596_10021277 | 101 |
| 311 | 3300033541 | Ga0316596_1002164 | Ga0316596_10021642 | 101 |
| 312 | 3300033541 | Ga0316596_1004415 | Ga0316596_10044158 | 101 |
| 313 | 3300033541 | Ga0316596_1005567 | Ga0316596_10055675 | 101 |
| 314 | 3300033541 | Ga0316596_1007429 | Ga0316596_10074296 | 101 |
| 315 | 3300033541 | Ga0316596_1009072 | Ga0316596_10090724 | 101 |
| 316 | 3300033541 | Ga0316596_1010052 | Ga0316596_10100522 | 101 |
| 317 | 3300033541 | Ga0316596_1017275 | Ga0316596_10172754 | 101 |
| 318 | 3300033541 | Ga0316596_1021389 | Ga0316596_10213892 | 101 |
| 319 | 3300033541 | Ga0316596_1033398 | Ga0316596_10333981 | 101 |
| 320 | 3300033541 | Ga0316596_1036743 | Ga0316596_10367432 | 101 |
| 321 | 3300033541 | Ga0316596_1048472 | Ga0316596_10484723 | 101 |
| 322 | 3300033541 | Ga0316596_1062612 | Ga0316596_10626122 | 101 |
| 323 | 3300033541 | Ga0316596_1068931 | Ga0316596_10689311 | 101 |
| 324 | 3300033541 | Ga0316596_1076795 | Ga0316596_10767953 | 101 |
| 325 | 3300033541 | Ga0316596_1111008 | Ga0316596_11110082 | 101 |
| 326 | 3300033541 | Ga0316596_1234139 | Ga0316596_12341392 | 101 |
| 327 | 3300035084 | Ga0373928_0108360 | Ga0373928_0108360_222_527 | 101 |
| 328 | 3300035091 | Ga0373951_0102257 | Ga0373951_0102257_155_460 | 101 |
| 329 | 3300035114 | Ga0373939_0125460 | Ga0373939_0125460_31_336 | 101 |
| 330 | 3300035120 | Ga0373957_0382505 | Ga0373957_0382505_142_447 | 101 |
| 331 | 3300035171 | Ga0373946_0063374 | Ga0373946_0063374_744_1049 | 101 |
| 332 | 3300035172 | Ga0373955_0008911 | Ga0373955_0008911_4150_4455 | 101 |
| 333 | 3300035398 | Ga0316574_0000085 | Ga0316574_0000085_11414_11719 | 101 |
| 334 | 3300035398 | Ga0316574_0009540 | Ga0316574_0009540_3360_3665 | 101 |
| 335 | 3300035398 | Ga0316574_0030582 | Ga0316574_0030582_1357_1662 | 101 |
| 336 | 3300035398 | Ga0316574_0038892 | Ga0316574_0038892_1276_1581 | 101 |
| 337 | 3300035398 | Ga0316574_0046395 | Ga0316574_0046395_697_1002 | 101 |
| 338 | 3300035398 | Ga0316574_0046734 | Ga0316574_0046734_2370_2675 | 101 |
| 339 | 3300035398 | Ga0316574_0091649 | Ga0316574_0091649_395_700 | 101 |
| 340 | 3300035398 | Ga0316574_0107737 | Ga0316574_0107737_550_855 | 101 |
| 341 | 3300035398 | Ga0316574_0148638 | Ga0316574_0148638_69_374 | 101 |
| 342 | 3300035398 | Ga0316574_0234958 | Ga0316574_0234958_373_678 | 101 |
| 343 | 3300035398 | Ga0316574_0280949 | Ga0316574_0280949_329_634 | 101 |
| 344 | 3300035398 | Ga0316574_0381436 | Ga0316574_0381436_379_684 | 101 |
| 345 | 3300035398 | Ga0316574_0803693 | Ga0316574_0803693_20_325 | 101 |
| 346 | 3300035691 | Ga0373931_0157093 | Ga0373931_0157093_491_796 | 101 |
| 347 | 3300035724 | Ga0373933_0012546 | Ga0373933_0012546_3793_4098 | 101 |
