F448429

General Info

Members Datasets Scaffolds Average Seq Length
459 289 918 215

Family's Representative Sequence

Representative Sequence 3300047321|Ga0495676_0198321|Ga0495676_0198321_487_1311
Length 247
Sequence MSDAVVDKDARAKKRKSVSGRNVSVAGKKDPGPIPEPQEPDEFAVQISDQIESFILSVREVAKGDDPDSAVPYLLLEVSQLLLAGGRLGAHEDIVPDERYEPDAGPEPDEDSLRQGLATLLEPIDVYSEVFDPYVPRSTPVACRISDDLADVVVNLSHGLTHFRAGRVSEALWWWQFSYLSSWGLTASASLRALQSLVAHVRQDSPLDELDGLDTGTDEDDEEQLAKEAGRVMEAELGTMGLRRRRQ

Samples

Sample ID Description Type Environment
1 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
13 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
14 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
15 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
16 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
17 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
18 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
19 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
20 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
21 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
22 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
23 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
24 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
25 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
26 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
31 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
32 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
36 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
37 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
38 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
39 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
40 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
41 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
42 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
43 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
44 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
45 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
46 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
47 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
48 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
49 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
50 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
51 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
52 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
53 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
54 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
55 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
56 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
57 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
58 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
59 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
60 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
61 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
62 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
63 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
64 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
65 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
66 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
67 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
68 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
69 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
70 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
76 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
85 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
90 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
91 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
92 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
93 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
94 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
95 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
96 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
97 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
98 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
99 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
100 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
103 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
104 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
107 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
108 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
109 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
110 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
111 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
112 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
116 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
117 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
126 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
127 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
128 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
129 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
130 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
135 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
136 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
137 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
140 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
141 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
145 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
148 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
