F448452

General Info

Members Datasets Scaffolds Average Seq Length
459 235 918 381

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_322902_c1|nmdc:mga0n895_322902_c1_251_1525
Length 424
Sequence MILAMPMVSAQKAIHAFRALRGNNTAPSILTMPRSTTSDNYTPRPEHHFTFGLWTVGNVGRDPFGDPVRPAISPVDIVRKLAELGAYGVNFHDNDLVPRDTSAAERDKIVKEFKNALEQTGVKVPMATTNLFGDPVFRDGAFTSNDARVRAYALQKTMRAMDLGVELGAKTYVFWGGREGVETNAAKNPVESLKWFRDALNFLCEYSRAQKYDLKFALEPKPNEPRGDIFLPTIGHMLAFIYTLDHPDMVGLNPEVAHDTMAGLDFSHGVAQALEAGKLFHIDLNGQKPGRFDQDLRFGSEDPKAAFFLVKLLEDSKWTGMRHFDSHAYRTEDFDGVWDFAAGSMRTYLILKEKVAQFAADEEIQGLLAELRERGATVGDRVTFSADGAKKLKERAFDLEAMRKQGYAYERLDQLTMELLLGVR

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
162 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
166 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
169 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
177 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
192 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
235 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.44
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.18
Rhizosphere 95.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_322902_c1 3300050512 Bacteria 1564
2 JGI25406J46586_10001618 3300003203 Bacteria 10628
3 Ga0065715_10106694 3300005293 Bacteria 2814
4 Ga0070658_10275449 3300005327 Bacteria 1432
5 Ga0070683_100014907 3300005329 Bacteria 6813
6 Ga0070683_100018738 3300005329 Bacteria 6136
7 Ga0070683_100025613 3300005329 Bacteria 5300
8 Ga0070683_100025662 3300005329 Bacteria 5295
9 Ga0070683_100115872 3300005329 Bacteria 2530
10 Ga0070690_100011175 3300005330 Bacteria 5246
11 Ga0070690_100011241 3300005330 Bacteria 5232
12 Ga0070670_100012556 3300005331 Bacteria 7251
13 Ga0070670_100014168 3300005331 Bacteria 6840
14 Ga0070670_100035274 3300005331 Bacteria 4307
15 Ga0070670_100087549 3300005331 Bacteria 2677
16 Ga0070670_100147823 3300005331 Bacteria 2033
17 Ga0068869_100006545 3300005334 Bacteria 7388
18 Ga0068869_100013006 3300005334 Bacteria 5521
19 Ga0068869_100082231 3300005334 Bacteria 2406
20 Ga0070666_10056583 3300005335 Bacteria 2649
21 Ga0070680_100061661 3300005336 Bacteria 3070
22 Ga0070682_100025420 3300005337 Bacteria 3533
23 Ga0068868_100036061 3300005338 Bacteria 3825
24 Ga0068868_100079575 3300005338 Bacteria 2625
25 Ga0068868_100166246 3300005338 Bacteria 1825
26 Ga0070660_100069985 3300005339 Bacteria 2737
27 Ga0070689_100009808 3300005340 Bacteria 6806
28 Ga0070689_100112294 3300005340 Bacteria 2169
29 Ga0070689_100148826 3300005340 Bacteria 1887
30 Ga0070687_100073026 3300005343 Bacteria 1848
31 Ga0070661_100024327 3300005344 Bacteria 4344
32 Ga0070661_100028407 3300005344 Bacteria 4035
33 Ga0070661_100086562 3300005344 Bacteria 2317
34 Ga0070668_100015497 3300005347 Bacteria 5698
35 Ga0070668_100015689 3300005347 Bacteria 5666
36 Ga0070668_100067192 3300005347 Bacteria 2784
37 Ga0070669_100019213 3300005353 Bacteria 4881
38 Ga0070675_100006193 3300005354 Bacteria 9177
39 Ga0070675_100006859 3300005354 Bacteria 8744
40 Ga0070675_100031243 3300005354 Bacteria 4304
41 Ga0070675_100120707 3300005354 Bacteria 2227
42 Ga0070675_100167610 3300005354 Bacteria 1892
43 Ga0070675_100179610 3300005354 Bacteria 1829
44 Ga0070675_100261914 3300005354 Bacteria 1515
45 Ga0070671_100014530 3300005355 Bacteria 6365
46 Ga0070671_100016715 3300005355 Bacteria 5933
47 Ga0070671_100042030 3300005355 Bacteria 3800
48 Ga0070671_100088902 3300005355 Bacteria 2586
49 Ga0070671_100147096 3300005355 Bacteria 1989
50 Ga0070674_100019498 3300005356 Bacteria 4308
51 Ga0070674_100096477 3300005356 Bacteria 2146
52 Ga0070674_100108159 3300005356 Bacteria 2037
53 Ga0070673_100025349 3300005364 Bacteria 4363
54 Ga0070673_100051074 3300005364 Bacteria 3236
55 Ga0070688_100016837 3300005365 Bacteria 4185
56 Ga0070688_100028855 3300005365 Bacteria 3317
57 Ga0070659_100002686 3300005366 Bacteria 12644
58 Ga0070659_100075558 3300005366 Bacteria 2685
59 Ga0070667_100028698 3300005367 Bacteria 4633
60 Ga0070703_10005908 3300005406 Bacteria 3428
61 Ga0070703_10015649 3300005406 Bacteria 2172
62 Ga0070709_10010521 3300005434 Bacteria 5127
63 Ga0070714_100114587 3300005435 Bacteria 2391
64 Ga0070714_100336477 3300005435 Bacteria 1415
65 Ga0070713_100062027 3300005436 Bacteria 3130
66 Ga0070713_100150387 3300005436 Bacteria 2070
67 Ga0070701_10021210 3300005438 Bacteria 3097
68 Ga0070701_10031622 3300005438 Bacteria 2627
69 Ga0070705_100020047 3300005440 Bacteria 3531
