F448389

General Info

Members Datasets Scaffolds Average Seq Length
459 220 918 197

Family's Representative Sequence

Representative Sequence 3300035691|Ga0373931_0011070|Ga0373931_0011070_2350_3045
Length 231
Sequence VGHDEPRAIQLTHHSLITHQEHIHMWKTDARLWLAALALGVSTGLTGCSDRTNDSSRSIVAPNVASRDVANDDAQGDEDDDTIYDQTDFLGNPLVSEVTIAKAHHGAYNRTQPYNTATFRTETEAFITSFGRPAGLATTLGSVLYPDMLVVDPSKNPNTAGWLSWALANGWGGRKLTDDVVDLGLTAIFSSFLTPVGALCPPFTLPLCTDNVSANDAAFSPTFPYLAAPHA

Samples

Sample ID Description Type Environment
1 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
180 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
193 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
214 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
215 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
216 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.31
Rhizosphere 98.04
Stem 0
Stem Tuber 0
Unclassified 19.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373931_0011070 3300035691 Bacteria 4350
2 MBSR1b_contig_844661 2162886012 Unclassified 1605
3 Ga0065712_10124546 3300005290 Bacteria 1624
4 Ga0065715_10002679 3300005293 Bacteria 5399
5 Ga0065715_10326718 3300005293 Bacteria 991
6 Ga0065707_10247014 3300005295 Unclassified 1137
7 Ga0070658_10254582 3300005327 Bacteria 1490
8 Ga0070658_10489525 3300005327 Bacteria 1062
9 Ga0070676_10206398 3300005328 Bacteria 1291
10 Ga0070676_10236172 3300005328 Bacteria 1214
11 Ga0070676_10284166 3300005328 Unclassified 1116
12 Ga0070683_100014074 3300005329 Bacteria 6987
13 Ga0070683_100036080 3300005329 Bacteria 4522
14 Ga0070683_100178960 3300005329 Unclassified 2013
15 Ga0070683_100221413 3300005329 Bacteria 1799
16 Ga0070683_100242733 3300005329 Bacteria 1713
17 Ga0070683_100457602 3300005329 Bacteria 1218
18 Ga0070683_101363073 3300005329 Unclassified 682
19 Ga0070690_100044030 3300005330 Bacteria 2832
20 Ga0070690_100245997 3300005330 Bacteria 1263
21 Ga0070690_100466334 3300005330 Bacteria 939
22 Ga0070670_100020074 3300005331 Bacteria 5739
23 Ga0070670_100191294 3300005331 Bacteria 1777
24 Ga0070670_100527613 3300005331 Bacteria 1052
25 Ga0070670_101375225 3300005331 Bacteria 647
26 Ga0070677_10137479 3300005333 Bacteria 1123
27 Ga0070677_10552875 3300005333 Bacteria 631
28 Ga0068869_100263615 3300005334 Bacteria 1380
29 Ga0070666_10144095 3300005335 Bacteria 1660
30 Ga0070666_10418468 3300005335 Bacteria 965
31 Ga0070680_100003560 3300005336 Bacteria 11622
32 Ga0070682_100141900 3300005337 Bacteria 1638
33 Ga0068868_100091155 3300005338 Bacteria 2456
34 Ga0068868_100260159 3300005338 Bacteria 1463
35 Ga0070689_100010241 3300005340 Bacteria 6679
36 Ga0070689_100064725 3300005340 Bacteria 2847
37 Ga0070689_100077209 3300005340 Bacteria 2610
38 Ga0070687_100314151 3300005343 Unclassified 999
39 Ga0070687_100400863 3300005343 Bacteria 899
40 Ga0070661_100014670 3300005344 Bacteria 5525
41 Ga0070661_100187343 3300005344 Bacteria 1577
42 Ga0070692_10037682 3300005345 Bacteria 2460
43 Ga0070668_100103132 3300005347 Bacteria 2263
44 Ga0070669_100007216 3300005353 Bacteria 7982
45 Ga0070669_100368223 3300005353 Bacteria 1170
46 Ga0070669_100373250 3300005353 Bacteria 1162
47 Ga0070675_100023291 3300005354 Bacteria 4950
48 Ga0070675_100047973 3300005354 Bacteria 3501
49 Ga0070675_100252652 3300005354 Bacteria 1543
50 Ga0070675_100339365 3300005354 Bacteria 1330
51 Ga0070675_100583956 3300005354 Bacteria 1013
52 Ga0070671_100134165 3300005355 Bacteria 2086
53 Ga0070671_100665822 3300005355 Bacteria 902
54 Ga0070671_100721169 3300005355 Unclassified 866
55 Ga0070673_100080493 3300005364 Bacteria 2639
56 Ga0070673_100099016 3300005364 Bacteria 2397
57 Ga0070673_100188297 3300005364 Bacteria 1771
58 Ga0070673_100469482 3300005364 Unclassified 1134
59 Ga0070673_100598940 3300005364 Bacteria 1005
60 Ga0070688_100074168 3300005365 Bacteria 2184
61 Ga0070688_100129804 3300005365 Bacteria 1699
62 Ga0070688_100342773 3300005365 Bacteria 1092
63 Ga0070659_100002190 3300005366 Bacteria 13907
64 Ga0070667_100032369 3300005367 Bacteria 4361
65 Ga0070667_100130479 3300005367 Unclassified 2193
66 Ga0070667_100163749 3300005367 Bacteria 1960
67 Ga0070667_100222292 3300005367 Bacteria 1681
68 Ga0070709_10059431 3300005434 Unclassified 2427
69 Ga0070701_10169556 3300005438 Bacteria 1270