149 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
150 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
153 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
159 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
160 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
194 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
195 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
196 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
197 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
198 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
199 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
200 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
201 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
202 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
203 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
204 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
205 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
206 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
207 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
208 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
215 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
216 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
217 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
218 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
219 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
220 2643221647 Streptomyces sp. Root369 Isolate Unclassified
221 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
222 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
223 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
224 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
225 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
226 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
227 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
228 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
229 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
230 2808606448 Streptomyces sp. 193411 Isolate Unclassified
231 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
232 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
233 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
234 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
235 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
236 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
237 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
238 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
239 2862574272 Streptomyces sp. AcE210 Isolate Nodule
240 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
241 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
242 2867428634 Streptomyces sp. RP5T Isolate Unclassified
243 2867475112 Streptomyces sp. TM32 Isolate Unclassified
244 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
245 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
246 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
247 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
248 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
249 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
250 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
251 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
252 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
253 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
254 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
255 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
256 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
257 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
258 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
259 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
260 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
261 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
262 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
263 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
264 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
265 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
266 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
267 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
268 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
269 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
270 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
271 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
272 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
273 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
274 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
275 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
276 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
277 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
278 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
279 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
280 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
281 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
282 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
283 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
284 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
285 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
286 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
287 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
288 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
289 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.05