70 Ga0070700_100009038 3300005441 Bacteria 5458
71 Ga0070700_100063176 3300005441 Bacteria 2341
72 Ga0070694_100097697 3300005444 Bacteria 2072
73 Ga0070708_100000017 3300005445 Bacteria 120364
74 Ga0070708_100020145 3300005445 Bacteria 5618
75 Ga0070708_100048747 3300005445 Bacteria 3746
76 Ga0070678_100123816 3300005456 Bacteria 2043
77 Ga0070678_100255957 3300005456 Bacteria 1470
78 Ga0070678_100262910 3300005456 Bacteria 1452
79 Ga0070662_100003796 3300005457 Bacteria 9448
80 Ga0070662_100122033 3300005457 Bacteria 1998
81 Ga0070662_100129862 3300005457 Bacteria 1941
82 Ga0070681_10016310 3300005458 Bacteria 7413
83 Ga0070681_10017161 3300005458 Bacteria 7238
84 Ga0068867_100007643 3300005459 Bacteria 7647
85 Ga0068867_100008523 3300005459 Bacteria 7237
86 Ga0070685_10058616 3300005466 Bacteria 2245
87 Ga0070706_100052974 3300005467 Bacteria 3744
88 Ga0070706_100063063 3300005467 Bacteria 3425
89 Ga0070706_100067766 3300005467 Bacteria 3301
90 Ga0070707_100054314 3300005468 Bacteria 3840
91 Ga0070698_100000168 3300005471 Bacteria 60404
92 Ga0070698_100026289 3300005471 Bacteria 6059
93 Ga0070699_100019638 3300005518 Bacteria 5822
94 Ga0070699_100021589 3300005518 Bacteria 5552
95 Ga0070684_100125438 3300005535 Bacteria 2312
96 Ga0070684_100138726 3300005535 Bacteria 2198
97 Ga0070684_100156616 3300005535 Bacteria 2066
98 Ga0070697_100065117 3300005536 Bacteria 2978
99 Ga0068853_100170874 3300005539 Bacteria 1967
100 Ga0068853_100203068 3300005539 Bacteria 1804
101 Ga0070672_100030843 3300005543 Bacteria 4031
102 Ga0070672_100081854 3300005543 Bacteria 2589
103 Ga0070672_100087770 3300005543 Bacteria 2503
104 Ga0070672_100149583 3300005543 Bacteria 1931
105 Ga0070672_100236408 3300005543 Bacteria 1536
106 Ga0070695_100087292 3300005545 Bacteria 2075
107 Ga0070693_100054608 3300005547 Bacteria 2298
108 Ga0070665_100017037 3300005548 Bacteria 7286
109 Ga0070665_100106243 3300005548 Bacteria 2810
110 Ga0068855_100273722 3300005563 Bacteria 1877
111 Ga0070664_100004411 3300005564 Bacteria 11301
112 Ga0070664_100010825 3300005564 Bacteria 7398
113 Ga0070664_100024180 3300005564 Bacteria 5023
114 Ga0070664_100049756 3300005564 Bacteria 3544
115 Ga0070664_100076206 3300005564 Bacteria 2881
116 Ga0068857_100000336 3300005577 Bacteria 32404
117 Ga0068856_100047929 3300005614 Bacteria 4209
118 Ga0070702_100073031 3300005615 Bacteria 2031
119 Ga0068852_100025559 3300005616 Bacteria 4786
120 Ga0068852_100042634 3300005616 Bacteria 3842
121 Ga0068859_100020526 3300005617 Bacteria 6629
122 Ga0068859_100025298 3300005617 Bacteria 5955
123 Ga0068859_100047390 3300005617 Bacteria 4318
124 Ga0068859_100242003 3300005617 Bacteria 1894
125 Ga0068864_100014517 3300005618 Bacteria 6543
126 Ga0068864_100021081 3300005618 Bacteria 5457
127 Ga0068864_100073386 3300005618 Bacteria 2983
128 Ga0068864_100128862 3300005618 Bacteria 2270
129 Ga0068864_100350027 3300005618 Bacteria 1393
130 Ga0068861_100007878 3300005719 Bacteria 7330
131 Ga0068851_10035055 3300005834 Bacteria 2507
132 Ga0068870_10035738 3300005840 Bacteria 2552
133 Ga0068863_100277350 3300005841 Bacteria 1623
134 Ga0068858_100009429 3300005842 Bacteria 9311
135 Ga0068858_100012070 3300005842 Bacteria 8141
136 Ga0068858_100023744 3300005842 Bacteria 5712
137 Ga0068858_100057815 3300005842 Bacteria 3584
138 Ga0068858_100082523 3300005842 Bacteria 2988
139 Ga0068858_100117225 3300005842 Bacteria 2489
140 Ga0068860_100110120 3300005843 Bacteria 2632
141 Ga0068860_100166837 3300005843 Bacteria 2126
142 Ga0068862_100009241 3300005844 Bacteria 8162
143 Ga0068862_100020744 3300005844 Bacteria 5489
144 Ga0081538_10012010 3300005981 Bacteria 6977
145 Ga0081539_10030359 3300005985 Bacteria 3356
146 Ga0075432_10006944 3300006058 Bacteria 3855
147 Ga0097621_100004007 3300006237 Bacteria 10210
148 Ga0068871_100026086 3300006358 Bacteria 4555
149 Ga0068871_100028055 3300006358 Bacteria 4409
150 Ga0068871_100054379 3300006358 Bacteria 3248
151 Ga0075428_100015205 3300006844 Bacteria 8538
152 Ga0075428_100021774 3300006844 Bacteria 7097
153 Ga0075428_100255446 3300006844 Bacteria 1888
154 Ga0075428_100310677 3300006844 Bacteria 1694
155 Ga0075430_100000640 3300006846 Bacteria 26659
156 Ga0075431_100005637 3300006847 Bacteria 12370
157 Ga0075431_100150611 3300006847 Bacteria 2395
158 Ga0075433_10000988 3300006852 Bacteria 20202
159 Ga0075429_100000690 3300006880 Bacteria 26282
160 Ga0075429_100040029 3300006880 Bacteria 4079
161 Ga0068865_100050368 3300006881 Bacteria 2876
