F448409

General Info

Members Datasets Scaffolds Average Seq Length
459 174 918 65

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0043470|Ga0466963_0043470_328_537
Length 69
Sequence MSPTMNDDHPSGMLEALKAEHRQLDERIQLLSSEPTGDQLELARLKRRKLQLKDQIQRIIDSSVPDIIA

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
135 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
150 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.63
Rhizosphere 92.37
Stem 0
Stem Tuber 0
Unclassified 13.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0043470 3300044694 Bacteria 2954
2 JGI24752J21851_1015583 3300001976 Bacteria 990
3 JGI24740J21852_10020439 3300001979 Bacteria 2309
4 JGI24739J22299_10014203 3300001989 Bacteria 2898
5 JGI24737J22298_10001371 3300001990 Bacteria 8641
6 JGI24735J21928_10036920 3300002067 Bacteria 1433
7 JGI24738J21930_10001979 3300002075 Bacteria 5510
8 JGI24738J21930_10092396 3300002075 Unclassified 641
9 JGI24738J21930_10094584 3300002075 Bacteria 634
10 JGI24738J21930_10111790 3300002075 Unclassified 589
11 JGI24034J26672_10025940 3300002239 Unclassified 938
12 Ga0065712_10140218 3300005290 Unclassified 1457
13 Ga0065715_10744617 3300005293 Bacteria 633
14 Ga0070658_10000477 3300005327 Bacteria 34731
15 Ga0070658_10136649 3300005327 Bacteria 2046
16 Ga0070658_10542081 3300005327 Bacteria 1007
17 Ga0070658_10649680 3300005327 Bacteria 915
18 Ga0070683_100000747 3300005329 Bacteria 23810
19 Ga0070690_101397998 3300005330 Bacteria 563
20 Ga0070690_101609132 3300005330 Unclassified 527
21 Ga0070670_100029933 3300005331 Bacteria 4688
22 Ga0070670_100311031 3300005331 Bacteria 1379
23 Ga0070670_100866568 3300005331 Bacteria 818
24 Ga0070677_10351695 3300005333 Bacteria 764
25 Ga0070666_10002947 3300005335 Bacteria 10304
26 Ga0070666_10079450 3300005335 Bacteria 2240
27 Ga0070666_10775160 3300005335 Bacteria 706
28 Ga0070680_100037588 3300005336 Bacteria 3912
29 Ga0070682_100149023 3300005337 Bacteria 1603
30 Ga0068868_100111118 3300005338 Bacteria 2227
31 Ga0068868_101780115 3300005338 Bacteria 582
32 Ga0070660_100000425 3300005339 Bacteria 27941
33 Ga0070660_100074144 3300005339 Bacteria 2662
34 Ga0070660_100447963 3300005339 Bacteria 1071
35 Ga0070660_100941896 3300005339 Unclassified 729
36 Ga0070687_101267314 3300005343 Bacteria 546
37 Ga0070661_100000552 3300005344 Bacteria 28745
38 Ga0070661_100039116 3300005344 Bacteria 3455
39 Ga0070661_100091236 3300005344 Bacteria 2256
40 Ga0070661_100284890 3300005344 Bacteria 1282
41 Ga0070661_101800091 3300005344 Bacteria 520
42 Ga0070692_10153919 3300005345 Bacteria 1312
43 Ga0070668_101114509 3300005347 Unclassified 713
44 Ga0070675_100075660 3300005354 Bacteria 2799
45 Ga0070675_101735820 3300005354 Unclassified 576
46 Ga0070671_100001542 3300005355 Bacteria 17326
47 Ga0070671_100001614 3300005355 Bacteria 16983
48 Ga0070671_100005726 3300005355 Bacteria 9896
49 Ga0070671_100054554 3300005355 Bacteria 3323
50 Ga0070671_100091040 3300005355 Bacteria 2554
51 Ga0070671_101896646 3300005355 Bacteria 530
52 Ga0070674_100852876 3300005356 Bacteria 790
53 Ga0070673_100158640 3300005364 Bacteria 1922
54 Ga0070673_100203929 3300005364 Bacteria 1704
55 Ga0070673_100228776 3300005364 Bacteria 1613
56 Ga0070659_100000065 3300005366 Bacteria 82919
57 Ga0070659_100039374 3300005366 Bacteria 3690
58 Ga0070659_100135840 3300005366 Bacteria 2000
59 Ga0070667_100036142 3300005367 Bacteria 4141
60 Ga0070667_100077562 3300005367 Bacteria 2837
61 Ga0070667_100117114 3300005367 Bacteria 2314
62 Ga0070709_10266291 3300005434 Unclassified 1240
63 Ga0070714_100199165 3300005435 Bacteria 1831
64 Ga0070714_101198134 3300005435 Unclassified 741
65 Ga0070710_10333040 3300005437 Bacteria 1000
66 Ga0070701_10922366 3300005438 Unclassified 604
67 Ga0070705_101261290 3300005440 Unclassified 611
68 Ga0070663_100001839 3300005455 Bacteria 11825
69 Ga0070663_101998039 3300005455 Unclassified 522
70 Ga0070678_100005678 3300005456 Bacteria 7248
71 Ga0070678_100129922 3300005456 Bacteria 1999
72 Ga0070662_100000010 3300005457 Bacteria 142717
73 Ga0070662_100010061 3300005457 Bacteria 6198
74 Ga0070662_100193084 3300005457 Bacteria 1612
75 Ga0070662_101336332 3300005457 Bacteria 617
76 Ga0070662_101559038 3300005457 Bacteria 570
77 Ga0070681_10325093 3300005458 Bacteria 1448
78 Ga0070681_10804998 3300005458 Unclassified 857
79 Ga0068867_100324939 3300005459 Bacteria 1276
80 Ga0070685_10294036 3300005466 Bacteria 1092
81 Ga0070679_100817587 3300005530 Bacteria 875
82 Ga0070684_100029987 3300005535 Bacteria 4617
83 Ga0068853_100000067 3300005539 Bacteria 73891
84 Ga0068853_100298456 3300005539 Bacteria 1489
85 Ga0068853_101553526 3300005539 Unclassified 641
86 Ga0070672_100046264 3300005543 Bacteria 3371
87 Ga0070672_100270386 3300005543 Bacteria 1435
88 Ga0070672_101535247 3300005543 Unclassified 597
89 Ga0070696_101779953 3300005546 Unclassified 532
90 Ga0070693_100000343 3300005547 Bacteria 21190
91 Ga0070665_100013969 3300005548 Bacteria 8076
92 Ga0070665_100205734 3300005548 Bacteria 1969
93 Ga0070665_100220517 3300005548 Bacteria 1897
94 Ga0068855_100017249 3300005563 Bacteria 8690
95 Ga0068855_100086792 3300005563 Bacteria 3618
96 Ga0070664_100000228 3300005564 Bacteria 40132
97 Ga0070664_100028970 3300005564 Bacteria 4613
98 Ga0070664_100052448 3300005564 Bacteria 3455
99 Ga0070664_101025482 3300005564 Bacteria 776
100 Ga0068857_100476144 3300005577 Bacteria 1170
101 Ga0068857_100866677 3300005577 Unclassified 865
102 Ga0068854_100419341 3300005578 Bacteria 1111
103 Ga0068854_100659290 3300005578 Unclassified 899
104 Ga0068854_101354998 3300005578 Bacteria 642
105 Ga0068854_101964398 3300005578 Unclassified 539
106 Ga0068856_100000101 3300005614 Bacteria 82391
107 Ga0068856_100211707 3300005614 Bacteria 1954
108 Ga0068856_102272897 3300005614 Bacteria 551
109 Ga0068852_100001433 3300005616 Bacteria 16088
110 Ga0068852_100031424 3300005616 Bacteria 4381
111 Ga0068852_100075087 3300005616 Bacteria 2980
112 Ga0068852_100240180 3300005616 Bacteria 1731
113 Ga0068852_100540684 3300005616 Bacteria 1164
114 Ga0068859_100123735 3300005617 Bacteria 2654
115 Ga0068864_100001115 3300005618 Bacteria 22458
116 Ga0068864_100010454 3300005618 Bacteria 7669
117 Ga0068864_100212942 3300005618 Bacteria 1780
118 Ga0068851_10021425 3300005834 Bacteria 3138
119 Ga0068851_10037978 3300005834 Bacteria 2415
120 Ga0068851_10870702 3300005834 Unclassified 563
121 Ga0068863_100037555 3300005841 Bacteria 4611
122 Ga0068863_100217410 3300005841 Bacteria 1840
123 Ga0068863_100313128 3300005841 Bacteria 1524
124 Ga0068858_100024591 3300005842 Bacteria 5611
125 Ga0068858_100032065 3300005842 Bacteria 4881
126 Ga0068858_102472300 3300005842 Bacteria 513
127 Ga0068860_100061977 3300005843 Bacteria 3554
128 Ga0068860_100568129 3300005843 Bacteria 1137
129 Ga0070717_11004637 3300006028 Bacteria 760
130 Ga0070717_11569939 3300006028 Bacteria 597
131 Ga0097621_100197884 3300006237 Bacteria 1743
132 Ga0097621_100277560 3300006237 Bacteria 1474
133 Ga0097621_100460279 3300006237 Bacteria 1147
134 Ga0068871_100547113 3300006358 Unclassified 1048
135 Ga0068871_100689963 3300006358 Bacteria 935
136 Ga0068871_102175234 3300006358 Unclassified 529
137 Ga0068871_102197249 3300006358 Unclassified 526
138 Ga0068865_100588711 3300006881 Unclassified 939
139 Ga0097620_100123735 3300006931 Bacteria 2654
140 Ga0105240_10273972 3300009093 Bacteria 1942
141 Ga0105243_12099296 3300009148 Unclassified 601
142 Ga0105241_10136220 3300009174 Bacteria 1994
143 Ga0105248_10000334 3300009177 Bacteria 55634
144 Ga0105248_10015208 3300009177 Bacteria 8480
145 Ga0105248_10067081 3300009177 Bacteria 4028
146 Ga0105248_10154957 3300009177 Bacteria 2585
147 Ga0105248_10174306 3300009177 Bacteria 2424
148 Ga0105248_11692499 3300009177 Bacteria 717
149 Ga0105237_10503694 3300009545 Bacteria 1217
150 Ga0105238_10044152 3300009551 Bacteria 4507
151 Ga0105238_10109195 3300009551 Bacteria 2748
152 Ga0105239_10266721 3300010375 Bacteria 1925
153 Ga0157318_1007782 3300012482 Bacteria 738
154 Ga0157373_10102935 3300013100 Bacteria 2009
155 Ga0157373_10157669 3300013100 Bacteria 1597
156 Ga0157373_10519788 3300013100 Bacteria 861
157 Ga0157373_11291080 3300013100 Unclassified 552
158 Ga0157371_10003821 3300013102 Bacteria 13450
159 Ga0157371_10630106 3300013102 Bacteria 799
160 Ga0157371_11193682 3300013102 Unclassified 586
161 Ga0157371_11422455 3300013102 Unclassified 539
162 Ga0157370_10000244 3300013104 Bacteria 69583
163 Ga0157370_10247249 3300013104 Bacteria 1650
164 Ga0157370_10536985 3300013104 Unclassified 1072
165 Ga0157370_10720378 3300013104 Bacteria 910
166 Ga0157369_10360215 3300013105 Bacteria 1510
167 Ga0157369_10963517 3300013105 Bacteria 874
168 Ga0157369_11976450 3300013105 Unclassified 592
169 Ga0157374_10013752 3300013296 Bacteria 7069
170 Ga0157374_11951478 3300013296 Bacteria 613
171 Ga0157378_11456806 3300013297 Bacteria 729
172 Ga0157378_11704620 3300013297 Unclassified 677
173 Ga0163162_10005022 3300013306 Bacteria 12743
174 Ga0163162_10433522 3300013306 Bacteria 1446
175 Ga0157372_10098864 3300013307 Bacteria 3329
176 Ga0157372_11307750 3300013307 Bacteria 837
177 Ga0157375_10014732 3300013308 Bacteria 6988
178 Ga0157375_13005437 3300013308 Unclassified 563
179 Ga0163163_10019125 3300014325 Bacteria 6427
180 Ga0163163_10138524 3300014325 Bacteria 2475
181 Ga0163163_12716908 3300014325 Unclassified 552
182 Ga0157379_11022931 3300014968 Bacteria 788
183 Ga0163161_11658915 3300017792 Unclassified 565
184 Ga0207697_10203650 3300025315 Bacteria 871
185 Ga0207656_10028082 3300025321 Bacteria 2307
186 Ga0207656_10052571 3300025321 Bacteria 1765
187 Ga0207692_10178101 3300025898 Bacteria 1237
188 Ga0207680_10028082 3300025903 Bacteria 3143
189 Ga0207680_10042101 3300025903 Bacteria 2669
190 Ga0207680_10118801 3300025903 Bacteria 1726
191 Ga0207647_10008390 3300025904 Bacteria 7410
192 Ga0207699_10275950 3300025906 Bacteria 1166
193 Ga0207705_10000113 3300025909 Bacteria 90567
194 Ga0207705_10327420 3300025909 Bacteria 1178
195 Ga0207705_10357486 3300025909 Bacteria 1126
196 Ga0207705_10502982 3300025909 Bacteria 941
197 Ga0207654_10147402 3300025911 Bacteria 1507
198 Ga0207707_10233605 3300025912 Bacteria 1600
199 Ga0207707_10580808 3300025912 Bacteria 950
200 Ga0207695_10805214 3300025913 Bacteria 820
201 Ga0207671_10726669 3300025914 Bacteria 789
202 Ga0207663_10472478 3300025916 Bacteria 970
203 Ga0207660_10035886 3300025917 Bacteria 3444
204 Ga0207657_10000026 3300025919 Bacteria 143118
205 Ga0207657_10022573 3300025919 Bacteria 5883
206 Ga0207657_10245392 3300025919 Bacteria 1429
207 Ga0207657_10765813 3300025919 Unclassified 747
208 Ga0207649_10000516 3300025920 Bacteria 27112
209 Ga0207649_10060258 3300025920 Bacteria 2384
210 Ga0207649_10293826 3300025920 Bacteria 1186
211 Ga0207649_10492317 3300025920 Bacteria 931
212 Ga0207652_10399645 3300025921 Bacteria 1240
213 Ga0207694_10139317 3300025924 Bacteria 1950
214 Ga0207694_11039184 3300025924 Bacteria 693
215 Ga0207650_10126355 3300025925 Bacteria 1996
216 Ga0207650_10229925 3300025925 Bacteria 1495
217 Ga0207650_10847891 3300025925 Bacteria 775
218 Ga0207650_10984417 3300025925 Unclassified 717
219 Ga0207659_11443816 3300025926 Unclassified 589
220 Ga0207700_10164834 3300025928 Bacteria 1843
221 Ga0207700_11119982 3300025928 Bacteria 704
222 Ga0207664_10444172 3300025929 Bacteria 1157
223 Ga0207664_10569923 3300025929 Bacteria 1016
224 Ga0207664_10629470 3300025929 Unclassified 964
225 Ga0207664_11192478 3300025929 Bacteria 679
226 Ga0207664_11316812 3300025929 Unclassified 642
227 Ga0207644_10003401 3300025931 Bacteria 10268
228 Ga0207644_10014952 3300025931 Bacteria 5203
229 Ga0207644_10015901 3300025931 Bacteria 5059
230 Ga0207644_10041735 3300025931 Bacteria 3247
231 Ga0207644_10074803 3300025931 Bacteria 2487
232 Ga0207644_10428562 3300025931 Bacteria 1084
233 Ga0207644_11568057 3300025931 Bacteria 552
234 Ga0207644_11600748 3300025931 Bacteria 546
235 Ga0207690_10000649 3300025932 Bacteria 22307
236 Ga0207690_10165085 3300025932 Bacteria 1654
237 Ga0207690_10173278 3300025932 Bacteria 1618
238 Ga0207706_10000031 3300025933 Bacteria 143109
239 Ga0207706_10013898 3300025933 Bacteria 7301
240 Ga0207706_10019552 3300025933 Bacteria 6093
241 Ga0207706_10999179 3300025933 Bacteria 703
242 Ga0207669_11027653 3300025937 Bacteria 693
243 Ga0207691_10062872 3300025940 Bacteria 3367
244 Ga0207691_10379049 3300025940 Bacteria 1208
245 Ga0207691_10727025 3300025940 Bacteria 836
246 Ga0207691_11303915 3300025940 Unclassified 600
247 Ga0207711_10000446 3300025941 Bacteria 43126
248 Ga0207711_10083935 3300025941 Bacteria 2787
249 Ga0207711_10297449 3300025941 Bacteria 1488
250 Ga0207711_11213985 3300025941 Bacteria 696
251 Ga0207661_10013965 3300025944 Bacteria 5873
252 Ga0207679_10000236 3300025945 Bacteria 42583
253 Ga0207679_10014432 3300025945 Bacteria 5196
254 Ga0207667_10001718 3300025949 Bacteria 27571
255 Ga0207667_10068007 3300025949 Bacteria 3710
256 Ga0207667_10225601 3300025949 Bacteria 1919
257 Ga0207651_10096938 3300025960 Bacteria 2176
258 Ga0207651_10126479 3300025960 Bacteria 1948
259 Ga0207651_10184839 3300025960 Bacteria 1657
260 Ga0207640_10283003 3300025981 Bacteria 1303
261 Ga0207640_10493551 3300025981 Bacteria 1018
262 Ga0207640_10583436 3300025981 Bacteria 944
263 Ga0207640_10639631 3300025981 Bacteria 905
264 Ga0207640_10824171 3300025981 Unclassified 805
265 Ga0207658_10087834 3300025986 Bacteria 2402
266 Ga0207658_10264045 3300025986 Bacteria 1468
267 Ga0207677_10263293 3300026023 Bacteria 1406
268 Ga0207703_10023076 3300026035 Bacteria 4886
269 Ga0207639_10005817 3300026041 Bacteria 8356
270 Ga0207678_10012250 3300026067 Bacteria 7530
271 Ga0207678_11221944 3300026067 Unclassified 665
272 Ga0207702_10010631 3300026078 Bacteria 7690
273 Ga0207702_10171068 3300026078 Bacteria 1992
274 Ga0207702_11175992 3300026078 Unclassified 761
275 Ga0207641_10030562 3300026088 Bacteria 4462
276 Ga0207641_10166724 3300026088 Bacteria 2007
277 Ga0207641_10244771 3300026088 Bacteria 1672
278 Ga0207648_10393897 3300026089 Unclassified 1254
279 Ga0207676_10013309 3300026095 Bacteria 5909
280 Ga0207676_10023129 3300026095 Bacteria 4580
281 Ga0207676_10102557 3300026095 Bacteria 2375
282 Ga0207676_10195959 3300026095 Bacteria 1781
283 Ga0207674_10276458 3300026116 Bacteria 1627
284 Ga0207674_10676890 3300026116 Bacteria 996
285 Ga0207683_10009545 3300026121 Bacteria 8270
286 Ga0207683_10041474 3300026121 Bacteria 4019
287 Ga0207698_10004076 3300026142 Bacteria 8868
288 Ga0207698_10101201 3300026142 Bacteria 2389
289 Ga0207698_11066074 3300026142 Bacteria 820
290 Ga0207698_11220693 3300026142 Bacteria 766
291 Ga0268266_10005677 3300028379 Bacteria 11570
292 Ga0268266_10426468 3300028379 Bacteria 1257
293 Ga0307414_11434722 3300032004 Unclassified 642
294 Ga0307411_10006616 3300032005 Bacteria 5815
295 Ga0307415_100092693 3300032126 Bacteria 2191
296 Ga0373939_0157766 3300035114 Bacteria 831
297 Ga0373960_0019533 3300035121 Bacteria 1781
298 Ga0373931_0026299 3300035691 Bacteria 2961
299 Ga0373931_0436632 3300035691 Bacteria 835
300 Ga0395899_0000154 3300037312 Bacteria 104239
301 Ga0395899_0007887 3300037312 Bacteria 8203
302 Ga0395899_0035072 3300037312 Bacteria 3767
303 Ga0395899_0080248 3300037312 Bacteria 2375
304 Ga0395899_0207620 3300037312 Bacteria 1362
305 Ga0395899_0300352 3300037312 Bacteria 1086
306 Ga0395899_0401219 3300037312 Bacteria 907
307 Ga0395899_0412579 3300037312 Bacteria 891
308 Ga0395899_0439882 3300037312 Unclassified 856
309 Ga0395899_0513867 3300037312 Bacteria 775
310 Ga0395900_0000293 3300037418 Bacteria 75318
311 Ga0395900_0002203 3300037418 Bacteria 21776
312 Ga0395900_0029788 3300037418 Bacteria 5602
313 Ga0395900_0088351 3300037418 Bacteria 3186
314 Ga0395900_0116563 3300037418 Bacteria 2741
315 Ga0395900_0126684 3300037418 Bacteria 2619
316 Ga0395900_0137607 3300037418 Bacteria 2502
317 Ga0395900_0146037 3300037418 Bacteria 2418
318 Ga0395900_0300007 3300037418 Bacteria 1593
319 Ga0395900_0480825 3300037418 Bacteria 1194
320 Ga0395900_0513860 3300037418 Bacteria 1146
321 Ga0395900_1463255 3300037418 Unclassified 595
322 Ga0395898_0000219 3300037466 Bacteria 146838
323 Ga0395898_0000732 3300037466 Bacteria 57501
324 Ga0395898_0059591 3300037466 Bacteria 3712
325 Ga0395898_0069072 3300037466 Bacteria 3419
326 Ga0395898_0089142 3300037466 Bacteria 2969
327 Ga0395898_0142033 3300037466 Bacteria 2298
328 Ga0395898_0178664 3300037466 Bacteria 2028
329 Ga0395898_0228959 3300037466 Bacteria 1773
330 Ga0395898_0401842 3300037466 Bacteria 1306
331 Ga0395898_0466685 3300037466 Unclassified 1201
332 Ga0395898_1010174 3300037466 Bacteria 767
333 Ga0395898_1976995 3300037466 Bacteria 502
334 Ga0395905_0000092 3300037471 Bacteria 149300
335 Ga0395905_0000094 3300037471 Bacteria 147776
336 Ga0395905_0001442 3300037471 Bacteria 28630
337 Ga0395905_0019018 3300037471 Bacteria 6514
338 Ga0395905_0028428 3300037471 Bacteria 5271
339 Ga0395905_0145672 3300037471 Bacteria 2228
340 Ga0395905_0452796 3300037471 Bacteria 1181
341 Ga0395905_0772445 3300037471 Bacteria 863
342 Ga0395905_0925860 3300037471 Bacteria 775
343 Ga0395905_0927803 3300037471 Bacteria 773
344 Ga0395905_1449069 3300037471 Bacteria 591
345 Ga0395905_1615014 3300037471 Bacteria 553
346 Ga0395905_1809526 3300037471 Bacteria 516
347 Ga0395901_0000228 3300038443 Bacteria 70677
348 Ga0395901_0006463 3300038443 Bacteria 11870
349 Ga0395901_0006785 3300038443 Bacteria 11563
350 Ga0395901_0035157 3300038443 Bacteria 5177
351 Ga0395901_0037677 3300038443 Bacteria 5000
352 Ga0395901_0080303 3300038443 Bacteria 3405
353 Ga0395901_0128024 3300038443 Bacteria 2669
354 Ga0395901_0193046 3300038443 Bacteria 2135
355 Ga0395901_0198418 3300038443 Bacteria 2103
356 Ga0395901_0240740 3300038443 Bacteria 1887
357 Ga0395901_1153137 3300038443 Unclassified 743
358 Ga0395901_1395592 3300038443 Unclassified 659
359 Ga0439458_0002668 3300042157 Bacteria 4305
360 Ga0466969_0245730 3300044656 Bacteria 811
361 Ga0466972_0068184 3300044658 Bacteria 1699
362 Ga0466972_0094802 3300044658 Unclassified 1414
363 Ga0466972_0127292 3300044658 Bacteria 1200
364 Ga0466965_0610915 3300044683 Bacteria 620
365 Ga0466966_0020323 3300044684 Bacteria 4368
366 Ga0466966_0024746 3300044684 Bacteria 3927
367 Ga0466966_0155221 3300044684 Bacteria 1395
368 Ga0466966_0182663 3300044684 Bacteria 1273
369 Ga0466966_0506393 3300044684 Bacteria 726
370 Ga0466961_0025708 3300044693 Bacteria 3785
371 Ga0466961_0108825 3300044693 Bacteria 1744
372 Ga0466963_0181977 3300044694 Bacteria 1467
373 Ga0466963_0716526 3300044694 Unclassified 706
374 Ga0466963_0718102 3300044694 Unclassified 705
375 Ga0466963_1079290 3300044694 Bacteria 565
376 Ga0466964_0036563 3300044706 Bacteria 1969
377 Ga0466964_0045773 3300044706 Unclassified 1782
378 Ga0466964_0047266 3300044706 Bacteria 1756
379 Ga0466964_0076843 3300044706 Bacteria 1425
380 Ga0466971_0042996 3300044719 Bacteria 2031
381 Ga0466971_0152191 3300044719 Bacteria 1080
382 Ga0466971_0192593 3300044719 Bacteria 961
383 Ga0466971_0351588 3300044719 Bacteria 713
384 Ga0466971_0440663 3300044719 Bacteria 638
385 Ga0466968_0026015 3300044735 Bacteria 2399
386 Ga0466970_0117834 3300044765 Bacteria 1453
387 Ga0466970_0247223 3300044765 Bacteria 999
388 Ga0466970_0399160 3300044765 Bacteria 784
389 Ga0466957_0035844 3300044842 Bacteria 2978
390 Ga0466957_0099961 3300044842 Bacteria 1827
391 Ga0466957_0240002 3300044842 Bacteria 1202
392 Ga0466957_0319312 3300044842 Bacteria 1048
393 Ga0466957_0509346 3300044842 Bacteria 835
394 Ga0466957_0772708 3300044842 Bacteria 681
395 Ga0466960_0106491 3300044901 Bacteria 1451
396 Ga0466959_0060338 3300045049 Bacteria 2759
397 Ga0466959_0115192 3300045049 Bacteria 1915
398 Ga0466959_0499788 3300045049 Bacteria 822
399 Ga0466958_0020076 3300045836 Bacteria 3895
400 Ga0466958_0041287 3300045836 Bacteria 2774
401 Ga0466958_0078557 3300045836 Bacteria 2028
402 Ga0466958_0561133 3300045836 Bacteria 742
403 Ga0466967_0046360 3300045976 Bacteria 3784
404 Ga0466967_0057272 3300045976 Bacteria 3440
405 Ga0466967_0066724 3300045976 Bacteria 3207
406 Ga0466967_0070744 3300045976 Bacteria 3121
407 Ga0466967_0082213 3300045976 Bacteria 2910
408 Ga0466967_0132721 3300045976 Bacteria 2313
409 Ga0466967_0165243 3300045976 Bacteria 2079
410 Ga0466967_0230198 3300045976 Bacteria 1764
411 Ga0466967_0237137 3300045976 Bacteria 1739
412 Ga0466967_0370017 3300045976 Bacteria 1390
413 Ga0466967_0408786 3300045976 Bacteria 1321
414 Ga0466967_0429842 3300045976 Bacteria 1288
415 Ga0466967_1567656 3300045976 Bacteria 656
416 Ga0466967_2541504 3300045976 Unclassified 507
417 Ga0495642_0375108 3300046528 Bacteria 626
418 Ga0495669_0020913 3300046684 Bacteria 2835
419 Ga0495669_0278216 3300046684 Bacteria 805
420 Ga0495677_0085850 3300047445 Bacteria 1183
421 Ga0496100_0041669 3300048903 Bacteria 2928
422 Ga0496100_1517025 3300048903 Unclassified 529
423 Ga0496101_0013698 3300048904 Bacteria 5438
424 Ga0496101_0122017 3300048904 Bacteria 1971
425 Ga0496101_0332734 3300048904 Bacteria 1192
426 Ga0496101_0747094 3300048904 Bacteria 772
427 Ga0496102_0247444 3300048905 Bacteria 1681
428 Ga0496106_0035924 3300048909 Bacteria 3707
429 Ga0496106_0059454 3300048909 Bacteria 2895
430 Ga0496106_0688319 3300048909 Bacteria 815
431 Ga0496106_1017079 3300048909 Unclassified 651
432 Ga0496107_0051794 3300048910 Bacteria 2961
433 Ga0496107_0087209 3300048910 Bacteria 2278
434 Ga0496107_0883365 3300048910 Unclassified 652
435 Ga0496108_0057379 3300048911 Bacteria 3271
436 Ga0496108_0067739 3300048911 Bacteria 3011
437 Ga0496108_0160330 3300048911 Bacteria 1944
438 Ga0496109_0016667 3300048912 Bacteria 6427
439 Ga0496109_0030129 3300048912 Bacteria 4863
440 Ga0496109_1116546 3300048912 Bacteria 725
441 Ga0496109_1338532 3300048912 Unclassified 652
442 Ga0496110_0056347 3300048913 Bacteria 3459
443 Ga0496110_0091012 3300048913 Bacteria 2728