| 348 | 3300036401 | Ga0373937_0003777 | Ga0373937_0003777_8557_8862 | 101 |
| 349 | 3300036401 | Ga0373937_0036176 | Ga0373937_0036176_2636_2941 | 101 |
| 350 | 3300036647 | Ga0316582_0002224 | Ga0316582_0002224_987_1292 | 101 |
| 351 | 3300036647 | Ga0316582_0012337 | Ga0316582_0012337_365_670 | 101 |
| 352 | 3300036647 | Ga0316582_0015971 | Ga0316582_0015971_3193_3498 | 101 |
| 353 | 3300036647 | Ga0316582_0027328 | Ga0316582_0027328_516_821 | 101 |
| 354 | 3300036647 | Ga0316582_0043630 | Ga0316582_0043630_128_433 | 101 |
| 355 | 3300036647 | Ga0316582_0093922 | Ga0316582_0093922_1208_1513 | 101 |
| 356 | 3300036647 | Ga0316582_0328203 | Ga0316582_0328203_445_750 | 101 |
| 357 | 3300036647 | Ga0316582_0484157 | Ga0316582_0484157_533_838 | 101 |
| 358 | 3300036647 | Ga0316582_0506024 | Ga0316582_0506024_117_422 | 101 |
| 359 | 3300036647 | Ga0316582_0510128 | Ga0316582_0510128_47_352 | 101 |
| 360 | 3300036647 | Ga0316582_0723242 | Ga0316582_0723242_250_555 | 101 |
| 361 | 3300036647 | Ga0316582_1078174 | Ga0316582_1078174_121_426 | 101 |
| 362 | 3300036712 | Ga0316584_0004999 | Ga0316584_0004999_3742_4047 | 101 |
| 363 | 3300036712 | Ga0316584_0022696 | Ga0316584_0022696_84_389 | 101 |
| 364 | 3300036712 | Ga0316584_0047543 | Ga0316584_0047543_2809_3114 | 101 |
| 365 | 3300036712 | Ga0316584_0086007 | Ga0316584_0086007_1952_2257 | 101 |
| 366 | 3300036712 | Ga0316584_0096606 | Ga0316584_0096606_143_448 | 101 |
| 367 | 3300036712 | Ga0316584_0112247 | Ga0316584_0112247_1215_1520 | 101 |
| 368 | 3300036712 | Ga0316584_0133058 | Ga0316584_0133058_659_964 | 101 |
| 369 | 3300036712 | Ga0316584_0227563 | Ga0316584_0227563_613_918 | 101 |
| 370 | 3300036712 | Ga0316584_0347997 | Ga0316584_0347997_89_394 | 101 |
| 371 | 3300036712 | Ga0316584_0600317 | Ga0316584_0600317_294_599 | 101 |
| 372 | 3300037588 | Ga0316581_0003763 | Ga0316581_0003763_933_1238 | 101 |
| 373 | 3300037588 | Ga0316581_0008237 | Ga0316581_0008237_2020_2325 | 101 |
| 374 | 3300037588 | Ga0316581_0025276 | Ga0316581_0025276_852_1157 | 101 |
| 375 | 3300037588 | Ga0316581_0138989 | Ga0316581_0138989_261_566 | 101 |
| 376 | 3300038725 | Ga0400484_10568 | Ga0400484_10568_1469_1774 | 101 |
| 377 | 3300038725 | Ga0400484_27221 | Ga0400484_27221_3449_3754 | 101 |
| 378 | 3300038725 | Ga0400484_30405 | Ga0400484_30405_7890_8195 | 101 |
| 379 | 3300038726 | Ga0400490_10179 | Ga0400490_10179_263_568 | 101 |
| 380 | 3300038726 | Ga0400490_19939 | Ga0400490_19939_1235_1540 | 101 |
| 381 | 3300038727 | Ga0400491_28158 | Ga0400491_28158_2715_3020 | 101 |
| 382 | 3300038735 | Ga0400485_14862 | Ga0400485_14862_1210_1515 | 101 |