Metatranscriptomes 2.61
Isolates 16.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.88
Nodule 1.09
Rhizoplane 0.65
Rhizosphere 79.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495676_0198321 3300047321 Bacteria 1396
2 JGI24738J21930_10003812 3300002075 Bacteria 3767
3 rootH1_10008485 3300003323 Bacteria 6800
4 JGI25160J50197_1011134 3300003354 Bacteria 3207
5 Ga0006562J51391_1044026 3300003578 Bacteria 4063
6 Ga0006562J51391_1044027 3300003578 Bacteria 2130
7 Ga0006562J51391_1071824 3300003578 Bacteria 8776
8 Ga0006562J51391_1071826 3300003578 Bacteria 10120
9 Ga0068853_100058620 3300005539 Bacteria 3324
10 Ga0070665_100649442 3300005548 Bacteria 1068
11 Ga0070665_101384012 3300005548 Bacteria 713
12 Ga0068856_100786023 3300005614 Bacteria 972
13 Ga0081455_10027683 3300005937 Bacteria 5191
14 Ga0075365_10160405 3300006038 Bacteria 1567
15 Ga0075363_100094056 3300006048 Bacteria 1652
16 Ga0075367_10050867 3300006178 Bacteria 2447
17 Ga0075370_10222493 3300006353 Bacteria 1116
18 Ga0099826_10043053 3300006948 Bacteria 3114
19 Ga0105251_10012110 3300009011 Bacteria 4895
20 Ga0105245_10446804 3300009098 Bacteria 1300
21 Ga0105245_10525163 3300009098 Bacteria 1203
22 Ga0105246_10008072 3300011119 Bacteria 6463
23 Ga0105246_10237212 3300011119 Bacteria 1440
24 Ga0157369_10111068 3300013105 Bacteria 2914
25 Ga0157372_10436114 3300013307 Bacteria 1527
26 Ga0157375_11630916 3300013308 Bacteria 763
27 Ga0157376_10271606 3300014969 Bacteria 1593
28 Ga0182007_10014899 3300015262 Bacteria 2915
29 Ga0182005_1050223 3300015265 Bacteria 1134
30 Ga0183367_1015 3300015688 Bacteria 298435
31 Ga0163161_10386670 3300017792 Bacteria 1119
32 Ga0197907_11301022 3300020069 Bacteria 1883
33 Ga0206356_10031771 3300020070 Bacteria 1754
34 Ga0206354_11406630 3300020081 Bacteria 1059
35 Ga0224712_10057989 3300022467 Bacteria 1532
36 Ga0209758_1016275 3300025297 Bacteria 3787
37 Ga0207426_1013980 3300025302 Bacteria 2956
38 Ga0207426_1021289 3300025302 Bacteria 2242
39 Ga0207687_10335548 3300025927 Bacteria 1228
40 Ga0207709_10334334 3300025935 Bacteria 1138
41 Ga0207639_10005922 3300026041 Bacteria 8288
42 Ga0209371_1004803 3300027312 Bacteria 5680
43 Ga0209282_1220477 3300027666 Bacteria 859
44 Ga0307517_10056954 3300028786 Bacteria 3798
45 Ga0307515_10102750 3300028794 Bacteria 3434
46 Ga0307515_10197482 3300028794 Bacteria 1899
47 Ga0268256_1005827 3300030500 Bacteria 4736
48 Ga0268256_1014863 3300030500 Bacteria 2292
49 Ga0307511_10035903 3300030521 Bacteria 4319
50 Ga0307511_10065427 3300030521 Bacteria 2721
51 Ga0307512_10002830 3300030522 Bacteria 21126
52 Ga0307512_10052075 3300030522 Bacteria 3268
53 Ga0307513_10007509 3300031456 Bacteria 14112
54 Ga0307508_10007129 3300031616 Bacteria 10414
55 Ga0307508_10019628 3300031616 Bacteria 6142
56 Ga0307508_10059555 3300031616 Bacteria 3377
57 Ga0307514_10028678 3300031649 Bacteria 4488
58 Ga0307514_10077022 3300031649 Bacteria 2481
59 Ga0307514_10105256 3300031649 Bacteria 2016
60 Ga0307514_10109316 3300031649 Bacteria 1963
61 Ga0307516_10049986 3300031730 Bacteria 4104
62 Ga0307516_10120094 3300031730 Bacteria 2420
63 Ga0307516_10146875 3300031730 Bacteria 2123
64 Ga0307416_100849455 3300032002 Bacteria 1011
65 Ga0307510_10005336 3300033180 Bacteria 15298
66 Ga0307510_10074310 3300033180 Bacteria 3359
67 Ga0307510_10099079 3300033180 Bacteria 2715
68 Ga0395898_0027234 3300037466 Bacteria 5741
69 Ga0395898_0392951 3300037466 Bacteria 1322
70 Ga0436364_1496479 3300037853 Bacteria 17356
71 Ga0395901_0284543 3300038443 Bacteria 1717
72 Ga0439436_0001537 3300041404 Bacteria 6712
73 Ga0439436_0007667 3300041404 Bacteria 3320
74 Ga0439439_0000748 3300041406 Bacteria 5835
75 Ga0451795_0204245 3300041456 Bacteria 1224
76 Ga0451853_1966274 3300041512 Bacteria 2109
77 Ga0451853_1997185 3300041512 Bacteria 3124
78 Ga0451853_3921265 3300041512 Bacteria 1069
79 Ga0439448_0071696 3300042005 Bacteria 1154
80 Ga0439449_0000408 3300042007 Bacteria 15908
81 Ga0439457_000034 3300042014 Bacteria 28537
82 Ga0439457_000848 3300042014 Bacteria 9188
83 Ga0439457_004179 3300042014 Bacteria 3808
84 Ga0439463_039724 3300042016 Bacteria 1195
85 Ga0450894_001728 3300042131 Bacteria 3072
86 Ga0450896_002270 3300042133 Bacteria 2470
87 Ga0450898_001350 3300042134 Bacteria 3206
88 Ga0450902_018534 3300042137 Bacteria 1142
89 Ga0450903_005334 3300042138 Bacteria 2153
90 Ga0450903_009832 3300042138 Bacteria 1554
91 Ga0450906_000818 3300042145 Bacteria 6850
92 Ga0439458_0001363 3300042157 Bacteria 6162
93 Ga0439458_0048281 3300042157 Bacteria 1046
94 Ga0450908_003243 3300042184 Bacteria 3167
95 Ga0466969_0006668 3300044656 Bacteria 6137
96 Ga0466969_0090207 3300044656 Bacteria 1453
97 Ga0466972_0041742 3300044658 Bacteria 2232
98 Ga0466972_0091445 3300044658 Bacteria 1443
99 Ga0466965_0000080 3300044683 Bacteria 28010
100 Ga0466965_0061493 3300044683 Bacteria 1877
101 Ga0466965_0404625 3300044683 Bacteria 754
102 Ga0466966_0004014 3300044684 Bacteria 9716
103 Ga0466966_0004606 3300044684 Bacteria 9078
104 Ga0466961_0002296 3300044693 Bacteria 11886
105 Ga0466961_0002813 3300044693 Bacteria 10828
106 Ga0466963_0001759 3300044694 Bacteria 11807
107 Ga0466963_0002793 3300044694 Bacteria 9838
108 Ga0466963_0135653 3300044694 Bacteria 1703
109 Ga0466964_0076204 3300044706 Bacteria 1429
110 Ga0466971_0000132 3300044719 Bacteria 27409
111 Ga0466971_0017422 3300044719 Bacteria 3178
112 Ga0466971_0045024 3300044719 Bacteria 1982
113 Ga0466968_0050262 3300044735 Bacteria 1778