444 Ga0496111_0238842 3300048914 Bacteria 1349
445 Ga0496111_0259868 3300048914 Bacteria 1288
446 Ga0496112_0007583 3300048915 Bacteria 9641
447 Ga0496112_0028960 3300048915 Bacteria 5352
448 Ga0496112_0055178 3300048915 Bacteria 3906
449 Ga0496112_1238795 3300048915 Bacteria 662
450 Ga0496113_0022523 3300048916 Bacteria 4458
451 Ga0496113_0106368 3300048916 Bacteria 2179
452 Ga0496113_0277883 3300048916 Bacteria 1339
453 Ga0496114_0061958 3300048917 Bacteria 3130
454 Ga0496114_1394728 3300048917 Bacteria 588
455 Ga0496115_0017809 3300048918 Bacteria 5440
456 Ga0501069_0234424 3300049585 Bacteria 1069
457 Ga0466962_0100535 3300061719 Bacteria 1388
458 Ga0466962_0705429 3300061719 Unclassified 518
459 Ga0466962_0720433 3300061719 Unclassified 512
460 Ga0466963_0043470
461 JGI24752J21851_1015583
462 JGI24740J21852_10020439
463 JGI24739J22299_10014203
464 JGI24737J22298_10001371
465 JGI24735J21928_10036920
466 JGI24738J21930_10001979
467 JGI24738J21930_10092396
468 JGI24738J21930_10094584
469 JGI24738J21930_10111790
470 JGI24034J26672_10025940
471 Ga0065712_10140218
472 Ga0065715_10744617
473 Ga0070658_10000477
474 Ga0070658_10136649
475 Ga0070658_10542081
476 Ga0070658_10649680
477 Ga0070683_100000747
478 Ga0070690_101397998
479 Ga0070690_101609132
480 Ga0070670_100029933
481 Ga0070670_100311031
482 Ga0070670_100866568
483 Ga0070677_10351695
484 Ga0070666_10002947
485 Ga0070666_10079450
486 Ga0070666_10775160
487 Ga0070680_100037588
488 Ga0070682_100149023
489 Ga0068868_100111118
490 Ga0068868_101780115
491 Ga0070660_100000425
492 Ga0070660_100074144
493 Ga0070660_100447963
494 Ga0070660_100941896
495 Ga0070687_101267314
496 Ga0070661_100000552
497 Ga0070661_100039116
498 Ga0070661_100091236
499 Ga0070661_100284890
500 Ga0070661_101800091
501 Ga0070692_10153919
502 Ga0070668_101114509
503 Ga0070675_100075660
504 Ga0070675_101735820
505 Ga0070671_100001542
506 Ga0070671_100001614
507 Ga0070671_100005726
508 Ga0070671_100054554
509 Ga0070671_100091040
510 Ga0070671_101896646
511 Ga0070674_100852876
512 Ga0070673_100158640
513 Ga0070673_100203929
514 Ga0070673_100228776
515 Ga0070659_100000065
516 Ga0070659_100039374
517 Ga0070659_100135840
518 Ga0070667_100036142
519 Ga0070667_100077562
520 Ga0070667_100117114
521 Ga0070709_10266291
522 Ga0070714_100199165
523 Ga0070714_101198134
524 Ga0070710_10333040
525 Ga0070701_10922366
526 Ga0070705_101261290
527 Ga0070663_100001839
528 Ga0070663_101998039
529 Ga0070678_100005678
530 Ga0070678_100129922
531 Ga0070662_100000010
532 Ga0070662_100010061
533 Ga0070662_100193084
534 Ga0070662_101336332
535 Ga0070662_101559038
536 Ga0070681_10325093
537 Ga0070681_10804998
538 Ga0068867_100324939
539 Ga0070685_10294036
540 Ga0070679_100817587
541 Ga0070684_100029987
542 Ga0068853_100000067
543 Ga0068853_100298456
544 Ga0068853_101553526
545 Ga0070672_100046264
546 Ga0070672_100270386
547 Ga0070672_101535247
548 Ga0070696_101779953
549 Ga0070693_100000343
550 Ga0070665_100013969
551 Ga0070665_100205734
552 Ga0070665_100220517
553 Ga0068855_100017249
554 Ga0068855_100086792
555 Ga0070664_100000228
556 Ga0070664_100028970
557 Ga0070664_100052448
558 Ga0070664_101025482
559 Ga0068857_100476144
560 Ga0068857_100866677
561 Ga0068854_100419341
562 Ga0068854_100659290
563 Ga0068854_101354998
564 Ga0068854_101964398
565 Ga0068856_100000101
566 Ga0068856_100211707
567 Ga0068856_102272897
568 Ga0068852_100001433
569 Ga0068852_100031424
570 Ga0068852_100075087
571 Ga0068852_100240180
572 Ga0068852_100540684
573 Ga0068859_100123735
574 Ga0068864_100001115
575 Ga0068864_100010454
576 Ga0068864_100212942
577 Ga0068851_10021425
578 Ga0068851_10037978
579 Ga0068851_10870702
580 Ga0068863_100037555
581 Ga0068863_100217410
582 Ga0068863_100313128
583 Ga0068858_100024591
584 Ga0068858_100032065
585 Ga0068858_102472300
586 Ga0068860_100061977
587 Ga0068860_100568129
588 Ga0070717_11004637
589 Ga0070717_11569939
590 Ga0097621_100197884
591 Ga0097621_100277560
592 Ga0097621_100460279
593 Ga0068871_100547113
594 Ga0068871_100689963
595 Ga0068871_102175234
596 Ga0068871_102197249
597 Ga0068865_100588711
598 Ga0097620_100123735
599 Ga0105240_10273972
600 Ga0105243_12099296
601 Ga0105241_10136220
602 Ga0105248_10000334
603 Ga0105248_10015208
604 Ga0105248_10067081
605 Ga0105248_10154957
606 Ga0105248_10174306
607 Ga0105248_11692499
608 Ga0105237_10503694
609 Ga0105238_10044152
610 Ga0105238_10109195
611 Ga0105239_10266721
612 Ga0157318_1007782
613 Ga0157373_10102935
614 Ga0157373_10157669
615 Ga0157373_10519788
616 Ga0157373_11291080
617 Ga0157371_10003821
618 Ga0157371_10630106
619 Ga0157371_11193682
620 Ga0157371_11422455
621 Ga0157370_10000244
622 Ga0157370_10247249
623 Ga0157370_10536985
624 Ga0157370_10720378
625 Ga0157369_10360215
626 Ga0157369_10963517
627 Ga0157369_11976450
628 Ga0157374_10013752
629 Ga0157374_11951478
630 Ga0157378_11456806
631 Ga0157378_11704620
632 Ga0163162_10005022
633 Ga0163162_10433522
634 Ga0157372_10098864
635 Ga0157372_11307750
636 Ga0157375_10014732
637 Ga0157375_13005437
638 Ga0163163_10019125
639 Ga0163163_10138524
640 Ga0163163_12716908
641 Ga0157379_11022931
642 Ga0163161_11658915
643 Ga0207697_10203650
644 Ga0207656_10028082
645 Ga0207656_10052571
646 Ga0207692_10178101
647 Ga0207680_10028082
648 Ga0207680_10042101
649 Ga0207680_10118801
650 Ga0207647_10008390
651 Ga0207699_10275950
652 Ga0207705_10000113
653 Ga0207705_10327420
654 Ga0207705_10357486
655 Ga0207705_10502982
656 Ga0207654_10147402
657 Ga0207707_10233605
658 Ga0207707_10580808
659 Ga0207695_10805214
660 Ga0207671_10726669
661 Ga0207663_10472478
662 Ga0207660_10035886
663 Ga0207657_10000026
664 Ga0207657_10022573
665 Ga0207657_10245392
666 Ga0207657_10765813
667 Ga0207649_10000516
668 Ga0207649_10060258
669 Ga0207649_10293826
670 Ga0207649_10492317
671 Ga0207652_10399645
672 Ga0207694_10139317
673 Ga0207694_11039184
674 Ga0207650_10126355
675 Ga0207650_10229925
676 Ga0207650_10847891
677 Ga0207650_10984417
678 Ga0207659_11443816
679 Ga0207700_10164834
680 Ga0207700_11119982
681 Ga0207664_10444172
682 Ga0207664_10569923
683 Ga0207664_10629470
684 Ga0207664_11192478
685 Ga0207664_11316812
686 Ga0207644_10003401
687 Ga0207644_10014952
688 Ga0207644_10015901
689 Ga0207644_10041735
690 Ga0207644_10074803
691 Ga0207644_10428562
692 Ga0207644_11568057
693 Ga0207644_11600748
694 Ga0207690_10000649
695 Ga0207690_10165085
696 Ga0207690_10173278
697 Ga0207706_10000031
698 Ga0207706_10013898
699 Ga0207706_10019552
700 Ga0207706_10999179
701 Ga0207669_11027653
702 Ga0207691_10062872
703 Ga0207691_10379049
704 Ga0207691_10727025
705 Ga0207691_11303915
706 Ga0207711_10000446
707 Ga0207711_10083935
708 Ga0207711_10297449
709 Ga0207711_11213985
710 Ga0207661_10013965
711 Ga0207679_10000236
712 Ga0207679_10014432
713 Ga0207667_10001718
714 Ga0207667_10068007
715 Ga0207667_10225601
716 Ga0207651_10096938
717 Ga0207651_10126479
718 Ga0207651_10184839
719 Ga0207640_10283003
720 Ga0207640_10493551
721 Ga0207640_10583436
722 Ga0207640_10639631
723 Ga0207640_10824171
724 Ga0207658_10087834
725 Ga0207658_10264045
726 Ga0207677_10263293
727 Ga0207703_10023076
728 Ga0207639_10005817
729 Ga0207678_10012250
730 Ga0207678_11221944
731 Ga0207702_10010631
732 Ga0207702_10171068
733 Ga0207702_11175992
734 Ga0207641_10030562
735 Ga0207641_10166724
736 Ga0207641_10244771
737 Ga0207648_10393897
738 Ga0207676_10013309
739 Ga0207676_10023129
740 Ga0207676_10102557
741 Ga0207676_10195959
742 Ga0207674_10276458
743 Ga0207674_10676890
744 Ga0207683_10009545
745 Ga0207683_10041474
746 Ga0207698_10004076
747 Ga0207698_10101201
748 Ga0207698_11066074
749 Ga0207698_11220693
750 Ga0268266_10005677
751 Ga0268266_10426468
752 Ga0307414_11434722
753 Ga0307411_10006616
754 Ga0307415_100092693
755 Ga0373939_0157766
756 Ga0373960_0019533
757 Ga0373931_0026299
758 Ga0373931_0436632
759 Ga0395899_0000154
760 Ga0395899_0007887
761 Ga0395899_0035072
762 Ga0395899_0080248
763 Ga0395899_0207620
764 Ga0395899_0300352
765 Ga0395899_0401219
766 Ga0395899_0412579
767 Ga0395899_0439882
768 Ga0395899_0513867
769 Ga0395900_0000293
770 Ga0395900_0002203
771 Ga0395900_0029788
772 Ga0395900_0088351
773 Ga0395900_0116563
774 Ga0395900_0126684
775 Ga0395900_0137607
776 Ga0395900_0146037
777 Ga0395900_0300007
778 Ga0395900_0480825
779 Ga0395900_0513860
780 Ga0395900_1463255
781 Ga0395898_0000219
782 Ga0395898_0000732
783 Ga0395898_0059591
784 Ga0395898_0069072
785 Ga0395898_0089142
786 Ga0395898_0142033
787 Ga0395898_0178664
788 Ga0395898_0228959
789 Ga0395898_0401842
790 Ga0395898_0466685
791 Ga0395898_1010174
792 Ga0395898_1976995
793 Ga0395905_0000092
794 Ga0395905_0000094
795 Ga0395905_0001442
796 Ga0395905_0019018
797 Ga0395905_0028428
798 Ga0395905_0145672
799 Ga0395905_0452796
800 Ga0395905_0772445
801 Ga0395905_0925860
802 Ga0395905_0927803
803 Ga0395905_1449069
804 Ga0395905_1615014
805 Ga0395905_1809526
806 Ga0395901_0000228
807 Ga0395901_0006463
808 Ga0395901_0006785
809 Ga0395901_0035157
810 Ga0395901_0037677
811 Ga0395901_0080303
812 Ga0395901_0128024
813 Ga0395901_0193046
814 Ga0395901_0198418
815 Ga0395901_0240740
816 Ga0395901_1153137
817 Ga0395901_1395592
818 Ga0439458_0002668
819 Ga0466969_0245730
820 Ga0466972_0068184
821 Ga0466972_0094802
822 Ga0466972_0127292
823 Ga0466965_0610915
824 Ga0466966_0020323
825 Ga0466966_0024746
826 Ga0466966_0155221
827 Ga0466966_0182663
828 Ga0466966_0506393
829 Ga0466961_0025708
830 Ga0466961_0108825
831 Ga0466963_0181977
832 Ga0466963_0716526
833 Ga0466963_0718102
834 Ga0466963_1079290
835 Ga0466964_0036563
836 Ga0466964_0045773
837 Ga0466964_0047266
838 Ga0466964_0076843
839 Ga0466971_0042996
840 Ga0466971_0152191
841 Ga0466971_0192593
842 Ga0466971_0351588
843 Ga0466971_0440663
844 Ga0466968_0026015
845 Ga0466970_0117834
846 Ga0466970_0247223
847 Ga0466970_0399160
848 Ga0466957_0035844
849 Ga0466957_0099961
850 Ga0466957_0240002
851 Ga0466957_0319312
852 Ga0466957_0509346
853 Ga0466957_0772708
854 Ga0466960_0106491
855 Ga0466959_0060338
856 Ga0466959_0115192
857 Ga0466959_0499788
858 Ga0466958_0020076
859 Ga0466958_0041287
860 Ga0466958_0078557
861 Ga0466958_0561133
862 Ga0466967_0046360
863 Ga0466967_0057272
864 Ga0466967_0066724
865 Ga0466967_0070744
866 Ga0466967_0082213
867 Ga0466967_0132721
868 Ga0466967_0165243
869 Ga0466967_0230198
870 Ga0466967_0237137
871 Ga0466967_0370017
872 Ga0466967_0408786
873 Ga0466967_0429842
874 Ga0466967_1567656
875 Ga0466967_2541504
876 Ga0495642_0375108
877 Ga0495669_0020913
878 Ga0495669_0278216
879 Ga0495677_0085850
880 Ga0496100_0041669
881 Ga0496100_1517025
882 Ga0496101_0013698
883 Ga0496101_0122017
884 Ga0496101_0332734
885 Ga0496101_0747094
886 Ga0496102_0247444
887 Ga0496106_0035924
888 Ga0496106_0059454
889 Ga0496106_0688319
890 Ga0496106_1017079
891 Ga0496107_0051794
892 Ga0496107_0087209
893 Ga0496107_0883365
894 Ga0496108_0057379
895 Ga0496108_0067739
896 Ga0496108_0160330
897 Ga0496109_0016667
898 Ga0496109_0030129
899 Ga0496109_1116546
900 Ga0496109_1338532
901 Ga0496110_0056347
902 Ga0496110_0091012
903 Ga0496111_0238842
904 Ga0496111_0259868
905 Ga0496112_0007583
906 Ga0496112_0028960
907 Ga0496112_0055178
908 Ga0496112_1238795
909 Ga0496113_0022523
910 Ga0496113_0106368
911 Ga0496113_0277883
912 Ga0496114_0061958
913 Ga0496114_1394728
914 Ga0496115_0017809
915 Ga0501069_0234424
916 Ga0466962_0100535
917 Ga0466962_0705429
918 Ga0466962_0720433

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04325

DUF465

Protein of unknown function (DUF465)

14

60

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4f7r-assembly2.cif.gz_C crystal structure of 14-3-3 protein from giardia intestinalis 0.9336 6 58
4lle-assembly2.cif.gz_C the crystal structure of r60l mutant of the histidine kinase (kinb) sensor domain from pseudomonas aeruginosa pa01 0.932 6 54
3n24-assembly3.cif.gz_F the crystal structure of a two-component sensor domain (3rd form) from pseudomonas aeruginosa pa01 0.9272 6 54
7exe-assembly1.cif.gz_A crystal structure of mouse 14-3-3zeta in complex with doubly phosphorylated adam22 peptide 0.9074 6 55
4lle-assembly1.cif.gz_B the crystal structure of r60l mutant of the histidine kinase (kinb) sensor domain from pseudomonas aeruginosa pa01 0.9068 7 54
ID Description Score Start End Superfamily
3kkbA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Histidine kinase (KinB), sensor domain 0.9506 6 54 1.20.120.880
af_P0AAA9_39_119_1.20.120.1490 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9411 6 58 1.20.120.1490
af_Q5ACW3_122_207_1.20.1280.20 Mainly Alpha;Up-down Bundle;Monooxygenase;HscB, C-terminal domain 0.9383 7 57 1.20.1280.20
af_P76235_3_421_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.9375 6 55 3.40.50.410
4lleC00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Histidine kinase (KinB), sensor domain 0.932 6 54 1.20.120.880
ID Description Score Start End GO Terms
AF-A0A445GVM5-F1-model_v4 Protein LSD1 isoform D 0.9829 6 58 GO:0005634
AF-A0A4Q8MBN6-F1-model_v4 deleted 0.9819 5 57
AF-A0A397QAT2-F1-model_v4 DUF465 domain-containing protein 0.9797 6 59
AF-A0A1B7XMS5-F1-model_v4 Zinc resistance-associated protein 0.9786 10 55
AF-A0A840I510-F1-model_v4 DUF465 domain-containing protein 0.9756 6 60

Map