162 Ga0097620_100020525 3300006931 Bacteria 6629
163 Ga0097620_100025297 3300006931 Bacteria 5955
164 Ga0097620_100026969 3300006931 Bacteria 5763
165 Ga0097620_100047390 3300006931 Bacteria 4318
166 Ga0097620_100242015 3300006931 Bacteria 1894
167 Ga0075435_100098435 3300007076 Bacteria 2421
168 Ga0075435_100195070 3300007076 Bacteria 1715
169 Ga0075435_100254714 3300007076 Bacteria 1495
170 Ga0105240_10007297 3300009093 Bacteria 16092
171 Ga0105240_10352865 3300009093 Bacteria 1668
172 Ga0111539_10005417 3300009094 Bacteria 16510
173 Ga0111539_10010016 3300009094 Bacteria 11948
174 Ga0111539_10098446 3300009094 Bacteria 3435
175 Ga0105245_10012472 3300009098 Bacteria 7395
176 Ga0105245_10013041 3300009098 Bacteria 7241
177 Ga0105245_10348532 3300009098 Bacteria 1466
178 Ga0105247_10055292 3300009101 Bacteria 2450
179 Ga0114129_10026482 3300009147 Bacteria 8211
180 Ga0114129_10032421 3300009147 Bacteria 7384
181 Ga0105243_10012347 3300009148 Bacteria 6458
182 Ga0105243_10212874 3300009148 Bacteria 1703
183 Ga0105242_10006250 3300009176 Bacteria 9174
184 Ga0105242_10063395 3300009176 Bacteria 3044
185 Ga0105248_10002862 3300009177 Bacteria 19149
186 Ga0105248_10053483 3300009177 Bacteria 4530
187 Ga0105248_10144777 3300009177 Bacteria 2681
188 Ga0105238_10002202 3300009551 Bacteria 19675
189 Ga0105238_10051846 3300009551 Bacteria 4125
190 Ga0105249_10004618 3300009553 Bacteria 11897
191 Ga0105249_10393245 3300009553 Bacteria 1415
192 Ga0157373_10015989 3300013100 Bacteria 5478
193 Ga0157373_10086985 3300013100 Bacteria 2202
194 Ga0157373_10198044 3300013100 Bacteria 1416
195 Ga0157371_10013910 3300013102 Bacteria 6095
196 Ga0157371_10027234 3300013102 Bacteria 4147
197 Ga0157370_10079183 3300013104 Bacteria 3095
198 Ga0157369_10173534 3300013105 Bacteria 2271
199 Ga0157369_10221767 3300013105 Bacteria 1979
200 Ga0157369_10238828 3300013105 Bacteria 1898
201 Ga0157369_10320146 3300013105 Bacteria 1612
202 Ga0157374_10055250 3300013296 Bacteria 3705
203 Ga0163162_10018182 3300013306 Bacteria 6883
204 Ga0163162_10028288 3300013306 Bacteria 5546
205 Ga0163162_10138139 3300013306 Bacteria 2548
206 Ga0157372_10008215 3300013307 Bacteria 11092
207 Ga0157372_10049565 3300013307 Bacteria 4670
208 Ga0157372_10189921 3300013307 Bacteria 2379
209 Ga0157375_10035409 3300013308 Bacteria 4765
210 Ga0157375_10344224 3300013308 Bacteria 1656
211 Ga0163163_10016391 3300014325 Bacteria 6885
212 Ga0163163_10045194 3300014325 Bacteria 4322
213 Ga0163163_10300116 3300014325 Bacteria 1659
214 Ga0157380_10303480 3300014326 Bacteria 1472
215 Ga0157377_10033719 3300014745 Bacteria 2796
216 Ga0157379_10022990 3300014968 Bacteria 5526
217 Ga0157379_10076434 3300014968 Bacteria 2998
218 Ga0157376_10043507 3300014969 Bacteria 3686
219 Ga0157376_10107597 3300014969 Bacteria 2448
220 Ga0157376_10128715 3300014969 Bacteria 2256
221 Ga0163161_10014504 3300017792 Bacteria 5487
222 Ga0206354_10570334 3300020081 Bacteria 1884
223 Ga0224712_10012565 3300022467 Bacteria 2670
224 Ga0207697_10000888 3300025315 Bacteria 16917
225 Ga0207653_10000232 3300025885 Bacteria 36881
226 Ga0207653_10034693 3300025885 Bacteria 1639
227 Ga0207682_10015050 3300025893 Bacteria 3012
228 Ga0207682_10028522 3300025893 Bacteria 2228
229 Ga0207710_10000169 3300025900 Bacteria 67027
230 Ga0207710_10000240 3300025900 Bacteria 46582
231 Ga0207688_10003266 3300025901 Bacteria 8859
232 Ga0207688_10088701 3300025901 Bacteria 1774
233 Ga0207688_10105503 3300025901 Bacteria 1631
234 Ga0207688_10165576 3300025901 Bacteria 1312
235 Ga0207680_10065952 3300025903 Bacteria 2224
236 Ga0207699_10019898 3300025906 Bacteria 3589
237 Ga0207699_10065732 3300025906 Bacteria 2200
238 Ga0207645_10002968 3300025907 Bacteria 13108
239 Ga0207645_10036777 3300025907 Bacteria 3144
240 Ga0207645_10054593 3300025907 Bacteria 2552
241 Ga0207643_10002278 3300025908 Bacteria 10456
242 Ga0207643_10021465 3300025908 Bacteria 3548
243 Ga0207643_10069922 3300025908 Bacteria 2019
244 Ga0207643_10108694 3300025908 Bacteria 1632
245 Ga0207705_10108442 3300025909 Bacteria 2049
246 Ga0207684_10047985 3300025910 Bacteria 3622
247 Ga0207684_10127041 3300025910 Bacteria 2188
248 Ga0207654_10180325 3300025911 Bacteria 1377
249 Ga0207707_10054460 3300025912 Bacteria 3482
250 Ga0207707_10211814 3300025912 Bacteria 1688
251 Ga0207707_10253761 3300025912 Bacteria 1527
252 Ga0207695_10005313 3300025913 Bacteria 17157
253 Ga0207695_10027259 3300025913 Bacteria 6364