70 Ga0070701_10324350 3300005438 Bacteria 954
71 Ga0070705_100009932 3300005440 Bacteria 4750
72 Ga0070700_100467349 3300005441 Unclassified 963
73 Ga0070700_100575283 3300005441 Bacteria 879
74 Ga0070694_100370325 3300005444 Bacteria 1115
75 Ga0070694_100622427 3300005444 Bacteria 871
76 Ga0070708_100000091 3300005445 Bacteria 59200
77 Ga0070678_100307325 3300005456 Bacteria 1349
78 Ga0070678_100379971 3300005456 Unclassified 1222
79 Ga0070662_100019601 3300005457 Bacteria 4594
80 Ga0070662_100021520 3300005457 Bacteria 4404
81 Ga0070662_100137977 3300005457 Unclassified 1887
82 Ga0070662_100589849 3300005457 Bacteria 934
83 Ga0070662_100642492 3300005457 Bacteria 895
84 Ga0070662_100699352 3300005457 Unclassified 857
85 Ga0070681_10275208 3300005458 Bacteria 1595
86 Ga0068867_100043439 3300005459 Bacteria 3290
87 Ga0070685_10005180 3300005466 Bacteria 6612
88 Ga0070706_100496161 3300005467 Bacteria 1136
89 Ga0070707_101120411 3300005468 Bacteria 753
90 Ga0070698_100018466 3300005471 Bacteria 7342
91 Ga0070698_100231964 3300005471 Bacteria 1779
92 Ga0070699_100016299 3300005518 Bacteria 6381
93 Ga0070699_100515986 3300005518 Bacteria 1086
94 Ga0070679_100008772 3300005530 Bacteria 9537
95 Ga0070679_100600800 3300005530 Bacteria 1044
96 Ga0070684_100030278 3300005535 Bacteria 4597
97 Ga0070684_100048534 3300005535 Bacteria 3683
98 Ga0070684_100092853 3300005535 Bacteria 2686
99 Ga0070684_100414010 3300005535 Bacteria 1244
100 Ga0070684_100601371 3300005535 Bacteria 1022
101 Ga0070684_100797376 3300005535 Unclassified 883
102 Ga0070697_100603166 3300005536 Unclassified 965
103 Ga0068853_100985374 3300005539 Bacteria 811
104 Ga0070672_100011637 3300005543 Bacteria 6140
105 Ga0070672_100041642 3300005543 Bacteria 3532
106 Ga0070672_100866576 3300005543 Bacteria 797
107 Ga0070672_101034048 3300005543 Unclassified 729
108 Ga0070693_100001077 3300005547 Bacteria 12211
109 Ga0070665_100404102 3300005548 Bacteria 1374
110 Ga0068855_100105017 3300005563 Bacteria 3248
111 Ga0070664_100137838 3300005564 Unclassified 2147
112 Ga0070664_100242744 3300005564 Bacteria 1617
113 Ga0070664_100298689 3300005564 Archaea 1455
114 Ga0070664_100300291 3300005564 Bacteria 1451
115 Ga0070664_100374049 3300005564 Bacteria 1299
116 Ga0070664_100757551 3300005564 Bacteria 906
117 Ga0068857_100007823 3300005577 Bacteria 9216
118 Ga0068857_100066356 3300005577 Unclassified 3211
119 Ga0068857_100111917 3300005577 Bacteria 2454
120 Ga0068857_100664907 3300005577 Unclassified 988
121 Ga0068857_100730993 3300005577 Bacteria 942
122 Ga0068854_100548966 3300005578 Bacteria 980
123 Ga0068856_100159136 3300005614 Bacteria 2269
124 Ga0068856_100159313 3300005614 Bacteria 2267
125 Ga0070702_100039475 3300005615 Bacteria 2634
126 Ga0070702_100224645 3300005615 Bacteria 1258
127 Ga0068852_100014555 3300005616 Bacteria 6061
128 Ga0068852_100022081 3300005616 Bacteria 5096
129 Ga0068852_100166720 3300005616 Bacteria 2061
130 Ga0068852_100415721 3300005616 Bacteria 1326
131 Ga0068859_100006405 3300005617 Bacteria 11945
132 Ga0068859_100065032 3300005617 Unclassified 3681
133 Ga0068859_100728175 3300005617 Unclassified 1082
134 Ga0068859_100845306 3300005617 Bacteria 1001
135 Ga0068859_101294418 3300005617 Unclassified 803
136 Ga0068864_100007489 3300005618 Bacteria 8994
137 Ga0068864_100190945 3300005618 Bacteria 1878
138 Ga0068866_10251707 3300005718 Bacteria 1081
139 Ga0068861_100515733 3300005719 Bacteria 1083
140 Ga0068870_10004673 3300005840 Bacteria 5914
141 Ga0068870_10006530 3300005840 Bacteria 5148
142 Ga0068863_100143979 3300005841 Bacteria 2279
143 Ga0068863_100169186 3300005841 Bacteria 2096
144 Ga0068858_100099965 3300005842 Bacteria 2705
145 Ga0068858_100119695 3300005842 Bacteria 2462
146 Ga0068860_100034770 3300005843 Bacteria 4835
147 Ga0068860_100097530 3300005843 Bacteria 2802
148 Ga0068862_100129420 3300005844 Bacteria 2231
149 Ga0068862_100266269 3300005844 Bacteria 1566
150 Ga0068862_100823277 3300005844 Unclassified 908
151 Ga0070716_100206020 3300006173 Bacteria 1311
152 Ga0097621_100287946 3300006237 Bacteria 1448
153 Ga0097621_100593477 3300006237 Bacteria 1012
154 Ga0068871_100010208 3300006358 Bacteria 6840
155 Ga0068871_100275320 3300006358 Bacteria 1471
156 Ga0075430_100037083 3300006846 Bacteria 4133