| 383 | 3300038741 | Ga0400488_21953 | Ga0400488_21953_1419_1724 | 101 |
| 384 | 3300038741 | Ga0400488_44035 | Ga0400488_44035_33_338 | 101 |
| 385 | 3300038741 | Ga0400488_59057 | Ga0400488_59057_1703_2008 | 101 |
| 386 | 3300038742 | Ga0400486_28699 | Ga0400486_28699_129_434 | 101 |
| 387 | 3300039062 | Ga0400483_039054 | Ga0400483_039054_8113_8418 | 101 |
| 388 | 3300039062 | Ga0400483_140144 | Ga0400483_140144_7020_7325 | 101 |
| 389 | 3300039062 | Ga0400483_211411 | Ga0400483_211411_1796_2101 | 101 |
| 390 | 3300039093 | Ga0400489_28031 | Ga0400489_28031_465_770 | 101 |
| 391 | 3300039110 | Ga0400487_00820 | Ga0400487_00820_1885_2190 | 101 |
| 392 | 3300039110 | Ga0400487_33555 | Ga0400487_33555_68313_68618 | 101 |
| 393 | 3300039110 | Ga0400487_52986 | Ga0400487_52986_1982_2287 | 101 |
| 394 | 3300039110 | Ga0400487_54841 | Ga0400487_54841_2063_2368 | 101 |
| 395 | 3300041445 | Ga0451792_02650 | Ga0451792_02650_20_325 | 101 |
| 396 | 3300041451 | Ga0451791_1202564 | Ga0451791_1202564_65_370 | 101 |
| 397 | 3300042876 | Ga0451577_0000210 | Ga0451577_0000210_115036_115341 | 101 |
| 398 | 3300042876 | Ga0451577_0030002 | Ga0451577_0030002_4062_4367 | 101 |
| 399 | 3300042876 | Ga0451577_0687018 | Ga0451577_0687018_390_695 | 101 |
| 400 | 3300044673 | Ga0453683_0303740 | Ga0453683_0303740_557_862 | 101 |
| 401 | 3300044712 | Ga0453684_0002807 | Ga0453684_0002807_36403_36708 | 101 |
| 402 | 3300044712 | Ga0453684_0243156 | Ga0453684_0243156_956_1261 | 101 |
| 403 | 3300044712 | Ga0453684_0396694 | Ga0453684_0396694_782_1087 | 101 |
| 404 | 3300044712 | Ga0453684_0430561 | Ga0453684_0430561_212_517 | 101 |
| 405 | 3300044712 | Ga0453684_0717014 | Ga0453684_0717014_415_720 | 101 |
| 406 | 3300045051 | Ga0451576_0000741 | Ga0451576_0000741_37722_38027 | 101 |
| 407 | 3300045051 | Ga0451576_0034235 | Ga0451576_0034235_1402_1707 | 101 |
| 408 | 3300046454 | Ga0495592_0606822 | Ga0495592_0606822_223_528 | 101 |
| 409 | 3300046455 | Ga0495603_0070158 | Ga0495603_0070158_1647_1952 | 101 |
| 410 | 3300046475 | Ga0495639_0098111 | Ga0495639_0098111_573_878 | 101 |
| 411 | 3300046535 | Ga0495586_0335799 | Ga0495586_0335799_169_474 | 101 |
| 412 | 3300046642 | Ga0495634_0144354 | Ga0495634_0144354_325_630 | 101 |
| 413 | 3300046681 | Ga0495647_0021612 | Ga0495647_0021612_649_954 | 101 |
| 414 | 3300046689 | Ga0495613_0975708 | Ga0495613_0975708_223_528 | 101 |
| 415 | 3300048903 | Ga0496100_0354713 | Ga0496100_0354713_188_493 | 101 |
| 416 | 3300048905 | Ga0496102_0514626 | Ga0496102_0514626_387_692 | 101 |
| 417 | 3300048907 | Ga0496104_0007967 | Ga0496104_0007967_2903_3208 | 101 |
| 418 | 3300048908 | Ga0496105_0485056 | Ga0496105_0485056_607_912 | 101 |