114 Ga0466970_0000430 3300044765 Bacteria 20561
115 Ga0466970_0000728 3300044765 Bacteria 16041
116 Ga0466970_0147081 3300044765 Bacteria 1300
117 Ga0466957_0003976 3300044842 Bacteria 8171
118 Ga0466960_0004702 3300044901 Bacteria 5358
119 Ga0466959_0003573 3300045049 Bacteria 10232
120 Ga0466959_0025527 3300045049 Bacteria 4380
121 Ga0466958_0000268 3300045836 Bacteria 20128
122 Ga0466958_0364578 3300045836 Bacteria 931
123 Ga0466967_0024471 3300045976 Bacteria 4965
124 Ga0466967_0128784 3300045976 Bacteria 2347
125 Ga0466967_0213819 3300045976 Bacteria 1830
126 Ga0466967_0303155 3300045976 Bacteria 1537
127 Ga0495617_028819 3300046452 Bacteria 1866
128 Ga0495592_0021448 3300046454 Bacteria 4912
129 Ga0495603_0008814 3300046455 Bacteria 6097
130 Ga0495603_0009069 3300046455 Bacteria 6014
131 Ga0495603_0146114 3300046455 Bacteria 1374
132 Ga0495590_0164938 3300046457 Bacteria 806
133 Ga0495629_0020540 3300046459 Bacteria 4716
134 Ga0495629_0068415 3300046459 Bacteria 2478
135 Ga0495629_0207917 3300046459 Bacteria 1352
136 Ga0495629_0287940 3300046459 Bacteria 1126
137 Ga0495629_0389755 3300046459 Bacteria 947
138 Ga0495638_0047747 3300046460 Bacteria 2683
139 Ga0495638_0154741 3300046460 Bacteria 1327
140 Ga0495638_0245786 3300046460 Bacteria 988
141 Ga0495638_0246632 3300046460 Bacteria 986
142 Ga0495651_0087651 3300046462 Bacteria 2340
143 Ga0495582_0261726 3300046473 Bacteria 992
144 Ga0495605_0072096 3300046474 Bacteria 1630
145 Ga0495639_0017446 3300046475 Bacteria 3118
146 Ga0495662_0031121 3300046476 Bacteria 2577
147 Ga0495664_0045519 3300046477 Bacteria 2602
148 Ga0495584_0046666 3300046491 Bacteria 2185
149 Ga0495585_0052679 3300046492 Bacteria 2253
150 Ga0495594_0028819 3300046499 Bacteria 2997
151 Ga0495594_0052358 3300046499 Bacteria 2247
152 Ga0495594_0077420 3300046499 Bacteria 1855
153 Ga0495594_0166065 3300046499 Bacteria 1255
154 Ga0495594_0198179 3300046499 Bacteria 1144
155 Ga0495596_0039072 3300046500 Bacteria 1875
156 Ga0495607_0097499 3300046501 Bacteria 1581
157 Ga0495583_0021087 3300046506 Bacteria 3357
158 Ga0495606_0144459 3300046507 Bacteria 1402
159 Ga0495608_0061825 3300046511 Bacteria 2462
160 Ga0495616_0081346 3300046513 Bacteria 1549
161 Ga0495618_0012643 3300046514 Bacteria 5128
162 Ga0495620_0023566 3300046515 Bacteria 2941
163 Ga0495620_0076002 3300046515 Bacteria 1365
164 Ga0495620_0149163 3300046515 Bacteria 912
165 Ga0495628_0055305 3300046516 Bacteria 3126
166 Ga0495628_0313904 3300046516 Bacteria 1158
167 Ga0495631_0147251 3300046518 Bacteria 1010
168 Ga0495632_0043928 3300046519 Bacteria 2232
169 Ga0495632_0070335 3300046519 Bacteria 1683
170 Ga0495637_0026906 3300046520 Bacteria 2577
171 Ga0495643_0013758 3300046522 Bacteria 4831
172 Ga0495643_0026291 3300046522 Bacteria 3285
173 Ga0495644_0041053 3300046523 Bacteria 1743
174 Ga0495648_0035080 3300046524 Bacteria 3255
175 Ga0495642_0017750 3300046528 Bacteria 2780
176 Ga0495642_0132054 3300046528 Bacteria 1075
177 Ga0495652_0261396 3300046529 Bacteria 1277
178 Ga0495640_0001201 3300046533 Bacteria 20288
179 Ga0495640_0009430 3300046533 Bacteria 7603
180 Ga0495609_0009201 3300046538 Bacteria 4789
181 Ga0495609_0053589 3300046538 Bacteria 1793
182 Ga0495597_0022902 3300046542 Bacteria 2893
183 Ga0495633_0027929 3300046558 Bacteria 2752
184 Ga0495633_0061521 3300046558 Bacteria 1758
185 Ga0495633_0152568 3300046558 Bacteria 1067
186 Ga0495667_0070182 3300046559 Bacteria 2286
187 Ga0495656_0093693 3300046615 Bacteria 1378
188 Ga0495668_0039048 3300046616 Bacteria 2650
189 Ga0495668_0237389 3300046616 Bacteria 998
190 Ga0495634_0014282 3300046642 Bacteria 5730
191 Ga0495611_0078276 3300046648 Bacteria 1517
192 Ga0495625_0149218 3300046660 Bacteria 1572
193 Ga0495635_0066182 3300046663 Bacteria 2478
194 Ga0495635_0110929 3300046663 Bacteria 1874
195 Ga0495659_0084169 3300046664 Bacteria 1212
196 Ga0495661_0061057 3300046665 Bacteria 2238
197 Ga0495588_0136801 3300046674 Bacteria 1293
198 Ga0495657_0019444 3300046675 Bacteria 4899
199 Ga0495623_0052669 3300046679 Bacteria 2571
200 Ga0495623_0114628 3300046679 Bacteria 1629
201 Ga0495646_0159796 3300046680 Bacteria 1248
202 Ga0495658_0177793 3300046683 Bacteria 1319
203 Ga0495613_0132760 3300046689 Bacteria 1782
204 Ga0495613_0134058 3300046689 Bacteria 1773
205 Ga0495613_0232420 3300046689 Bacteria 1291
206 Ga0495624_0011964 3300046690 Bacteria 5949
207 Ga0495624_0019438 3300046690 Bacteria 4534
208 Ga0495670_0019119 3300046691 Bacteria 3376
209 Ga0495670_0266704 3300046691 Bacteria 914
210 Ga0495671_0203714 3300046692 Bacteria 959
211 Ga0495649_0080236 3300046694 Bacteria 1745
212 Ga0495649_0183919 3300046694 Bacteria 1089
213 Ga0495649_0238610 3300046694 Bacteria 936
214 Ga0495589_0013383 3300046794 Bacteria 4234
215 Ga0495589_0030983 3300046794 Bacteria 2693
216 Ga0495589_0033239 3300046794 Bacteria 2591
217 Ga0495600_0033663 3300046809 Bacteria 3326
218 Ga0495600_0038742 3300046809 Bacteria 3102
219 Ga0495660_0033359 3300046810 Bacteria 2887
220 Ga0495581_0055632 3300047315 Bacteria 2283
221 Ga0495581_0240389 3300047315 Bacteria 1059
222 Ga0495581_0249406 3300047315 Bacteria 1038
223 Ga0495636_0007753 3300047318 Bacteria 4225
224 Ga0495636_0019838 3300047318 Bacteria 2704
225 Ga0495674_0279045 3300047319 Bacteria 1369
226 Ga0495672_0079663 3300047320 Bacteria 1829
227 Ga0495676_0009503 3300047321 Bacteria 8857
228 Ga0495676_0062781 3300047321 Bacteria 2898
229 Ga0495676_0343532 3300047321 Bacteria 999
230 Ga0495683_0024250 3300047323 Bacteria 3114
231 Ga0495687_016222 3300047443 Bacteria 3751