157 Ga0075431_100095394 3300006847 Unclassified 3070
158 Ga0075431_100401907 3300006847 Bacteria 1371
159 Ga0068865_100034629 3300006881 Bacteria 3390
160 Ga0068865_100050616 3300006881 Unclassified 2871
161 Ga0075436_100249363 3300006914 Bacteria 1264
162 Ga0097620_100006405 3300006931 Bacteria 11945
163 Ga0097620_100065025 3300006931 Unclassified 3681
164 Ga0097620_100728214 3300006931 Unclassified 1082
165 Ga0097620_100845318 3300006931 Bacteria 1001
166 Ga0097620_101294868 3300006931 Unclassified 803
167 Ga0105240_10046883 3300009093 Bacteria 5473
168 Ga0105240_10144805 3300009093 Bacteria 2837
169 Ga0111539_10096178 3300009094 Unclassified 3478
170 Ga0111539_10123872 3300009094 Bacteria 3030
171 Ga0111539_10219298 3300009094 Bacteria 2216
172 Ga0105245_10006891 3300009098 Bacteria 9964
173 Ga0105245_10096559 3300009098 Bacteria 2727
174 Ga0105245_10166145 3300009098 Bacteria 2098
175 Ga0105245_10270946 3300009098 Unclassified 1656
176 Ga0105243_10098319 3300009148 Bacteria 2424
177 Ga0105243_10365971 3300009148 Bacteria 1329
178 Ga0105241_10035622 3300009174 Bacteria 3743
179 Ga0105242_10004623 3300009176 Bacteria 10674
180 Ga0105242_10010304 3300009176 Bacteria 7166
181 Ga0105242_10117927 3300009176 Bacteria 2273
182 Ga0105242_10263382 3300009176 Bacteria 1558
183 Ga0105242_10404063 3300009176 Unclassified 1276
184 Ga0105248_10004111 3300009177 Bacteria 16093
185 Ga0105248_10019049 3300009177 Bacteria 7588
186 Ga0105248_10037306 3300009177 Bacteria 5437
187 Ga0105248_10801127 3300009177 Unclassified 1063
188 Ga0105248_11383699 3300009177 Unclassified 796
189 Ga0105248_11593457 3300009177 Bacteria 740
190 Ga0105237_10156041 3300009545 Bacteria 2279
191 Ga0105237_10516057 3300009545 Bacteria 1201
192 Ga0105237_10875986 3300009545 Bacteria 905
193 Ga0105249_10282646 3300009553 Unclassified 1658
194 Ga0105249_10816669 3300009553 Bacteria 997
195 Ga0105239_10016864 3300010375 Bacteria 8073
196 Ga0157373_10045092 3300013100 Bacteria 3148
197 Ga0157371_10008591 3300013102 Bacteria 8117
198 Ga0157370_10609476 3300013104 Bacteria 999
199 Ga0157369_10038405 3300013105 Bacteria 5236
200 Ga0157369_10463470 3300013105 Bacteria 1312
201 Ga0157369_10634800 3300013105 Bacteria 1102
202 Ga0157369_10967115 3300013105 Bacteria 872
203 Ga0157374_10004155 3300013296 Bacteria 12149
204 Ga0157374_10506329 3300013296 Unclassified 1212
205 Ga0157374_11194201 3300013296 Unclassified 782
206 Ga0157374_11228184 3300013296 Bacteria 771
207 Ga0157378_10492852 3300013297 Unclassified 1223
208 Ga0157378_10558810 3300013297 Bacteria 1151
209 Ga0163162_10275041 3300013306 Bacteria 1816
210 Ga0157372_10002537 3300013307 Bacteria 19815
211 Ga0157372_10082158 3300013307 Unclassified 3647
212 Ga0157372_10115056 3300013307 Unclassified 3083
213 Ga0157372_11653480 3300013307 Bacteria 737
214 Ga0157375_10011950 3300013308 Bacteria 7685
215 Ga0157375_10015667 3300013308 Bacteria 6790
216 Ga0157375_10023691 3300013308 Bacteria 5669
217 Ga0157375_10080957 3300013308 Bacteria 3286
218 Ga0157375_10504636 3300013308 Bacteria 1374
219 Ga0157375_10692171 3300013308 Bacteria 1173
220 Ga0163163_10023684 3300014325 Bacteria 5830
221 Ga0163163_10229210 3300014325 Bacteria 1907
222 Ga0157380_10117252 3300014326 Bacteria 2249
223 Ga0157380_10131186 3300014326 Unclassified 2138
224 Ga0157377_10009075 3300014745 Bacteria 4872
225 Ga0157376_10098003 3300014969 Unclassified 2555
226 Ga0157376_10154478 3300014969 Unclassified 2073
227 Ga0163161_10339526 3300017792 Bacteria 1191
228 Ga0163161_10683316 3300017792 Bacteria 853
229 Ga0213876_10057945 3300021384 Bacteria 2045
230 Ga0207697_10013390 3300025315 Bacteria 3423
231 Ga0207697_10038265 3300025315 Bacteria 1966
232 Ga0207656_10338418 3300025321 Bacteria 750
233 Ga0207682_10042534 3300025893 Bacteria 1857
234 Ga0207642_10180808 3300025899 Bacteria 1149
235 Ga0207688_10274572 3300025901 Bacteria 1026
236 Ga0207680_10332863 3300025903 Bacteria 1064
237 Ga0207647_10096459 3300025904 Bacteria 1760
238 Ga0207699_10329402 3300025906 Bacteria 1073
239 Ga0207645_10074866 3300025907 Bacteria 2167
240 Ga0207645_10194272 3300025907 Bacteria 1334
241 Ga0207645_10287853 3300025907 Bacteria 1092
242 Ga0207643_10004450 3300025908 Bacteria 7536
243 Ga0207643_10194830 3300025908 Bacteria 1231
244 Ga0207707_10230525 3300025912 Bacteria 1611
245 Ga0207671_10383988 3300025914 Bacteria 1116
246 Ga0207693_10175568 3300025915 Unclassified 1686
247 Ga0207662_10163463 3300025918 Bacteria 1423
248 Ga0207657_10009153 3300025919 Bacteria 9992
249 Ga0207649_10439823 3300025920 Bacteria 982
250 Ga0207652_10058141 3300025921 Bacteria 3331
251 Ga0207652_10185215 3300025921 Bacteria 1872
252 Ga0207681_10132868 3300025923 Bacteria 1842
253 Ga0207681_10165196 3300025923 Unclassified 1673
254 Ga0207694_10099775 3300025924 Bacteria 2300
255 Ga0207694_10137193 3300025924 Bacteria 1965
256 Ga0207650_10008725 3300025925 Bacteria 6923
257 Ga0207650_10219018 3300025925 Bacteria 1531
258 Ga0207659_10008945 3300025926 Bacteria 6242
259 Ga0207659_10142140 3300025926 Bacteria 1864
260 Ga0207659_10174039 3300025926 Unclassified 1700
261 Ga0207659_10325965 3300025926 Bacteria 1268
262 Ga0207687_10540414 3300025927 Unclassified 977
263 Ga0207687_10618751 3300025927 Bacteria 914
264 Ga0207644_10107934 3300025931 Bacteria 2101
265 Ga0207644_10765967 3300025931 Bacteria 807
266 Ga0207690_10025973 3300025932 Bacteria 3685
267 Ga0207706_10006727 3300025933 Bacteria 10627
268 Ga0207706_10056204 3300025933 Bacteria 3471
269 Ga0207686_10086634 3300025934 Unclassified 2058
270 Ga0207709_10044600 3300025935 Bacteria 2680
271 Ga0207670_10013221 3300025936 Bacteria 4857
272 Ga0207670_10057959 3300025936 Bacteria 2629
273 Ga0207670_10124294 3300025936 Unclassified 1880
274 Ga0207669_10071608 3300025937 Bacteria 2179
275 Ga0207704_10188648 3300025938 Bacteria 1497
276 Ga0207665_10249102 3300025939 Bacteria 1312
277 Ga0207691_10006804 3300025940 Bacteria 11024
278 Ga0207691_10030862 3300025940 Bacteria 5005
279 Ga0207691_10099969 3300025940 Bacteria 2589
280 Ga0207691_10721617 3300025940 Bacteria 840
281 Ga0207711_10157232 3300025941 Bacteria 2055
282 Ga0207711_10305287 3300025941 Bacteria 1468
283 Ga0207711_10387545 3300025941 Bacteria 1297
284 Ga0207711_10594713 3300025941 Bacteria 1032
285 Ga0207711_10767734 3300025941 Bacteria 898
286 Ga0207689_10007240 3300025942 Bacteria 9745
287 Ga0207689_10410739 3300025942 Unclassified 1129
288 Ga0207689_10412810 3300025942 Unclassified 1126
289 Ga0207661_10004655 3300025944 Bacteria 9609
290 Ga0207661_10025949 3300025944 Bacteria 4460
291 Ga0207661_10137878 3300025944 Bacteria 2097
292 Ga0207661_10152929 3300025944 Archaea 1996
293 Ga0207661_10332244 3300025944 Bacteria 1368
294 Ga0207679_10012630 3300025945 Bacteria 5513
295 Ga0207679_10029804 3300025945 Unclassified 3803
296 Ga0207679_10204205 3300025945 Archaea 1653
297 Ga0207667_10055335 3300025949 Bacteria 4171
298 Ga0207651_10042010 3300025960 Bacteria 3039
299 Ga0207651_10093184 3300025960 Bacteria 2211
300 Ga0207651_10309048 3300025960 Unclassified 1318
301 Ga0207712_10807055 3300025961 Unclassified 825
302 Ga0207668_10442342 3300025972 Bacteria 1108
303 Ga0207668_10865242 3300025972 Bacteria 803
304 Ga0207640_10435468 3300025981 Bacteria 1077
305 Ga0207658_10040204 3300025986 Bacteria 3379
306 Ga0207658_10059815 3300025986 Bacteria 2840
307 Ga0207658_10238611 3300025986 Bacteria 1539
308 Ga0207658_10565291 3300025986 Unclassified 1019
309 Ga0207677_10297938 3300026023 Bacteria 1331
310 Ga0207677_10799270 3300026023 Bacteria 844
311 Ga0207703_10104841 3300026035 Bacteria 2403
312 Ga0207703_10196651 3300026035 Bacteria 1789
313 Ga0207703_10259968 3300026035 Bacteria 1569
314 Ga0207639_10001571 3300026041 Bacteria 15315
315 Ga0207639_10085922 3300026041 Bacteria 2503
316 Ga0207708_10143392 3300026075 Bacteria 1875
317 Ga0207702_10030805 3300026078 Bacteria 4469
318 Ga0207702_10357998 3300026078 Unclassified 1398
319 Ga0207641_10015288 3300026088 Bacteria 6291
320 Ga0207648_10024601 3300026089 Bacteria 5372
321 Ga0207648_10320934 3300026089 Unclassified 1392
322 Ga0207648_10329324 3300026089 Bacteria 1373
323 Ga0207676_10001551 3300026095 Bacteria 16926
324 Ga0207676_10262163 3300026095 Bacteria 1561
325 Ga0207676_10868708 3300026095 Unclassified 883
326 Ga0207674_10001530 3300026116 Bacteria 29786
327 Ga0207674_10061488 3300026116 Bacteria 3795
328 Ga0207683_10066878 3300026121 Bacteria 3170
329 Ga0207683_10172220 3300026121 Unclassified 1961
330 Ga0207698_10053709 3300026142 Bacteria 3095
331 Ga0207698_10458310 3300026142 Bacteria 1232
332 Ga0207698_10659083 3300026142 Bacteria 1038
333 Ga0207428_10122622 3300027907 Unclassified 1992
334 Ga0268265_10094859 3300028380 Bacteria 2394
335 Ga0268265_10159699 3300028380 Bacteria 1913
336 Ga0268264_10061998 3300028381 Bacteria 3139
337 Ga0268264_10105444 3300028381 Bacteria 2458
338 Ga0307408_100028116 3300031548 Bacteria 3883
339 Ga0307408_100158098 3300031548 Bacteria 1797
340 Ga0307408_100484201 3300031548 Bacteria 1080
341 Ga0307408_100585329 3300031548 Bacteria 989
342 Ga0307405_10000477 3300031731 Bacteria 15067
343 Ga0307405_10030850 3300031731 Unclassified 3148
344 Ga0307405_10177912 3300031731 Bacteria 1524
345 Ga0307405_10225331 3300031731 Bacteria 1378
346 Ga0307405_10543266 3300031731 Bacteria 939
347 Ga0307405_10645144 3300031731 Bacteria 870
348 Ga0307405_11030057 3300031731 Unclassified 704
349 Ga0307413_10072859 3300031824 Bacteria 2169
350 Ga0307413_10163032 3300031824 Bacteria 1568
351 Ga0307413_10197582 3300031824 Bacteria 1449
352 Ga0307410_10137395 3300031852 Bacteria 1803
353 Ga0307410_10186741 3300031852 Bacteria 1573
354 Ga0307410_10843032 3300031852 Bacteria 782
355 Ga0307410_11122061 3300031852 Bacteria 682
356 Ga0307406_10109281 3300031901 Bacteria 1900
357 Ga0307406_10311647 3300031901 Bacteria 1213
358 Ga0307406_10531993 3300031901 Unclassified 958
359 Ga0307406_10726774 3300031901 Unclassified 831
360 Ga0307406_10967825 3300031901 Bacteria 728
361 Ga0307407_10040131 3300031903 Bacteria 2607
362 Ga0307407_10173132 3300031903 Bacteria 1424
363 Ga0307407_10193895 3300031903 Unclassified 1356
364 Ga0307412_10022683 3300031911 Bacteria 3853
365 Ga0307412_10053296 3300031911 Bacteria 2681
366 Ga0307412_10647635 3300031911 Unclassified 901
367 Ga0307412_10652902 3300031911 Unclassified 897
368 Ga0307412_10655842 3300031911 Bacteria 896
369 Ga0307409_100004304 3300031995 Bacteria 7967
370 Ga0307409_100252415 3300031995 Bacteria 1613
371 Ga0307409_100321802 3300031995 Unclassified 1448
372 Ga0307409_100353515 3300031995 Bacteria 1387
373 Ga0307409_100988915 3300031995 Bacteria 859
374 Ga0307409_101400838 3300031995 Bacteria 725
375 Ga0307416_100026153 3300032002 Bacteria 4294
376 Ga0307416_100082982 3300032002 Unclassified 2717
377 Ga0307416_100268176 3300032002 Bacteria 1674
378 Ga0307416_100400661 3300032002 Bacteria 1409
379 Ga0307416_100432809 3300032002 Bacteria 1363
380 Ga0307416_100801531 3300032002 Bacteria 1037
381 Ga0307414_10004540 3300032004 Bacteria 7548
382 Ga0307414_10756519 3300032004 Bacteria 883
383 Ga0307411_10000572 3300032005 Bacteria 13140
384 Ga0307411_10031742 3300032005 Bacteria 3255
385 Ga0307411_10294784 3300032005 Bacteria 1298
386 Ga0307411_10543710 3300032005 Unclassified 990
387 Ga0307415_100099961 3300032126 Bacteria 2124
388 Ga0307415_100131552 3300032126 Bacteria 1895
389 Ga0307415_100136706 3300032126 Bacteria 1865
390 Ga0307415_100250957 3300032126 Bacteria 1437
391 Ga0307415_100316062 3300032126 Unclassified 1300
392 Ga0307415_100400711 3300032126 Bacteria 1171
393 Ga0307415_100531576 3300032126 Bacteria 1034
394 Ga0307415_101544307 3300032126 Bacteria 636
395 Ga0373934_0004077 3300035086 Bacteria 5385
396 Ga0373954_0084344 3300035118 Unclassified 1521
397 Ga0373931_0058466 3300035691 Bacteria 2071
398 Ga0373933_0266394 3300035724 Unclassified 1105
399 Ga0373947_0058978 3300035725 Bacteria 2326
400 Ga0373925_0024929 3300037068 Unclassified 4369
401 Ga0395899_0021291 3300037312 Bacteria 4919
402 Ga0395900_0056883 3300037418 Bacteria 4026
403 Ga0395898_0818936 3300037466 Bacteria 871
404 Ga0395905_0005383 3300037471 Bacteria 13080
405 Ga0395905_0190680 3300037471 Bacteria 1923
406 Ga0395905_1118932 3300037471 Bacteria 691
407 Ga0395901_0003035 3300038443 Bacteria 16917
408 Ga0436365_0504803 3300039437 Bacteria 11077
409 Ga0436365_1760486 3300039437 Bacteria 1190
410 Ga0439461_0041971 3300041410 Unclassified 991
411 Ga0439434_0025724 3300042435 Bacteria 1777
412 Ga0451577_0176005 3300042876 Bacteria 1929
413 Ga0466963_0381572 3300044694 Unclassified 993
414 Ga0451576_0188028 3300045051 Bacteria 2157
415 Ga0466967_0122731 3300045976 Bacteria 2403
416 Ga0466967_0396683 3300045976 Bacteria 1342
417 Ga0466967_1049563 3300045976 Bacteria 812
418 Ga0495629_0032577 3300046459 Unclassified 3690
419 Ga0495629_0225646 3300046459 Unclassified 1291
420 Ga0495580_0250435 3300046472 Unclassified 1213
421 Ga0495582_0159162 3300046473 Bacteria 1284
422 Ga0495639_0016482 3300046475 Unclassified 3209
423 Ga0495594_0004149 3300046499 Bacteria 7443
424 Ga0495594_0114486 3300046499 Bacteria 1522
425 Ga0495628_0067049 3300046516 Unclassified 2804
426 Ga0495630_0174880 3300046517 Unclassified 1636
427 Ga0495663_0103459 3300046525 Bacteria 940
428 Ga0495666_0154637 3300046526 Bacteria 1065
429 Ga0495652_0031394 3300046529 Bacteria 4653
430 Ga0495665_0287877 3300046531 Bacteria 842
431 Ga0495640_0163667 3300046533 Bacteria 1424
432 Ga0495586_0012055 3300046535 Bacteria 4593
433 Ga0495586_0355560 3300046535 Unclassified 841
434 Ga0495587_0039108 3300046536 Bacteria 2841
435 Ga0495621_0005371 3300046539 Bacteria 3677
436 Ga0495645_0002270 3300046543 Bacteria 13082
437 Ga0495668_0439221 3300046616 Bacteria 718
438 Ga0495634_0115573 3300046642 Bacteria 1722
439 Ga0495581_0003970 3300047315 Bacteria 8523
440 Ga0495581_0346492 3300047315 Unclassified 867
441 Ga0495581_0433006 3300047315 Unclassified 766
442 Ga0495674_0059546 3300047319 Unclassified 3335
443 Ga0495685_148707 3300047447 Bacteria 761
444 Ga0495602_0465270 3300048088 Unclassified 890
445 Ga0496104_0235765 3300048907 Bacteria 1742
446 Ga0496106_0141195 3300048909 Bacteria 1895
447 Ga0496108_0120678 3300048911 Bacteria 2248
448 Ga0496110_0203461 3300048913 Bacteria 1799
449 Ga0496112_0093755 3300048915 Bacteria 2972
450 Ga0496113_0318910 3300048916 Bacteria 1245
451 Ga0501292_062175 3300049515 Unclassified 679
452 Ga0501261_019966 3300049690 Bacteria 955
453 Ga0501225_0093930 3300049705 Bacteria 871
454 Ga0501267_011295 3300049764 Unclassified 909
455 nmdc:mga09592_344864_c1 3300050508 Bacteria 1289
456 nmdc:mga0qj67_348152_c1 3300050509 Unclassified 1198
457 nmdc:mga06r32_175636_c1 3300050510 Bacteria 2126
458 nmdc:mga08y16_307326_c1 3300050511 Bacteria 1633
459 nmdc:mga08y16_91471_c1 3300050511 Unclassified 3171
460 Ga0373931_0011070
461 MBSR1b_contig_844661
462 Ga0065712_10124546
463 Ga0065715_10002679
464 Ga0065715_10326718
465 Ga0065707_10247014
466 Ga0070658_10254582
467 Ga0070658_10489525
468 Ga0070676_10206398
469 Ga0070676_10236172
470 Ga0070676_10284166
471 Ga0070683_100014074
472 Ga0070683_100036080
473 Ga0070683_100178960
474 Ga0070683_100221413
475 Ga0070683_100242733
476 Ga0070683_100457602
477 Ga0070683_101363073
478 Ga0070690_100044030
479 Ga0070690_100245997
480 Ga0070690_100466334
481 Ga0070670_100020074
482 Ga0070670_100191294
483 Ga0070670_100527613
484 Ga0070670_101375225
485 Ga0070677_10137479
486 Ga0070677_10552875
487 Ga0068869_100263615
488 Ga0070666_10144095
489 Ga0070666_10418468
490 Ga0070680_100003560
491 Ga0070682_100141900
492 Ga0068868_100091155
493 Ga0068868_100260159
494 Ga0070689_100010241
495 Ga0070689_100064725
496 Ga0070689_100077209
497 Ga0070687_100314151
498 Ga0070687_100400863
499 Ga0070661_100014670
500 Ga0070661_100187343
501 Ga0070692_10037682
502 Ga0070668_100103132
503 Ga0070669_100007216
504 Ga0070669_100368223
505 Ga0070669_100373250
506 Ga0070675_100023291
507 Ga0070675_100047973
508 Ga0070675_100252652
509 Ga0070675_100339365
510 Ga0070675_100583956
511 Ga0070671_100134165
512 Ga0070671_100665822
513 Ga0070671_100721169
514 Ga0070673_100080493
515 Ga0070673_100099016
516 Ga0070673_100188297
517 Ga0070673_100469482
518 Ga0070673_100598940
519 Ga0070688_100074168
520 Ga0070688_100129804
521 Ga0070688_100342773
522 Ga0070659_100002190
523 Ga0070667_100032369
524 Ga0070667_100130479
525 Ga0070667_100163749
526 Ga0070667_100222292
527 Ga0070709_10059431
528 Ga0070701_10169556
529 Ga0070701_10324350
530 Ga0070705_100009932
531 Ga0070700_100467349
532 Ga0070700_100575283
533 Ga0070694_100370325
534 Ga0070694_100622427
535 Ga0070708_100000091
536 Ga0070678_100307325
537 Ga0070678_100379971
538 Ga0070662_100019601
539 Ga0070662_100021520
540 Ga0070662_100137977
541 Ga0070662_100589849
542 Ga0070662_100642492
543 Ga0070662_100699352
544 Ga0070681_10275208
545 Ga0068867_100043439
546 Ga0070685_10005180
547 Ga0070706_100496161
548 Ga0070707_101120411
549 Ga0070698_100018466
550 Ga0070698_100231964
551 Ga0070699_100016299
552 Ga0070699_100515986
553 Ga0070679_100008772
554 Ga0070679_100600800
555 Ga0070684_100030278
556 Ga0070684_100048534
557 Ga0070684_100092853
558 Ga0070684_100414010
559 Ga0070684_100601371
560 Ga0070684_100797376
561 Ga0070697_100603166
562 Ga0068853_100985374
563 Ga0070672_100011637
564 Ga0070672_100041642
565 Ga0070672_100866576
566 Ga0070672_101034048
567 Ga0070693_100001077
568 Ga0070665_100404102
569 Ga0068855_100105017
570 Ga0070664_100137838
571 Ga0070664_100242744
572 Ga0070664_100298689
573 Ga0070664_100300291
574 Ga0070664_100374049
575 Ga0070664_100757551
576 Ga0068857_100007823
577 Ga0068857_100066356
578 Ga0068857_100111917
579 Ga0068857_100664907
580 Ga0068857_100730993
581 Ga0068854_100548966
582 Ga0068856_100159136
583 Ga0068856_100159313
584 Ga0070702_100039475
585 Ga0070702_100224645
586 Ga0068852_100014555
587 Ga0068852_100022081
588 Ga0068852_100166720
589 Ga0068852_100415721
590 Ga0068859_100006405
591 Ga0068859_100065032
592 Ga0068859_100728175
593 Ga0068859_100845306
594 Ga0068859_101294418
595 Ga0068864_100007489
596 Ga0068864_100190945
597 Ga0068866_10251707
598 Ga0068861_100515733
599 Ga0068870_10004673
600 Ga0068870_10006530
601 Ga0068863_100143979
602 Ga0068863_100169186
603 Ga0068858_100099965
604 Ga0068858_100119695
605 Ga0068860_100034770
606 Ga0068860_100097530
607 Ga0068862_100129420
608 Ga0068862_100266269
609 Ga0068862_100823277
610 Ga0070716_100206020
611 Ga0097621_100287946
612 Ga0097621_100593477
613 Ga0068871_100010208
614 Ga0068871_100275320
615 Ga0075430_100037083
616 Ga0075431_100095394
617 Ga0075431_100401907
618 Ga0068865_100034629
619 Ga0068865_100050616
620 Ga0075436_100249363
621 Ga0097620_100006405
622 Ga0097620_100065025
623 Ga0097620_100728214
624 Ga0097620_100845318
625 Ga0097620_101294868
626 Ga0105240_10046883
627 Ga0105240_10144805
628 Ga0111539_10096178
629 Ga0111539_10123872
630 Ga0111539_10219298
631 Ga0105245_10006891
632 Ga0105245_10096559
633 Ga0105245_10166145
634 Ga0105245_10270946
635 Ga0105243_10098319
636 Ga0105243_10365971
637 Ga0105241_10035622
638 Ga0105242_10004623
639 Ga0105242_10010304
640 Ga0105242_10117927
641 Ga0105242_10263382
642 Ga0105242_10404063
643 Ga0105248_10004111
644 Ga0105248_10019049
645 Ga0105248_10037306
646 Ga0105248_10801127
647 Ga0105248_11383699
648 Ga0105248_11593457
649 Ga0105237_10156041
650 Ga0105237_10516057
651 Ga0105237_10875986
652 Ga0105249_10282646
653 Ga0105249_10816669
654 Ga0105239_10016864
655 Ga0157373_10045092
656 Ga0157371_10008591
657 Ga0157370_10609476
658 Ga0157369_10038405
659 Ga0157369_10463470
660 Ga0157369_10634800
661 Ga0157369_10967115
662 Ga0157374_10004155
663 Ga0157374_10506329
664 Ga0157374_11194201
665 Ga0157374_11228184
666 Ga0157378_10492852
667 Ga0157378_10558810
668 Ga0163162_10275041
669 Ga0157372_10002537
670 Ga0157372_10082158
671 Ga0157372_10115056
672 Ga0157372_11653480
673 Ga0157375_10011950
674 Ga0157375_10015667
675 Ga0157375_10023691
676 Ga0157375_10080957
677 Ga0157375_10504636
678 Ga0157375_10692171
679 Ga0163163_10023684
680 Ga0163163_10229210
681 Ga0157380_10117252
682 Ga0157380_10131186
683 Ga0157377_10009075
684 Ga0157376_10098003
685 Ga0157376_10154478
686 Ga0163161_10339526
687 Ga0163161_10683316
688 Ga0213876_10057945
689 Ga0207697_10013390
690 Ga0207697_10038265
691 Ga0207656_10338418
692 Ga0207682_10042534
693 Ga0207642_10180808
694 Ga0207688_10274572
695 Ga0207680_10332863
696 Ga0207647_10096459
697 Ga0207699_10329402
698 Ga0207645_10074866
699 Ga0207645_10194272
700 Ga0207645_10287853
701 Ga0207643_10004450
702 Ga0207643_10194830
703 Ga0207707_10230525
704 Ga0207671_10383988
705 Ga0207693_10175568
706 Ga0207662_10163463
707 Ga0207657_10009153
708 Ga0207649_10439823
709 Ga0207652_10058141
710 Ga0207652_10185215
711 Ga0207681_10132868
712 Ga0207681_10165196
713 Ga0207694_10099775
714 Ga0207694_10137193
715 Ga0207650_10008725
716 Ga0207650_10219018
717 Ga0207659_10008945
718 Ga0207659_10142140
719 Ga0207659_10174039
720 Ga0207659_10325965
721 Ga0207687_10540414
722 Ga0207687_10618751
723 Ga0207644_10107934
724 Ga0207644_10765967
725 Ga0207690_10025973
726 Ga0207706_10006727
727 Ga0207706_10056204
728 Ga0207686_10086634
729 Ga0207709_10044600
730 Ga0207670_10013221
731 Ga0207670_10057959
732 Ga0207670_10124294
733 Ga0207669_10071608
734 Ga0207704_10188648
735 Ga0207665_10249102
736 Ga0207691_10006804
737 Ga0207691_10030862
738 Ga0207691_10099969
739 Ga0207691_10721617
740 Ga0207711_10157232
741 Ga0207711_10305287
742 Ga0207711_10387545
743 Ga0207711_10594713
744 Ga0207711_10767734
745 Ga0207689_10007240
746 Ga0207689_10410739
747 Ga0207689_10412810
748 Ga0207661_10004655
749 Ga0207661_10025949
750 Ga0207661_10137878
751 Ga0207661_10152929
752 Ga0207661_10332244
753 Ga0207679_10012630
754 Ga0207679_10029804
755 Ga0207679_10204205
756 Ga0207667_10055335
757 Ga0207651_10042010
758 Ga0207651_10093184
759 Ga0207651_10309048
760 Ga0207712_10807055
761 Ga0207668_10442342
762 Ga0207668_10865242
763 Ga0207640_10435468
764 Ga0207658_10040204
765 Ga0207658_10059815
766 Ga0207658_10238611
767 Ga0207658_10565291
768 Ga0207677_10297938
769 Ga0207677_10799270
770 Ga0207703_10104841
771 Ga0207703_10196651
772 Ga0207703_10259968
773 Ga0207639_10001571
774 Ga0207639_10085922
775 Ga0207708_10143392
776 Ga0207702_10030805
777 Ga0207702_10357998
778 Ga0207641_10015288
779 Ga0207648_10024601
780 Ga0207648_10320934
781 Ga0207648_10329324
782 Ga0207676_10001551
783 Ga0207676_10262163
784 Ga0207676_10868708
785 Ga0207674_10001530
786 Ga0207674_10061488
787 Ga0207683_10066878
788 Ga0207683_10172220
789 Ga0207698_10053709
790 Ga0207698_10458310
791 Ga0207698_10659083
792 Ga0207428_10122622
793 Ga0268265_10094859
794 Ga0268265_10159699
795 Ga0268264_10061998
796 Ga0268264_10105444
797 Ga0307408_100028116
798 Ga0307408_100158098
799 Ga0307408_100484201
800 Ga0307408_100585329
801 Ga0307405_10000477
802 Ga0307405_10030850
803 Ga0307405_10177912
804 Ga0307405_10225331
805 Ga0307405_10543266
806 Ga0307405_10645144
807 Ga0307405_11030057
808 Ga0307413_10072859
809 Ga0307413_10163032
810 Ga0307413_10197582
811 Ga0307410_10137395
812 Ga0307410_10186741
813 Ga0307410_10843032
814 Ga0307410_11122061
815 Ga0307406_10109281
816 Ga0307406_10311647
817 Ga0307406_10531993
818 Ga0307406_10726774
819 Ga0307406_10967825
820 Ga0307407_10040131
821 Ga0307407_10173132
822 Ga0307407_10193895
823 Ga0307412_10022683
824 Ga0307412_10053296
825 Ga0307412_10647635
826 Ga0307412_10652902
827 Ga0307412_10655842
828 Ga0307409_100004304
829 Ga0307409_100252415
830 Ga0307409_100321802
831 Ga0307409_100353515
832 Ga0307409_100988915
833 Ga0307409_101400838
834 Ga0307416_100026153
835 Ga0307416_100082982
836 Ga0307416_100268176
837 Ga0307416_100400661
838 Ga0307416_100432809
839 Ga0307416_100801531
840 Ga0307414_10004540
841 Ga0307414_10756519
842 Ga0307411_10000572
843 Ga0307411_10031742
844 Ga0307411_10294784
845 Ga0307411_10543710
846 Ga0307415_100099961
847 Ga0307415_100131552
848 Ga0307415_100136706
849 Ga0307415_100250957
850 Ga0307415_100316062
851 Ga0307415_100400711
852 Ga0307415_100531576
853 Ga0307415_101544307
854 Ga0373934_0004077
855 Ga0373954_0084344
856 Ga0373931_0058466
857 Ga0373933_0266394
858 Ga0373947_0058978
859 Ga0373925_0024929
860 Ga0395899_0021291
861 Ga0395900_0056883
862 Ga0395898_0818936
863 Ga0395905_0005383
864 Ga0395905_0190680
865 Ga0395905_1118932
866 Ga0395901_0003035
867 Ga0436365_0504803
868 Ga0436365_1760486
869 Ga0439461_0041971
870 Ga0439434_0025724
871 Ga0451577_0176005
872 Ga0466963_0381572
873 Ga0451576_0188028
874 Ga0466967_0122731
875 Ga0466967_0396683
876 Ga0466967_1049563
877 Ga0495629_0032577
878 Ga0495629_0225646
879 Ga0495580_0250435
880 Ga0495582_0159162
881 Ga0495639_0016482
882 Ga0495594_0004149
883 Ga0495594_0114486
884 Ga0495628_0067049
885 Ga0495630_0174880
886 Ga0495663_0103459
887 Ga0495666_0154637
888 Ga0495652_0031394
889 Ga0495665_0287877
890 Ga0495640_0163667
891 Ga0495586_0012055
892 Ga0495586_0355560
893 Ga0495587_0039108
894 Ga0495621_0005371
895 Ga0495645_0002270
896 Ga0495668_0439221
897 Ga0495634_0115573
898 Ga0495581_0003970
899 Ga0495581_0346492
900 Ga0495581_0433006
901 Ga0495674_0059546
902 Ga0495685_148707
903 Ga0495602_0465270
904 Ga0496104_0235765
905 Ga0496106_0141195
906 Ga0496108_0120678
907 Ga0496110_0203461
908 Ga0496112_0093755
909 Ga0496113_0318910
910 Ga0501292_062175
911 Ga0501261_019966
912 Ga0501225_0093930
913 Ga0501267_011295
914 nmdc:mga09592_344864_c1
915 nmdc:mga0qj67_348152_c1
916 nmdc:mga06r32_175636_c1
917 nmdc:mga08y16_307326_c1
918 nmdc:mga08y16_91471_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14224

DUF4331

Domain of unknown function (DUF4331)

123

229

0.77

Map