| 419 | 3300048909 | Ga0496106_0273703 | Ga0496106_0273703_187_492 | 101 |
| 420 | 3300048910 | Ga0496107_0360499 | Ga0496107_0360499_633_938 | 101 |
| 421 | 3300048911 | Ga0496108_0044062 | Ga0496108_0044062_1532_1837 | 101 |
| 422 | 3300048912 | Ga0496109_0017303 | Ga0496109_0017303_3083_3388 | 101 |
| 423 | 3300048913 | Ga0496110_0268143 | Ga0496110_0268143_458_763 | 101 |
| 424 | 3300048915 | Ga0496112_0024825 | Ga0496112_0024825_4814_5119 | 101 |
| 425 | 3300048916 | Ga0496113_0050042 | Ga0496113_0050042_2016_2321 | 101 |
| 426 | 3300048917 | Ga0496114_0011260 | Ga0496114_0011260_6622_6927 | 101 |
| 427 | 3300049570 | Ga0501033_0004532 | Ga0501033_0004532_880_1185 | 101 |
| 428 | 3300049571 | Ga0501034_0010161 | Ga0501034_0010161_3074_3379 | 101 |
| 429 | 3300049571 | Ga0501034_0376669 | Ga0501034_0376669_1022_1327 | 101 |
| 430 | 3300049572 | Ga0501036_0160990 | Ga0501036_0160990_65_370 | 101 |
| 431 | 3300049572 | Ga0501036_1107948 | Ga0501036_1107948_122_427 | 101 |
| 432 | 3300049573 | Ga0501037_0005647 | Ga0501037_0005647_1340_1645 | 101 |
| 433 | 3300049574 | Ga0501038_0005917 | Ga0501038_0005917_9473_9778 | 101 |
| 434 | 3300049575 | Ga0501039_0010315 | Ga0501039_0010315_4301_4606 | 101 |
| 435 | 3300049575 | Ga0501039_0280498 | Ga0501039_0280498_508_813 | 101 |
| 436 | 3300049576 | Ga0501040_1126193 | Ga0501040_1126193_123_428 | 101 |
| 437 | 3300049578 | Ga0501042_0666563 | Ga0501042_0666563_425_730 | 101 |
| 438 | 3300049579 | Ga0501043_0007921 | Ga0501043_0007921_7971_8276 | 101 |
| 439 | 3300049580 | Ga0501046_0251935 | Ga0501046_0251935_39_344 | 101 |
| 440 | 3300049581 | Ga0501047_0072714 | Ga0501047_0072714_1441_1746 | 101 |
| 441 | 3300049582 | Ga0501048_0077989 | Ga0501048_0077989_1418_1723 | 101 |
| 442 | 3300049584 | Ga0501068_0068874 | Ga0501068_0068874_1078_1383 | 101 |
| 443 | 3300049587 | Ga0501071_0241170 | Ga0501071_0241170_349_654 | 101 |
| 444 | 3300049588 | Ga0501072_0417940 | Ga0501072_0417940_444_749 | 101 |
| 445 | 3300049588 | Ga0501072_0729659 | Ga0501072_0729659_425_730 | 101 |
| 446 | 3300049589 | Ga0501073_0008863 | Ga0501073_0008863_3046_3351 | 101 |
| 447 | 3300049590 | Ga0501074_0014241 | Ga0501074_0014241_4731_5036 | 101 |
| 448 | 3300049591 | Ga0501075_0959849 | Ga0501075_0959849_97_402 | 101 |
| 449 | 3300049592 | Ga0501076_1573468 | Ga0501076_1573468_163_468 | 101 |
| 450 | 3300049742 | Ga0501080_0011521 | Ga0501080_0011521_6693_6998 | 101 |
| 451 | 3300049744 | Ga0501083_0089232 | Ga0501083_0089232_926_1231 | 101 |
| 452 | 3300049822 | Ga0501035_0093976 | Ga0501035_0093976_1771_2076 | 101 |
| 453 | 3300049823 | Ga0501044_0206310 | Ga0501044_0206310_1468_1773 | 101 |