232 Ga0495687_058804 3300047443 Bacteria 1593
233 Ga0495687_104137 3300047443 Bacteria 1057
234 Ga0495675_0114708 3300047444 Bacteria 1680
235 Ga0495675_0283519 3300047444 Bacteria 987
236 Ga0495677_0037920 3300047445 Bacteria 1761
237 Ga0495677_0147371 3300047445 Bacteria 905
238 Ga0495679_027051 3300047446 Bacteria 1897
239 Ga0495685_000356 3300047447 Bacteria 14603
240 Ga0495685_001164 3300047447 Bacteria 8017
241 Ga0495685_005112 3300047447 Bacteria 4272
242 Ga0495685_006233 3300047447 Bacteria 3900
243 Ga0495681_0002008 3300047470 Bacteria 14874
244 Ga0495681_0013890 3300047470 Bacteria 4649
245 Ga0495684_0226625 3300047471 Bacteria 1368
246 Ga0495686_0080254 3300047472 Bacteria 1994
247 Ga0495686_0204165 3300047472 Bacteria 1132
248 Ga0495593_0043189 3300047673 Bacteria 2416
249 Ga0495602_0144948 3300048088 Bacteria 1875
250 Ga0495626_0040119 3300048091 Bacteria 2212
251 Ga0496101_0631315 3300048904 Bacteria 847
252 Ga0501308_017444 3300049128 Bacteria 869
253 Ga0495678_033889 3300049459 Bacteria 2105
254 Ga0495682_0019559 3300049460 Bacteria 2546
255 Ga0501317_013017 3300049533 Bacteria 1034
256 Ga0501031_0007726 3300049568 Bacteria 7000
257 Ga0501031_0033505 3300049568 Bacteria 3351
258 Ga0501031_0123613 3300049568 Bacteria 1690
259 Ga0501032_0004515 3300049569 Bacteria 10468
260 Ga0501032_0014715 3300049569 Bacteria 5536
261 Ga0501032_0021017 3300049569 Bacteria 4540
262 Ga0501032_0065089 3300049569 Bacteria 2439
263 Ga0501032_0220145 3300049569 Bacteria 1235
264 Ga0501032_0273379 3300049569 Bacteria 1094
265 Ga0501033_0006157 3300049570 Bacteria 9410
266 Ga0501033_0016876 3300049570 Bacteria 5520
267 Ga0501033_0083059 3300049570 Bacteria 2348
268 Ga0501033_0084190 3300049570 Bacteria 2330
269 Ga0501033_0355005 3300049570 Bacteria 1026
270 Ga0501034_0001182 3300049571 Bacteria 36131
271 Ga0501034_0026226 3300049571 Bacteria 5935
272 Ga0501034_0029009 3300049571 Bacteria 5626
273 Ga0501034_0032513 3300049571 Bacteria 5296
274 Ga0501034_0383278 3300049571 Bacteria 1330
275 Ga0501034_0430996 3300049571 Bacteria 1238
276 Ga0501034_0564839 3300049571 Bacteria 1046
277 Ga0501036_0006481 3300049572 Bacteria 9510
278 Ga0501036_0026955 3300049572 Bacteria 4856
279 Ga0501036_0036473 3300049572 Bacteria 4161
280 Ga0501036_0048169 3300049572 Bacteria 3608
281 Ga0501036_0062701 3300049572 Bacteria 3149
282 Ga0501036_0526069 3300049572 Bacteria 983
283 Ga0501037_0009492 3300049573 Bacteria 7140
284 Ga0501037_0015104 3300049573 Bacteria 5680
285 Ga0501037_0035859 3300049573 Bacteria 3655
286 Ga0501037_0049751 3300049573 Bacteria 3068
287 Ga0501037_0084875 3300049573 Bacteria 2293
288 Ga0501037_0404612 3300049573 Bacteria 936
289 Ga0501038_0000928 3300049574 Bacteria 26058
290 Ga0501038_0022534 3300049574 Bacteria 5642
291 Ga0501038_0028831 3300049574 Bacteria 4928
292 Ga0501038_0030983 3300049574 Bacteria 4728
293 Ga0501038_0084390 3300049574 Bacteria 2672
294 Ga0501038_0098685 3300049574 Bacteria 2435
295 Ga0501038_0318874 3300049574 Bacteria 1216
296 Ga0501038_0322809 3300049574 Bacteria 1207
297 Ga0501039_0065748 3300049575 Bacteria 2813
298 Ga0501039_0091325 3300049575 Bacteria 2373
299 Ga0501039_0422093 3300049575 Bacteria 1047
300 Ga0501039_0426623 3300049575 Bacteria 1041
301 Ga0501040_0032283 3300049576 Bacteria 3543
302 Ga0501041_0027546 3300049577 Bacteria 3424
303 Ga0501042_0018518 3300049578 Bacteria 4822
304 Ga0501042_0306213 3300049578 Bacteria 1148
305 Ga0501043_0013305 3300049579 Bacteria 6434
306 Ga0501043_0024646 3300049579 Bacteria 4718
307 Ga0501043_0034893 3300049579 Bacteria 3956
308 Ga0501043_0037172 3300049579 Bacteria 3830
309 Ga0501043_0097938 3300049579 Bacteria 2305
310 Ga0501043_0135427 3300049579 Bacteria 1929
311 Ga0501046_0009429 3300049580 Bacteria 8436
312 Ga0501046_0048152 3300049580 Bacteria 3376
313 Ga0501047_0000093 3300049581 Bacteria 110613
314 Ga0501047_0003955 3300049581 Bacteria 13934
315 Ga0501047_0005690 3300049581 Bacteria 11729
316 Ga0501047_0014587 3300049581 Bacteria 7477
317 Ga0501047_0016734 3300049581 Bacteria 7005
318 Ga0501047_0018269 3300049581 Bacteria 6719
319 Ga0501047_0061565 3300049581 Bacteria 3621
320 Ga0501048_0006331 3300049582 Bacteria 9003
321 Ga0501048_0029897 3300049582 Bacteria 3945
322 Ga0501067_0005808 3300049583 Bacteria 6848
323 Ga0501068_0014722 3300049584 Bacteria 4475
324 Ga0501069_0011659 3300049585 Bacteria 4660
325 Ga0501070_0000926 3300049586 Bacteria 26476
326 Ga0501070_0051436 3300049586 Bacteria 3420
327 Ga0501070_0127631 3300049586 Bacteria 2101
328 Ga0501070_0669935 3300049586 Bacteria 822
329 Ga0501071_0010709 3300049587 Bacteria 6150
330 Ga0501072_0600601 3300049588 Bacteria 868
331 Ga0501074_0006214 3300049590 Bacteria 8619
332 Ga0501074_0037148 3300049590 Bacteria 3530
333 Ga0501076_0077433 3300049592 Bacteria 2668
334 Ga0501079_0027389 3300049741 Bacteria 4369
335 Ga0501080_0092045 3300049742 Bacteria 2816
336 Ga0501083_0012275 3300049744 Bacteria 5995
337 Ga0501282_003559 3300049778 Bacteria 1680
338 Ga0501035_0000307 3300049822 Bacteria 57471
339 Ga0501035_0007476 3300049822 Bacteria 10203
340 Ga0501035_0007907 3300049822 Bacteria 9932
341 Ga0501035_0018702 3300049822 Bacteria 6381
342 Ga0501035_0055799 3300049822 Bacteria 3527
343 Ga0501035_0064145 3300049822 Bacteria 3265
344 Ga0501035_0096781 3300049822 Bacteria 2593
345 Ga0501044_0016820 3300049823 Bacteria 7847
346 Ga0501044_0032765 3300049823 Bacteria 5461
347 Ga0501044_0049020 3300049823 Bacteria 4359
348 Ga0501044_0055805 3300049823 Bacteria 4056
349 Ga0501044_0069498 3300049823 Bacteria 3584
350 Ga0501044_0076546 3300049823 Bacteria 3395
351 Ga0501044_0078889 3300049823 Bacteria 3337
352 Ga0501044_0080653 3300049823 Bacteria 3295
353 Ga0501044_0212053 3300049823 Bacteria 1890
354 Ga0501044_0361043 3300049823 Bacteria 1370
355 Ga0501044_0422410 3300049823 Bacteria 1243
356 Ga0501045_0030889 3300049824 Bacteria 3878
357 Ga0501045_0631546 3300049824 Bacteria 792
358 nmdc:mga0yw44_644896_c1 3300050492 Bacteria 720
359 nmdc:mga06z11_38033_c1 3300050494 Bacteria 2387
360 nmdc:mga07m45_115746_c1 3300050496 Bacteria 1546
361 nmdc:mga07m45_90227_c1 3300050496 Bacteria 1755
362 Ga0500578_0057324 3300053086 Bacteria 2490
363 Ga0500654_032057 3300053099 Bacteria 3142
364 Ga0500553_125814 3300053101 Bacteria 1045
365 Ga0500560_062786 3300053107 Bacteria 1214
366 Ga0500569_002928 3300053109 Bacteria 3422
367 Ga0500628_003579 3300053129 Bacteria 2568
368 Ga0500652_000974 3300053131 Bacteria 9465
369 Ga0500658_0004189 3300053134 Bacteria 5415
370 Ga0500561_0001295 3300053137 Bacteria 4062
371 Ga0500573_0164286 3300053140 Bacteria 1206
372 Ga0500577_0020615 3300053142 Bacteria 2160
373 Ga0500579_030163 3300053143 Bacteria 3482
374 Ga0500633_0008448 3300053160 Bacteria 2656
375 Ga0500634_0005822 3300053161 Bacteria 5902
376 Ga0500656_000164 3300053732 Bacteria 4237
377 Ga0501084_0013362 3300054114 Bacteria 6793
378 Ga0501084_0442695 3300054114 Bacteria 1098
379 Ga0587091_057047 3300059511 Bacteria 819
380 Ga0587122_001941 3300059628 Bacteria 1428
381 Ga0501082_0036260 3300060353 Bacteria 4248
382 Ga0466962_0000906 3300061719 Bacteria 13457
383 Ga0466962_0341007 3300061719 Bacteria 745
384 Ga0530510_0024033 3300061734 Bacteria 4347
385 2547406381 2547132111 Bacteria 8013147
386 2554257166 2554235005 Bacteria 6457341
387 2585305364 2582581313 Bacteria 10042643
388 2585312898 2582581314 Bacteria 11452267
389 2616702345 2616644814 Bacteria 11555299
390 2644266084 2643221647 Bacteria 10741251
391 2644437449 2643221678 Bacteria 9540101
392 2768642578 2767802112 Bacteria 6465194
393 2784589293 2784132148 Bacteria 8627943
394 2785342330 2784746763 Bacteria 9783172
395 2785370348 2784746768 Bacteria 10036182
396 2786671458 2786546132 Bacteria 10419719
397 2793984500 2791355406 Bacteria 11364898
398 2808842871 2808606359 Bacteria 9866990
399 2808921269 2808606375 Bacteria 9466072
400 2809232912 2808606448 Bacteria 8656184
401 2811845467 2808606982 Bacteria 7791042
402 2812357203 2811994879 Bacteria 9313447
403 2812479869 2811994917 Bacteria 7761064
404 2852639903 2852635781 Bacteria 8251373
405 2862180055 2862178590 Bacteria 8583590
406 2862286528 2862281513 Bacteria 9621493
407 2862393025 2862382967 Bacteria 10317375
408 2862510154 2862507626 Bacteria 9425308
409 2862578592 2862574272 Bacteria 10567477
410 2863412099 2863404153 Bacteria 9672205
411 2867348697 2867346516 Bacteria 7608576
412 2867437152 2867428634 Bacteria 9590268
413 2867477867 2867475112 Bacteria 6909112
414 2873155119 2873151551 Bacteria 8625867
415 2877680276 2877676314 Bacteria 9512378
416 2912718918 2912715099 Bacteria 9460473
417 2912724199 2912723979 Bacteria 8557534
418 2912761724 2912757875 Bacteria 7940295
419 2919471311 2919468124 Bacteria 9133025
420 2946068665 2946064051 Bacteria 8957905
421 2946076663 2946072368 Bacteria 8999607
422 2947228230 2947224130 Bacteria 9938529
423 2954006291 2954002825 Bacteria 9173742
424 2954385313 2954380949 Bacteria 10050426
425 2954677781 2954673503 Bacteria 9685905
426 2954686373 2954682443 Bacteria 9862841
427 2954696047 2954691527 Bacteria 10720516
428 2954711220 2954701450 Bacteria 10834262
429 2954715454 2954711539 Bacteria 10867210
430 2954725374 2954721474 Bacteria 10456478
431 2954736421 2954731030 Bacteria 10243860
432 2954744309 2954740390 Bacteria 10229294
433 2954755270 2954749733 Bacteria 10366972
434 2954763282 2954759201 Bacteria 9358192
435 2990065239 2990059506 Bacteria 9321252
436 2990089487 2990088156 Bacteria 6657676
437 2997454440 2997451912 Bacteria 8492419
438 2997600098 2997600082 Bacteria 9896405
439 3006325547 3006321560 Bacteria 8247479
440 3006395157 3006393351 Bacteria 6615579
441 3006425654 3006425503 Bacteria 6491253
442 3006500244 3006493962 Bacteria 8825450
443 8008485707 8008485437 Bacteria 7198341
444 8008566035 8008558824 Bacteria 10610750
445 8008578213 8008574985 Bacteria 7815457
446 8023628762 8023623736 Bacteria 8593882
447 8025482183 8025478263 Bacteria 8209203
448 8025524791 8025524527 Bacteria 7197316
449 8033688465 8033684223 Bacteria 6906479
450 8047897763 8047893842 Bacteria 11723082
451 8048137042 8048127548 Bacteria 11053136
452 8048361108 8048356638 Bacteria 11044339
453 8048374749 8048369669 Bacteria 11666822
454 8048383473 8048379754 Bacteria 11877923
455 8048410784 8048406513 Bacteria 8936924
456 8054165139 8054160619 Bacteria 7783213
457 8056453927 8056447290 Bacteria 7680491
458 8056669061 8056667051 Bacteria 6953971
459 8056837762 8056829672 Bacteria 9045328
460 Ga0495676_0198321
461 JGI24738J21930_10003812
462 rootH1_10008485
463 JGI25160J50197_1011134
464 Ga0006562J51391_1044026
465 Ga0006562J51391_1044027
466 Ga0006562J51391_1071824
467 Ga0006562J51391_1071826
468 Ga0068853_100058620
469 Ga0070665_100649442
470 Ga0070665_101384012
471 Ga0068856_100786023
472 Ga0081455_10027683
473 Ga0075365_10160405
474 Ga0075363_100094056
475 Ga0075367_10050867
476 Ga0075370_10222493
477 Ga0099826_10043053
478 Ga0105251_10012110
479 Ga0105245_10446804
480 Ga0105245_10525163
481 Ga0105246_10008072
482 Ga0105246_10237212
483 Ga0157369_10111068
484 Ga0157372_10436114
485 Ga0157375_11630916
486 Ga0157376_10271606
487 Ga0182007_10014899
488 Ga0182005_1050223
489 Ga0183367_1015
490 Ga0163161_10386670
491 Ga0197907_11301022
492 Ga0206356_10031771
493 Ga0206354_11406630
494 Ga0224712_10057989
495 Ga0209758_1016275
496 Ga0207426_1013980
497 Ga0207426_1021289
498 Ga0207687_10335548
499 Ga0207709_10334334
500 Ga0207639_10005922
501 Ga0209371_1004803
502 Ga0209282_1220477
503 Ga0307517_10056954
504 Ga0307515_10102750
505 Ga0307515_10197482
506 Ga0268256_1005827
507 Ga0268256_1014863
508 Ga0307511_10035903
509 Ga0307511_10065427
510 Ga0307512_10002830
511 Ga0307512_10052075
512 Ga0307513_10007509
513 Ga0307508_10007129
514 Ga0307508_10019628
515 Ga0307508_10059555
516 Ga0307514_10028678
517 Ga0307514_10077022
518 Ga0307514_10105256
519 Ga0307514_10109316
520 Ga0307516_10049986
521 Ga0307516_10120094
522 Ga0307516_10146875
523 Ga0307416_100849455
524 Ga0307510_10005336
525 Ga0307510_10074310
526 Ga0307510_10099079
527 Ga0395898_0027234
528 Ga0395898_0392951
529 Ga0436364_1496479
530 Ga0395901_0284543
531 Ga0439436_0001537
532 Ga0439436_0007667
533 Ga0439439_0000748
534 Ga0451795_0204245
535 Ga0451853_1966274
536 Ga0451853_1997185
537 Ga0451853_3921265
538 Ga0439448_0071696
539 Ga0439449_0000408
540 Ga0439457_000034
541 Ga0439457_000848
542 Ga0439457_004179
543 Ga0439463_039724
544 Ga0450894_001728
545 Ga0450896_002270
546 Ga0450898_001350
547 Ga0450902_018534
548 Ga0450903_005334
549 Ga0450903_009832
550 Ga0450906_000818
551 Ga0439458_0001363
552 Ga0439458_0048281
553 Ga0450908_003243
554 Ga0466969_0006668
555 Ga0466969_0090207
556 Ga0466972_0041742
557 Ga0466972_0091445
558 Ga0466965_0000080
559 Ga0466965_0061493
560 Ga0466965_0404625
561 Ga0466966_0004014
562 Ga0466966_0004606
563 Ga0466961_0002296
564 Ga0466961_0002813
565 Ga0466963_0001759
566 Ga0466963_0002793
567 Ga0466963_0135653
568 Ga0466964_0076204
569 Ga0466971_0000132
570 Ga0466971_0017422
571 Ga0466971_0045024
572 Ga0466968_0050262
573 Ga0466970_0000430
574 Ga0466970_0000728
575 Ga0466970_0147081
576 Ga0466957_0003976
577 Ga0466960_0004702
578 Ga0466959_0003573
579 Ga0466959_0025527
580 Ga0466958_0000268
581 Ga0466958_0364578
582 Ga0466967_0024471
583 Ga0466967_0128784
584 Ga0466967_0213819
585 Ga0466967_0303155
586 Ga0495617_028819
587 Ga0495592_0021448
588 Ga0495603_0008814
589 Ga0495603_0009069
590 Ga0495603_0146114
591 Ga0495590_0164938
592 Ga0495629_0020540
593 Ga0495629_0068415
594 Ga0495629_0207917
595 Ga0495629_0287940
596 Ga0495629_0389755
597 Ga0495638_0047747
598 Ga0495638_0154741
599 Ga0495638_0245786
600 Ga0495638_0246632
601 Ga0495651_0087651
602 Ga0495582_0261726
603 Ga0495605_0072096
604 Ga0495639_0017446
605 Ga0495662_0031121
606 Ga0495664_0045519
607 Ga0495584_0046666
608 Ga0495585_0052679
609 Ga0495594_0028819
610 Ga0495594_0052358
611 Ga0495594_0077420
612 Ga0495594_0166065
613 Ga0495594_0198179
614 Ga0495596_0039072
615 Ga0495607_0097499
616 Ga0495583_0021087
617 Ga0495606_0144459
618 Ga0495608_0061825
619 Ga0495616_0081346
620 Ga0495618_0012643
621 Ga0495620_0023566
622 Ga0495620_0076002
623 Ga0495620_0149163
624 Ga0495628_0055305
625 Ga0495628_0313904
626 Ga0495631_0147251
627 Ga0495632_0043928
628 Ga0495632_0070335
629 Ga0495637_0026906
630 Ga0495643_0013758
631 Ga0495643_0026291
632 Ga0495644_0041053
633 Ga0495648_0035080
634 Ga0495642_0017750
635 Ga0495642_0132054
636 Ga0495652_0261396
637 Ga0495640_0001201
638 Ga0495640_0009430
639 Ga0495609_0009201
640 Ga0495609_0053589
641 Ga0495597_0022902
642 Ga0495633_0027929
643 Ga0495633_0061521
644 Ga0495633_0152568
645 Ga0495667_0070182
646 Ga0495656_0093693
647 Ga0495668_0039048
648 Ga0495668_0237389
649 Ga0495634_0014282
650 Ga0495611_0078276
651 Ga0495625_0149218
652 Ga0495635_0066182
653 Ga0495635_0110929
654 Ga0495659_0084169
655 Ga0495661_0061057
656 Ga0495588_0136801
657 Ga0495657_0019444
658 Ga0495623_0052669
659 Ga0495623_0114628
660 Ga0495646_0159796
661 Ga0495658_0177793
662 Ga0495613_0132760
663 Ga0495613_0134058
664 Ga0495613_0232420
665 Ga0495624_0011964
666 Ga0495624_0019438
667 Ga0495670_0019119
668 Ga0495670_0266704
669 Ga0495671_0203714
670 Ga0495649_0080236
671 Ga0495649_0183919
672 Ga0495649_0238610
673 Ga0495589_0013383
674 Ga0495589_0030983
675 Ga0495589_0033239
676 Ga0495600_0033663
677 Ga0495600_0038742
678 Ga0495660_0033359
679 Ga0495581_0055632
680 Ga0495581_0240389
681 Ga0495581_0249406
682 Ga0495636_0007753
683 Ga0495636_0019838
684 Ga0495674_0279045
685 Ga0495672_0079663
686 Ga0495676_0009503
687 Ga0495676_0062781
688 Ga0495676_0343532
689 Ga0495683_0024250
690 Ga0495687_016222
691 Ga0495687_058804
692 Ga0495687_104137
693 Ga0495675_0114708
694 Ga0495675_0283519
695 Ga0495677_0037920
696 Ga0495677_0147371
697 Ga0495679_027051
698 Ga0495685_000356
699 Ga0495685_001164
700 Ga0495685_005112
701 Ga0495685_006233
702 Ga0495681_0002008
703 Ga0495681_0013890
704 Ga0495684_0226625
705 Ga0495686_0080254
706 Ga0495686_0204165
707 Ga0495593_0043189
708 Ga0495602_0144948
709 Ga0495626_0040119
710 Ga0496101_0631315
711 Ga0501308_017444
712 Ga0495678_033889
713 Ga0495682_0019559
714 Ga0501317_013017
715 Ga0501031_0007726
716 Ga0501031_0033505
717 Ga0501031_0123613
718 Ga0501032_0004515
719 Ga0501032_0014715
720 Ga0501032_0021017
721 Ga0501032_0065089
722 Ga0501032_0220145
723 Ga0501032_0273379
724 Ga0501033_0006157
725 Ga0501033_0016876
726 Ga0501033_0083059
727 Ga0501033_0084190
728 Ga0501033_0355005
729 Ga0501034_0001182
730 Ga0501034_0026226
731 Ga0501034_0029009
732 Ga0501034_0032513
733 Ga0501034_0383278
734 Ga0501034_0430996
735 Ga0501034_0564839
736 Ga0501036_0006481
737 Ga0501036_0026955
738 Ga0501036_0036473
739 Ga0501036_0048169
740 Ga0501036_0062701
741 Ga0501036_0526069
742 Ga0501037_0009492
743 Ga0501037_0015104
744 Ga0501037_0035859
745 Ga0501037_0049751
746 Ga0501037_0084875
747 Ga0501037_0404612
748 Ga0501038_0000928
749 Ga0501038_0022534
750 Ga0501038_0028831
751 Ga0501038_0030983
752 Ga0501038_0084390
753 Ga0501038_0098685
754 Ga0501038_0318874
755 Ga0501038_0322809
756 Ga0501039_0065748
757 Ga0501039_0091325
758 Ga0501039_0422093
759 Ga0501039_0426623
760 Ga0501040_0032283
761 Ga0501041_0027546
762 Ga0501042_0018518
763 Ga0501042_0306213
764 Ga0501043_0013305
765 Ga0501043_0024646
766 Ga0501043_0034893
767 Ga0501043_0037172
768 Ga0501043_0097938
769 Ga0501043_0135427
770 Ga0501046_0009429
771 Ga0501046_0048152
772 Ga0501047_0000093
773 Ga0501047_0003955
774 Ga0501047_0005690
775 Ga0501047_0014587
776 Ga0501047_0016734
777 Ga0501047_0018269
778 Ga0501047_0061565
779 Ga0501048_0006331
780 Ga0501048_0029897
781 Ga0501067_0005808
782 Ga0501068_0014722
783 Ga0501069_0011659
784 Ga0501070_0000926
785 Ga0501070_0051436
786 Ga0501070_0127631
787 Ga0501070_0669935
788 Ga0501071_0010709
789 Ga0501072_0600601
790 Ga0501074_0006214
791 Ga0501074_0037148
792 Ga0501076_0077433
793 Ga0501079_0027389
794 Ga0501080_0092045
795 Ga0501083_0012275
796 Ga0501282_003559
797 Ga0501035_0000307
798 Ga0501035_0007476
799 Ga0501035_0007907
800 Ga0501035_0018702
801 Ga0501035_0055799
802 Ga0501035_0064145
803 Ga0501035_0096781
804 Ga0501044_0016820
805 Ga0501044_0032765
806 Ga0501044_0049020
807 Ga0501044_0055805
808 Ga0501044_0069498
809 Ga0501044_0076546
810 Ga0501044_0078889
811 Ga0501044_0080653
812 Ga0501044_0212053
813 Ga0501044_0361043
814 Ga0501044_0422410
815 Ga0501045_0030889
816 Ga0501045_0631546
817 nmdc:mga0yw44_644896_c1
818 nmdc:mga06z11_38033_c1
819 nmdc:mga07m45_115746_c1
820 nmdc:mga07m45_90227_c1
821 Ga0500578_0057324
822 Ga0500654_032057
823 Ga0500553_125814
824 Ga0500560_062786
825 Ga0500569_002928
826 Ga0500628_003579
827 Ga0500652_000974
828 Ga0500658_0004189
829 Ga0500561_0001295
830 Ga0500573_0164286
831 Ga0500577_0020615
832 Ga0500579_030163
833 Ga0500633_0008448
834 Ga0500634_0005822
835 Ga0500656_000164
836 Ga0501084_0013362
837 Ga0501084_0442695
838 Ga0587091_057047
839 Ga0587122_001941
840 Ga0501082_0036260
841 Ga0466962_0000906
842 Ga0466962_0341007
843 Ga0530510_0024033
844 2547406381
845 2554257166
846 2585305364
847 2585312898
848 2616702345
849 2644266084
850 2644437449
851 2768642578
852 2784589293
853 2785342330
854 2785370348
855 2786671458
856 2793984500
857 2808842871
858 2808921269
859 2809232912
860 2811845467
861 2812357203
862 2812479869
863 2852639903
864 2862180055
865 2862286528
866 2862393025
867 2862510154
868 2862578592
869 2863412099
870 2867348697
871 2867437152
872 2867477867
873 2873155119
874 2877680276
875 2912718918
876 2912724199
877 2912761724
878 2919471311
879 2946068665
880 2946076663
881 2947228230
882 2954006291
883 2954385313
884 2954677781
885 2954686373
886 2954696047
887 2954711220
888 2954715454
889 2954725374
890 2954736421
891 2954744309
892 2954755270
893 2954763282
894 2990065239
895 2990089487
896 2997454440
897 2997600098
898 3006325547
899 3006395157
900 3006425654
901 3006500244
902 8008485707
903 8008566035
904 8008578213
905 8023628762
906 8025482183
907 8025524791
908 8033688465
909 8047897763
910 8048137042
911 8048361108
912 8048374749
913 8048383473
914 8048410784
915 8054165139
916 8056453927
917 8056669061
918 8056837762

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16702

DUF5063

Domain of unknown function (DUF5063)

38

200

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nrh-assembly1.cif.gz_A crystal structure of protein bf1032 from bacteroides fragilis, northeast structural genomics consortium target bfr309 0.8712 14 170
3nrh-assembly1.cif.gz_B-2 crystal structure of protein bf1032 from bacteroides fragilis, northeast structural genomics consortium target bfr309 0.8308 18 170
3nrh-assembly1.cif.gz_A crystal structure of protein bf1032 from bacteroides fragilis, northeast structural genomics consortium target bfr309 0.8047 14 170
3nrh-assembly1.cif.gz_B-2 crystal structure of protein bf1032 from bacteroides fragilis, northeast structural genomics consortium target bfr309 0.7702 18 170
8cdv-assembly1.cif.gz_S rnase r bound to a 30s degradation intermediate (state ii) 0.5578 17 93
ID Description Score Start End Superfamily
3nrhB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Protein of unknown function DUF5063 0.7272 23 170 1.20.120.1550
3nrhB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Protein of unknown function DUF5063 0.6833 23 170 1.20.120.1550
af_P0ACA1_79_188_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.5323 17 94 1.20.1050.10
4peaT00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 0.4635 17 93 1.20.58.110
1iq0A03 Mainly Alpha;Orthogonal Bundle;Isoleucyl-tRNA Synthetase; Domain 1;Isoleucyl-tRNA Synthetase; Domain 1 0.4518 16 95 1.10.730.10
ID Description Score Start End GO Terms
AF-A0A429X8L7-F1-model_v4 DUF5063 domain-containing protein 0.9494 95 176
AF-A0A1G8FHF6-F1-model_v4 DUF5063 domain-containing protein 0.9484 14 176
AF-A0A2P4UMY2-F1-model_v4 DUF5063 domain-containing protein 0.9443 14 177
AF-C7Q5M8-F1-model_v4 DUF5063 domain-containing protein 0.942 10 179
AF-A0A5C7N9E7-F1-model_v4 DUF5063 domain-containing protein 0.9412 16 177

Map