254 Ga0207660_10019443 3300025917 Bacteria 4541
255 Ga0207662_10000093 3300025918 Bacteria 42424
256 Ga0207662_10027463 3300025918 Bacteria 3284
257 Ga0207649_10047455 3300025920 Bacteria 2643
258 Ga0207649_10161527 3300025920 Bacteria 1553
259 Ga0207652_10054856 3300025921 Bacteria 3427
260 Ga0207652_10334555 3300025921 Bacteria 1367
261 Ga0207681_10013430 3300025923 Bacteria 5068
262 Ga0207681_10016150 3300025923 Bacteria 4664
263 Ga0207681_10113723 3300025923 Bacteria 1973
264 Ga0207694_10029300 3300025924 Bacteria 4201
265 Ga0207650_10097086 3300025925 Bacteria 2261
266 Ga0207659_10007647 3300025926 Bacteria 6667
267 Ga0207659_10015804 3300025926 Bacteria 4902
268 Ga0207659_10052484 3300025926 Bacteria 2905
269 Ga0207659_10059047 3300025926 Bacteria 2756
270 Ga0207659_10098571 3300025926 Bacteria 2198
271 Ga0207659_10163616 3300025926 Bacteria 1749
272 Ga0207687_10005579 3300025927 Bacteria 8314
273 Ga0207687_10055444 3300025927 Bacteria 2777
274 Ga0207700_10091528 3300025928 Bacteria 2402
275 Ga0207644_10002487 3300025931 Bacteria 11862
276 Ga0207644_10026897 3300025931 Bacteria 3971
277 Ga0207644_10060706 3300025931 Bacteria 2736
278 Ga0207644_10156976 3300025931 Bacteria 1765
279 Ga0207644_10183305 3300025931 Bacteria 1642
280 Ga0207690_10071328 3300025932 Bacteria 2395
281 Ga0207706_10013624 3300025933 Bacteria 7385
282 Ga0207706_10055477 3300025933 Bacteria 3494
283 Ga0207709_10036840 3300025935 Bacteria 2902
284 Ga0207670_10223618 3300025936 Bacteria 1442
285 Ga0207669_10011684 3300025937 Bacteria 4284
286 Ga0207665_10014897 3300025939 Bacteria 5110
287 Ga0207691_10007393 3300025940 Bacteria 10584
288 Ga0207691_10008941 3300025940 Bacteria 9612
289 Ga0207691_10029343 3300025940 Bacteria 5146
290 Ga0207691_10034918 3300025940 Bacteria 4672
291 Ga0207691_10063154 3300025940 Bacteria 3359
292 Ga0207691_10078597 3300025940 Bacteria 2970
293 Ga0207691_10127674 3300025940 Bacteria 2248
294 Ga0207691_10130704 3300025940 Bacteria 2218
295 Ga0207711_10005741 3300025941 Bacteria 10471
296 Ga0207689_10001118 3300025942 Bacteria 25875
297 Ga0207689_10037342 3300025942 Bacteria 4029
298 Ga0207689_10086614 3300025942 Bacteria 2574
299 Ga0207661_10011998 3300025944 Bacteria 6295
300 Ga0207661_10020520 3300025944 Bacteria 4940
301 Ga0207661_10052732 3300025944 Bacteria 3251
302 Ga0207679_10003787 3300025945 Bacteria 9372
303 Ga0207679_10007120 3300025945 Bacteria 7087
304 Ga0207679_10155404 3300025945 Bacteria 1867
305 Ga0207679_10165486 3300025945 Bacteria 1815
306 Ga0207651_10034763 3300025960 Bacteria 3268
307 Ga0207651_10072561 3300025960 Bacteria 2444
308 Ga0207651_10137966 3300025960 Bacteria 1879
309 Ga0207651_10170625 3300025960 Bacteria 1715
310 Ga0207712_10002740 3300025961 Bacteria 11263
311 Ga0207712_10018843 3300025961 Bacteria 4500
312 Ga0207712_10117629 3300025961 Bacteria 2005
313 Ga0207668_10015536 3300025972 Bacteria 4732
314 Ga0207668_10048615 3300025972 Bacteria 2912
315 Ga0207668_10098698 3300025972 Bacteria 2165
316 Ga0207677_10156660 3300026023 Bacteria 1764
317 Ga0207677_10173511 3300026023 Bacteria 1689
318 Ga0207703_10000021 3300026035 Bacteria 247414
319 Ga0207703_10002358 3300026035 Bacteria 16441
320 Ga0207703_10037160 3300026035 Bacteria 3879
321 Ga0207703_10037808 3300026035 Bacteria 3847
322 Ga0207703_10082384 3300026035 Bacteria 2685
323 Ga0207703_10097096 3300026035 Bacteria 2489
324 Ga0207678_10013021 3300026067 Bacteria 7299
325 Ga0207708_10020321 3300026075 Bacteria 5009
326 Ga0207708_10056682 3300026075 Bacteria 2989
327 Ga0207702_10146372 3300026078 Bacteria 2144
328 Ga0207702_10237676 3300026078 Bacteria 1705
329 Ga0207641_10027791 3300026088 Bacteria 4672
330 Ga0207648_10016596 3300026089 Bacteria 6722
331 Ga0207648_10314604 3300026089 Bacteria 1406
332 Ga0207676_10003054 3300026095 Bacteria 11946
333 Ga0207676_10132571 3300026095 Bacteria 2121
334 Ga0207674_10000120 3300026116 Bacteria 91883
335 Ga0207674_10000797 3300026116 Bacteria 41036
336 Ga0207674_10045892 3300026116 Bacteria 4491
337 Ga0207675_100019214 3300026118 Bacteria 6376
338 Ga0207675_100052052 3300026118 Bacteria 3821
339 Ga0207675_100060110 3300026118 Bacteria 3547
340 Ga0207683_10013664 3300026121 Bacteria 6924
341 Ga0207698_10017837 3300026142 Bacteria 4824
342 Ga0207698_10031178 3300026142 Bacteria 3845
343 Ga0207698_10055330 3300026142 Bacteria 3057
344 Ga0209998_10035359 3300027717 Bacteria 1120
345 Ga0207428_10015574 3300027907 Bacteria 6572
346 Ga0207428_10038936 3300027907 Bacteria 3862
347 Ga0207428_10043242 3300027907 Bacteria 3640
348 Ga0268266_10090285 3300028379 Bacteria 2685
349 Ga0268265_10017826 3300028380 Bacteria 4909
350 Ga0268265_10026144 3300028380 Bacteria 4150
351 Ga0268265_10217470 3300028380 Bacteria 1669
352 Ga0268264_10073865 3300028381 Bacteria 2895
353 Ga0268264_10102017 3300028381 Bacteria 2496
354 Ga0265326_10000640 3300028558 Bacteria 13045
355 Ga0265322_10004120 3300028654 Bacteria 4345
356 Ga0265338_10017163 3300028800 Bacteria 7820
357 Ga0265338_10071457 3300028800 Bacteria 2968
358 Ga0265338_10100235 3300028800 Bacteria 2363
359 Ga0265325_10053067 3300031241 Bacteria 2079
360 Ga0265340_10000128 3300031247 Bacteria 37953
361 Ga0265340_10034524 3300031247 Bacteria 2515
362 Ga0265316_10000452 3300031344 Bacteria 46569
363 Ga0307408_100001367 3300031548 Bacteria 18196
364 Ga0307408_100100336 3300031548 Bacteria 2204
365 Ga0265313_10053060 3300031595 Bacteria 1931
366 Ga0316577_10005606 3300031733 Bacteria 6594
367 Ga0307413_10036007 3300031824 Bacteria 2845
368 Ga0307410_10037541 3300031852 Bacteria 3165
369 Ga0307410_10175200 3300031852 Bacteria 1620
370 Ga0307406_10001212 3300031901 Bacteria 14432
371 Ga0307407_10033799 3300031903 Bacteria 2793
372 Ga0307416_100289341 3300032002 Bacteria 1621
373 Ga0307414_10017549 3300032004 Bacteria 4382
374 Ga0373934_0020488 3300035086 Bacteria 2540
375 Ga0373940_0026331 3300035088 Bacteria 1521
376 Ga0373943_0108623 3300035170 Bacteria 1460
377 Ga0373955_0024884 3300035172 Bacteria 3067
378 Ga0373961_0051006 3300035241 Bacteria 1227
379 Ga0373931_0006624 3300035691 Bacteria 5423
380 Ga0373935_0050660 3300035692 Bacteria 2636
381 Ga0373947_0077253 3300035725 Bacteria 2053
382 Ga0373937_0066833 3300036401 Bacteria 3312
383 Ga0316584_0014240 3300036712 Bacteria 5657
384 Ga0436365_1011791 3300039437 Bacteria 4329
385 Ga0436363_0937212 3300039450 Bacteria 3783
386 Ga0436363_1538494 3300039450 Bacteria 7618
387 Ga0466961_0176307 3300044693 Bacteria 1328
388 Ga0466963_0001713 3300044694 Bacteria 11937
389 Ga0466963_0035923 3300044694 Bacteria 3229
390 Ga0453684_0053833 3300044712 Bacteria 5249
391 Ga0466971_0060616 3300044719 Bacteria 1710
392 Ga0466968_0084071 3300044735 Bacteria 1403
393 Ga0466970_0029807 3300044765 Bacteria 2876
394 Ga0466970_0030497 3300044765 Bacteria 2843
395 Ga0466957_0044184 3300044842 Bacteria 2700
396 Ga0451576_0049866 3300045051 Bacteria 4393
397 Ga0466967_0009760 3300045976 Bacteria 7153
398 Ga0466967_0046195 3300045976 Bacteria 3789
399 Ga0495603_0142318 3300046455 Bacteria 1395
400 Ga0495580_0030568 3300046472 Bacteria 3899
401 Ga0495594_0015629 3300046499 Bacteria 3989
402 Ga0495594_0026132 3300046499 Bacteria 3139
403 Ga0495594_0031765 3300046499 Bacteria 2864
404 Ga0495630_0041486 3300046517 Bacteria 3437
405 Ga0495665_0059564 3300046531 Bacteria 2015
406 Ga0495586_0052006 3300046535 Bacteria 2217
407 Ga0495587_0110271 3300046536 Bacteria 1581
408 Ga0495645_0161419 3300046543 Bacteria 1549
409 Ga0495581_0073020 3300047315 Bacteria 1985
410 Ga0495604_0188938 3300047317 Bacteria 1437
411 Ga0495674_0028657 3300047319 Bacteria 5073
412 Ga0495684_0162084 3300047471 Bacteria 1667
413 Ga0496102_0000233 3300048905 Bacteria 72853
414 Ga0496102_0278842 3300048905 Bacteria 1576
415 Ga0496102_0399578 3300048905 Bacteria 1292
416 Ga0496104_0258313 3300048907 Bacteria 1655
417 Ga0496107_0061968 3300048910 Bacteria 2709
418 Ga0496108_0123809 3300048911 Bacteria 2219
419 Ga0496109_0007437 3300048912 Bacteria 9273
420 Ga0496109_0030202 3300048912 Bacteria 4858
421 Ga0496110_0266972 3300048913 Bacteria 1558
422 Ga0496112_0000747 3300048915 Bacteria 22703
423 Ga0496119_0000061 3300048922 Bacteria 171442
424 Ga0496119_0000337 3300048922 Bacteria 65601
425 Ga0496119_0124998 3300048922 Bacteria 1408
426 Ga0496120_0000250 3300048923 Bacteria 90632
427 Ga0496120_0005861 3300048923 Bacteria 9604
428 Ga0496121_0008340 3300048924 Bacteria 12236
429 Ga0501038_0005600 3300049574 Bacteria 11655
430 Ga0501046_0124458 3300049580 Bacteria 1960
431 Ga0501047_0002075 3300049581 Bacteria 19175
432 Ga0501047_0115619 3300049581 Bacteria 2565
433 Ga0501070_0001997 3300049586 Bacteria 17938
434 Ga0501080_0044442 3300049742 Bacteria 4135
435 Ga0501080_0147093 3300049742 Bacteria 2178
436 Ga0501035_0002685 3300049822 Bacteria 17310
437 Ga0501044_0007384 3300049823 Bacteria 12088
438 Ga0501044_0019672 3300049823 Bacteria 7216
439 nmdc:mga05p37_208034_c1 3300050507 Bacteria 2366
440 nmdc:mga09592_19728_c1 3300050508 Bacteria 5537
441 nmdc:mga0qj67_23144_c1 3300050509 Bacteria 4776
442 nmdc:mga0qj67_2760_c1 3300050509 Bacteria 12598
443 nmdc:mga06r32_469674_c1 3300050510 Bacteria 1236
444 nmdc:mga08y16_115568_c1 3300050511 Bacteria 2794
445 nmdc:mga08y16_222722_c1 3300050511 Bacteria 1952
446 nmdc:mga08y16_253560_c1 3300050511 Bacteria 1818
447 nmdc:mga08y16_76812_c1 3300050511 Bacteria 3481
448 nmdc:mga08y16_82366_c1 3300050511 Bacteria 3354
449 nmdc:mga0n895_104938_c1 3300050512 Bacteria 2838
450 nmdc:mga0n895_11723_c1 3300050512 Bacteria 7835
451 nmdc:mga0rr50_21975_c1 3300050513 Bacteria 4368
452 nmdc:mga0rr50_31560_c1 3300050513 Bacteria 3764
453 nmdc:mga0rr50_44751_c1 3300050513 Bacteria 3249
454 nmdc:mga0rr50_57596_c1 3300050513 Bacteria 2907
455 nmdc:mga08x19_84681_c1 3300050514 Bacteria 2086
456 nmdc:mga0a205_1673_c1 3300050515 Bacteria 19113
457 nmdc:mga0a205_2027_c1 3300050515 Bacteria 17695
458 Ga0530510_0032445 3300061734 Bacteria 3758
459 2912728626 2912723979 Bacteria 8557534
460 nmdc:mga0n895_322902_c1
461 JGI25406J46586_10001618
462 Ga0065715_10106694
463 Ga0070658_10275449
464 Ga0070683_100014907
465 Ga0070683_100018738
466 Ga0070683_100025613
467 Ga0070683_100025662
468 Ga0070683_100115872
469 Ga0070690_100011175
470 Ga0070690_100011241
471 Ga0070670_100012556
472 Ga0070670_100014168
473 Ga0070670_100035274
474 Ga0070670_100087549
475 Ga0070670_100147823
476 Ga0068869_100006545
477 Ga0068869_100013006
478 Ga0068869_100082231
479 Ga0070666_10056583
480 Ga0070680_100061661
481 Ga0070682_100025420
482 Ga0068868_100036061
483 Ga0068868_100079575
484 Ga0068868_100166246
485 Ga0070660_100069985
486 Ga0070689_100009808
487 Ga0070689_100112294
488 Ga0070689_100148826
489 Ga0070687_100073026
490 Ga0070661_100024327
491 Ga0070661_100028407
492 Ga0070661_100086562
493 Ga0070668_100015497
494 Ga0070668_100015689
495 Ga0070668_100067192
496 Ga0070669_100019213
497 Ga0070675_100006193
498 Ga0070675_100006859
499 Ga0070675_100031243
500 Ga0070675_100120707
501 Ga0070675_100167610
502 Ga0070675_100179610
503 Ga0070675_100261914
504 Ga0070671_100014530
505 Ga0070671_100016715
506 Ga0070671_100042030
507 Ga0070671_100088902
508 Ga0070671_100147096
509 Ga0070674_100019498
510 Ga0070674_100096477
511 Ga0070674_100108159
512 Ga0070673_100025349
513 Ga0070673_100051074
514 Ga0070688_100016837
515 Ga0070688_100028855
516 Ga0070659_100002686
517 Ga0070659_100075558
518 Ga0070667_100028698
519 Ga0070703_10005908
520 Ga0070703_10015649
521 Ga0070709_10010521
522 Ga0070714_100114587
523 Ga0070714_100336477
524 Ga0070713_100062027
525 Ga0070713_100150387
526 Ga0070701_10021210
527 Ga0070701_10031622
528 Ga0070705_100020047
529 Ga0070700_100009038
530 Ga0070700_100063176
531 Ga0070694_100097697
532 Ga0070708_100000017
533 Ga0070708_100020145
534 Ga0070708_100048747
535 Ga0070678_100123816
536 Ga0070678_100255957
537 Ga0070678_100262910
538 Ga0070662_100003796
539 Ga0070662_100122033
540 Ga0070662_100129862
541 Ga0070681_10016310
542 Ga0070681_10017161
543 Ga0068867_100007643
544 Ga0068867_100008523
545 Ga0070685_10058616
546 Ga0070706_100052974
547 Ga0070706_100063063
548 Ga0070706_100067766
549 Ga0070707_100054314
550 Ga0070698_100000168
551 Ga0070698_100026289
552 Ga0070699_100019638
553 Ga0070699_100021589
554 Ga0070684_100125438
555 Ga0070684_100138726
556 Ga0070684_100156616
557 Ga0070697_100065117
558 Ga0068853_100170874
559 Ga0068853_100203068
560 Ga0070672_100030843
561 Ga0070672_100081854
562 Ga0070672_100087770
563 Ga0070672_100149583
564 Ga0070672_100236408
565 Ga0070695_100087292
566 Ga0070693_100054608
567 Ga0070665_100017037
568 Ga0070665_100106243
569 Ga0068855_100273722
570 Ga0070664_100004411
571 Ga0070664_100010825
572 Ga0070664_100024180
573 Ga0070664_100049756
574 Ga0070664_100076206
575 Ga0068857_100000336
576 Ga0068856_100047929
577 Ga0070702_100073031
578 Ga0068852_100025559
579 Ga0068852_100042634
580 Ga0068859_100020526
581 Ga0068859_100025298
582 Ga0068859_100047390
583 Ga0068859_100242003
584 Ga0068864_100014517
585 Ga0068864_100021081
586 Ga0068864_100073386
587 Ga0068864_100128862
588 Ga0068864_100350027
589 Ga0068861_100007878
590 Ga0068851_10035055
591 Ga0068870_10035738
592 Ga0068863_100277350
593 Ga0068858_100009429
594 Ga0068858_100012070
595 Ga0068858_100023744
596 Ga0068858_100057815
597 Ga0068858_100082523
598 Ga0068858_100117225
599 Ga0068860_100110120
600 Ga0068860_100166837
601 Ga0068862_100009241
602 Ga0068862_100020744
603 Ga0081538_10012010
604 Ga0081539_10030359
605 Ga0075432_10006944
606 Ga0097621_100004007
607 Ga0068871_100026086
608 Ga0068871_100028055
609 Ga0068871_100054379
610 Ga0075428_100015205
611 Ga0075428_100021774
612 Ga0075428_100255446
613 Ga0075428_100310677
614 Ga0075430_100000640
615 Ga0075431_100005637
616 Ga0075431_100150611
617 Ga0075433_10000988
618 Ga0075429_100000690
619 Ga0075429_100040029
620 Ga0068865_100050368
621 Ga0097620_100020525
622 Ga0097620_100025297
623 Ga0097620_100026969
624 Ga0097620_100047390
625 Ga0097620_100242015
626 Ga0075435_100098435
627 Ga0075435_100195070
628 Ga0075435_100254714
629 Ga0105240_10007297
630 Ga0105240_10352865
631 Ga0111539_10005417
632 Ga0111539_10010016
633 Ga0111539_10098446
634 Ga0105245_10012472
635 Ga0105245_10013041
636 Ga0105245_10348532
637 Ga0105247_10055292
638 Ga0114129_10026482
639 Ga0114129_10032421
640 Ga0105243_10012347
641 Ga0105243_10212874
642 Ga0105242_10006250
643 Ga0105242_10063395
644 Ga0105248_10002862
645 Ga0105248_10053483
646 Ga0105248_10144777
647 Ga0105238_10002202
648 Ga0105238_10051846
649 Ga0105249_10004618
650 Ga0105249_10393245
651 Ga0157373_10015989
652 Ga0157373_10086985
653 Ga0157373_10198044
654 Ga0157371_10013910
655 Ga0157371_10027234
656 Ga0157370_10079183
657 Ga0157369_10173534
658 Ga0157369_10221767
659 Ga0157369_10238828
660 Ga0157369_10320146
661 Ga0157374_10055250
662 Ga0163162_10018182
663 Ga0163162_10028288
664 Ga0163162_10138139
665 Ga0157372_10008215
666 Ga0157372_10049565
667 Ga0157372_10189921
668 Ga0157375_10035409
669 Ga0157375_10344224
670 Ga0163163_10016391
671 Ga0163163_10045194
672 Ga0163163_10300116
673 Ga0157380_10303480
674 Ga0157377_10033719
675 Ga0157379_10022990
676 Ga0157379_10076434
677 Ga0157376_10043507
678 Ga0157376_10107597
679 Ga0157376_10128715
680 Ga0163161_10014504
681 Ga0206354_10570334
682 Ga0224712_10012565
683 Ga0207697_10000888
684 Ga0207653_10000232
685 Ga0207653_10034693
686 Ga0207682_10015050
687 Ga0207682_10028522
688 Ga0207710_10000169
689 Ga0207710_10000240
690 Ga0207688_10003266
691 Ga0207688_10088701
692 Ga0207688_10105503
693 Ga0207688_10165576
694 Ga0207680_10065952
695 Ga0207699_10019898
696 Ga0207699_10065732
697 Ga0207645_10002968
698 Ga0207645_10036777
699 Ga0207645_10054593
700 Ga0207643_10002278
701 Ga0207643_10021465
702 Ga0207643_10069922
703 Ga0207643_10108694
704 Ga0207705_10108442
705 Ga0207684_10047985
706 Ga0207684_10127041
707 Ga0207654_10180325
708 Ga0207707_10054460
709 Ga0207707_10211814
710 Ga0207707_10253761
711 Ga0207695_10005313
712 Ga0207695_10027259
713 Ga0207660_10019443
714 Ga0207662_10000093
715 Ga0207662_10027463
716 Ga0207649_10047455
717 Ga0207649_10161527
718 Ga0207652_10054856
719 Ga0207652_10334555
720 Ga0207681_10013430
721 Ga0207681_10016150
722 Ga0207681_10113723
723 Ga0207694_10029300
724 Ga0207650_10097086
725 Ga0207659_10007647
726 Ga0207659_10015804
727 Ga0207659_10052484
728 Ga0207659_10059047
729 Ga0207659_10098571
730 Ga0207659_10163616
731 Ga0207687_10005579
732 Ga0207687_10055444
733 Ga0207700_10091528
734 Ga0207644_10002487
735 Ga0207644_10026897
736 Ga0207644_10060706
737 Ga0207644_10156976
738 Ga0207644_10183305
739 Ga0207690_10071328
740 Ga0207706_10013624
741 Ga0207706_10055477
742 Ga0207709_10036840
743 Ga0207670_10223618
744 Ga0207669_10011684
745 Ga0207665_10014897
746 Ga0207691_10007393
747 Ga0207691_10008941
748 Ga0207691_10029343
749 Ga0207691_10034918
750 Ga0207691_10063154
751 Ga0207691_10078597
752 Ga0207691_10127674
753 Ga0207691_10130704
754 Ga0207711_10005741
755 Ga0207689_10001118
756 Ga0207689_10037342
757 Ga0207689_10086614
758 Ga0207661_10011998
759 Ga0207661_10020520
760 Ga0207661_10052732
761 Ga0207679_10003787
762 Ga0207679_10007120
763 Ga0207679_10155404
764 Ga0207679_10165486
765 Ga0207651_10034763
766 Ga0207651_10072561
767 Ga0207651_10137966
768 Ga0207651_10170625
769 Ga0207712_10002740
770 Ga0207712_10018843
771 Ga0207712_10117629
772 Ga0207668_10015536
773 Ga0207668_10048615
774 Ga0207668_10098698
775 Ga0207677_10156660
776 Ga0207677_10173511
777 Ga0207703_10000021
778 Ga0207703_10002358
779 Ga0207703_10037160
780 Ga0207703_10037808
781 Ga0207703_10082384
782 Ga0207703_10097096
783 Ga0207678_10013021
784 Ga0207708_10020321
785 Ga0207708_10056682
786 Ga0207702_10146372
787 Ga0207702_10237676
788 Ga0207641_10027791
789 Ga0207648_10016596
790 Ga0207648_10314604
791 Ga0207676_10003054
792 Ga0207676_10132571
793 Ga0207674_10000120
794 Ga0207674_10000797
795 Ga0207674_10045892
796 Ga0207675_100019214
797 Ga0207675_100052052
798 Ga0207675_100060110
799 Ga0207683_10013664
800 Ga0207698_10017837
801 Ga0207698_10031178
802 Ga0207698_10055330
803 Ga0209998_10035359
804 Ga0207428_10015574
805 Ga0207428_10038936
806 Ga0207428_10043242
807 Ga0268266_10090285
808 Ga0268265_10017826
809 Ga0268265_10026144
810 Ga0268265_10217470
811 Ga0268264_10073865
812 Ga0268264_10102017
813 Ga0265326_10000640
814 Ga0265322_10004120
815 Ga0265338_10017163
816 Ga0265338_10071457
817 Ga0265338_10100235
818 Ga0265325_10053067
819 Ga0265340_10000128
820 Ga0265340_10034524
821 Ga0265316_10000452
822 Ga0307408_100001367
823 Ga0307408_100100336
824 Ga0265313_10053060
825 Ga0316577_10005606
826 Ga0307413_10036007
827 Ga0307410_10037541
828 Ga0307410_10175200
829 Ga0307406_10001212
830 Ga0307407_10033799
831 Ga0307416_100289341
832 Ga0307414_10017549
833 Ga0373934_0020488
834 Ga0373940_0026331
835 Ga0373943_0108623
836 Ga0373955_0024884
837 Ga0373961_0051006
838 Ga0373931_0006624
839 Ga0373935_0050660
840 Ga0373947_0077253
841 Ga0373937_0066833
842 Ga0316584_0014240
843 Ga0436365_1011791
844 Ga0436363_0937212
845 Ga0436363_1538494
846 Ga0466961_0176307
847 Ga0466963_0001713
848 Ga0466963_0035923
849 Ga0453684_0053833
850 Ga0466971_0060616
851 Ga0466968_0084071
852 Ga0466970_0029807
853 Ga0466970_0030497
854 Ga0466957_0044184
855 Ga0451576_0049866
856 Ga0466967_0009760
857 Ga0466967_0046195
858 Ga0495603_0142318
859 Ga0495580_0030568
860 Ga0495594_0015629
861 Ga0495594_0026132
862 Ga0495594_0031765
863 Ga0495630_0041486
864 Ga0495665_0059564
865 Ga0495586_0052006
866 Ga0495587_0110271
867 Ga0495645_0161419
868 Ga0495581_0073020
869 Ga0495604_0188938
870 Ga0495674_0028657
871 Ga0495684_0162084
872 Ga0496102_0000233
873 Ga0496102_0278842
874 Ga0496102_0399578
875 Ga0496104_0258313
876 Ga0496107_0061968
877 Ga0496108_0123809
878 Ga0496109_0007437
879 Ga0496109_0030202
880 Ga0496110_0266972
881 Ga0496112_0000747
882 Ga0496119_0000061
883 Ga0496119_0000337
884 Ga0496119_0124998
885 Ga0496120_0000250
886 Ga0496120_0005861
887 Ga0496121_0008340
888 Ga0501038_0005600
889 Ga0501046_0124458
890 Ga0501047_0002075
891 Ga0501047_0115619
892 Ga0501070_0001997
893 Ga0501080_0044442
894 Ga0501080_0147093
895 Ga0501035_0002685
896 Ga0501044_0007384
897 Ga0501044_0019672
898 nmdc:mga05p37_208034_c1
899 nmdc:mga09592_19728_c1
900 nmdc:mga0qj67_23144_c1
901 nmdc:mga0qj67_2760_c1
902 nmdc:mga06r32_469674_c1
903 nmdc:mga08y16_115568_c1
904 nmdc:mga08y16_222722_c1
905 nmdc:mga08y16_253560_c1
906 nmdc:mga08y16_76812_c1
907 nmdc:mga08y16_82366_c1
908 nmdc:mga0n895_104938_c1
909 nmdc:mga0n895_11723_c1
910 nmdc:mga0rr50_21975_c1
911 nmdc:mga0rr50_31560_c1
912 nmdc:mga0rr50_44751_c1
913 nmdc:mga0rr50_57596_c1
914 nmdc:mga08x19_84681_c1
915 nmdc:mga0a205_1673_c1
916 nmdc:mga0a205_2027_c1
917 Ga0530510_0032445
918 2912728626

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

78

346

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1bxc-assembly1.cif.gz_A xylose isomerase from thermus caldophilus 0.9608 3 367
1bxb-assembly1.cif.gz_D xylose isomerase from thermus thermophilus 0.9584 3 367
1oad-assembly1.cif.gz_A glucose isomerase from streptomyces rubiginosus in p21212 crystal form 0.9536 2 367
1clk-assembly1.cif.gz_A crystal structure of streptomyces diastaticus no.7 strain m1033 xylose isomerase at 1.9 a resolution with pseudo-i222 space group 0.9527 4 367
1xib-assembly1.cif.gz_A modes of binding substrates and their analogues to the enzyme d-xylose isomerase 0.9522 1 367
ID Description Score Start End Superfamily
1didA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8976 4 367 3.20.20.150
1didA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8857 4 367 3.20.20.150
af_A0A1D6QER4_85_310_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8235 10 224 3.20.20.150
1a0dA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8208 10 367 3.20.20.150
3ktcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8157 5 314 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A402ALT6-F1-model_v4 Xylose isomerase (EC 5.3.1.5) 0.9936 4 134 GO:0005737
GO:0009045
GO:0042732
GO:0046872
AF-A0A6I2ZA47-F1-model_v4 deleted 0.9902 4 91
AF-A0A7K2TNZ7-F1-model_v4 Xylose isomerase (EC 5.3.1.5) 0.9884 4 168 GO:0005737
GO:0009045
GO:0042732
GO:0046872
AF-A0A6B3IQN1-F1-model_v4 Xylose isomerase (EC 5.3.1.5) 0.9873 4 102 GO:0005737
GO:0009045
GO:0042732
GO:0046872
AF-A0A6G3D262-F1-model_v4 Xylose isomerase (EC 5.3.1.5) 0.9862 1 137 GO:0005737
GO:0009045
GO:0042732
GO:0046872

Map