| 454 | 3300050507 | nmdc:mga05p37_686811_c1 | nmdc:mga05p37_686811_c1_322_627 | 101 |
| 455 | 3300050511 | nmdc:mga08y16_943718_c1 | nmdc:mga08y16_943718_c1_31_336 | 101 |
| 456 | 3300050512 | nmdc:mga0n895_781330_c1 | nmdc:mga0n895_781330_c1_474_779 | 101 |
| 457 | 3300053077 | Ga0495601_0002921 | Ga0495601_0002921_6300_6605 | 101 |
| 458 | 3300053077 | Ga0495601_0125414 | Ga0495601_0125414_846_1151 | 101 |
| 459 | 3300054114 | Ga0501084_0008596 | Ga0501084_0008596_863_1168 | 101 |
| 460 | 3300060353 | Ga0501082_0157434 | Ga0501082_0157434_1266_1571 | 101 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tuf-assembly1.cif.gz_A | structure of the spoiiq-spoiiiah pore forming complex. | 0.9784 | 18 | 50 |
| 7vzg-assembly1.cif.gz_A | structure of the acidobacteria homodimeric reaction center bound with cytochrome c (the larger form) | 0.8703 | 4 | 49 |
| 6dkm-assembly1.cif.gz_A | dhd131 | 0.859 | 2 | 49 |
| 6dkm-assembly2.cif.gz_C | dhd131 | 0.8529 | 2 | 49 |
| 6inr-assembly1.cif.gz_A | the crystal structure of phytoplasmal effector causing phyllody symptoms 1 (phyl1) | 0.7816 | 5 | 49 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9U1M8_1198_1314_1.25.40.530 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;MyTH4 domain | 0.9989 | 24 | 49 | 1.25.40.530 |
| af_A0A5K1K948_10_246_1.20.190.20 | Mainly Alpha;Up-down Bundle;Delta-Endotoxin; domain 1;14-3-3 domain | 0.9913 | 10 | 47 | 1.20.190.20 |
| af_Q9VPS5_207_391_3.50.7.10 | Alpha Beta;3-Layer(bba) Sandwich;GroEL;GroEL | 0.94 | 21 | 50 | 3.50.7.10 |
| 1x4tA01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.8612 | 10 | 49 | 1.10.287.660 |
| af_Q9Y4R8_507_628_1.25.40.720 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tel2 C-terminal domain | 0.8066 | 16 | 49 | 1.25.40.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1E1W100-F1-model_v4 | Inhibitor of growth protein N-terminal histone-binding domain-containing protein | 0.9453 | 2 | 49 |
GO:0005634
GO:0035064 GO:0045893 |
| AF-A0A177WUT1-F1-model_v4 | Uncharacterized protein | 0.8227 | 7 | 64 |
|
| AF-A0A811PPL6-F1-model_v4 | Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial (EC 1.3.5.1) | 0.7892 | 9 | 69 |
GO:0003735
GO:0005743 GO:0005840 GO:0006099 GO:0006412 GO:0009055 GO:0016491 GO:0022904 GO:0045273 GO:0046872 GO:0051537 GO:0051538 GO:0051539 GO:1990904 |
| AF-A0A5J5WZY3-F1-model_v4 | Small ribosomal subunit protein uS14m (Ribosomal protein S14, mitochondrial) | 0.7616 | 8 | 62 |
GO:0003735
GO:0005739 GO:0006412 GO:0015935 |
| AF-A0A383B3S2-F1-model_v4 | 30S ribosomal protein S14 | 0.7607 | 4 | 57 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar