metagRoot

F448366

General Info

Members	Datasets	Scaffolds	Average Seq Length
459	217	459	157

Family's Representative Sequence

Representative Sequence	3300025911\|Ga0207654_10076866\|Ga0207654_100768662
Length	178
Sequence	MTGVGSTEPAGSGGADMRGAGAGNGLYEAIQAERAKYPEGSRSATLHALRLAQEEHGWLSPDALREVADALEVTPAYCKAVATFYDMYHLAPVGTHLVEVCTNLSCALAGAQRVVDAFASELGVAPGETTADGDVTFRTVECLGGCGYATVVAVDHRYRQFVGPDDVAAIVEELRAGS

Samples

	Sample ID	Description	Type	Environment
1	3300003373	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
2	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
3	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
4	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
5	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
6	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
7	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
8	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
9	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
10	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
11	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
12	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
13	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
14	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
15	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
16	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
17	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
18	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
19	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
20	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
21	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
22	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
23	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
24	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
25	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
26	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
27	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
28	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
29	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
30	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
31	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
32	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
33	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
34	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
35	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
36	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
37	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
38	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
39	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
40	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
41	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
42	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
43	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
44	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
45	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
46	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
47	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
48	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
49	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
50	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
51	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
52	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
53	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
54	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
55	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
56	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
57	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
58	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
59	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
60	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
61	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
62	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
63	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
64	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
65	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
66	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
67	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
68	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
69	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
70	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
71	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
72	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
73	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
74	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
75	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
76	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
77	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
78	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
79	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
80	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
98	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
100	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
101	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
102	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
103	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
104	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
105	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
106	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
107	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
108	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
109	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
110	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
111	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
112	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
113	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
114	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
115	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
116	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
117	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
118	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
119	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
120	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
121	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
122	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
123	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
124	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
125	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
126	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
127	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
128	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
129	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
130	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
131	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
132	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
133	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
134	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
135	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
136	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
137	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
138	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
139	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
140	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
141	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
142	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
143	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
144	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
145	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
146	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
147	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
148	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
149	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
150	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
151	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
152	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
153	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
154	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
155	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
156	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
157	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
158	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
159	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
160	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
161	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
162	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
163	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
164	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
165	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
166	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
167	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
168	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
169	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
170	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
171	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
172	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
173	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
174	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
175	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
176	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
177	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
178	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
179	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
180	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
181	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
182	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
183	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
184	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
185	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
186	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
187	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
188	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
189	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
190	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
191	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
192	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
193	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
194	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
195	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
196	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
197	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
198	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
199	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
200	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
201	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
202	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
203	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
204	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
205	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
206	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
207	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
208	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
209	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
210	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
211	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
212	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
213	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
214	3300059423	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
215	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
216	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
217	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	97.6
Metatranscriptomes	2.4
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.22
Nodule	0
Rhizoplane	5.88
Rhizosphere	93.46
Stem	0
Stem Tuber	0
Unclassified	0.44

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25407J50210_10015139	3300003373	Bacteria	1990
2	JGI25407J50210_10027950	3300003373	Bacteria	1463
3	Ga0070658_10015063	3300005327	Bacteria	6188
4	Ga0070658_10070570	3300005327	Bacteria	2860
5	Ga0070658_10116793	3300005327	Bacteria	2214
6	Ga0070683_100022595	3300005329	Bacteria	5624
7	Ga0070683_100075139	3300005329	Bacteria	3157
8	Ga0070683_100099907	3300005329	Bacteria	2731
9	Ga0070683_100316183	3300005329	Bacteria	1486
10	Ga0070683_100815674	3300005329	Bacteria	895
11	Ga0070683_101195209	3300005329	Unclassified	731
12	Ga0070680_100155257	3300005336	Bacteria	1922
13	Ga0070680_100174254	3300005336	Bacteria	1811
14	Ga0070680_100299104	3300005336	Bacteria	1364
15	Ga0070680_100497730	3300005336	Bacteria	1043
16	Ga0070680_100724517	3300005336	Bacteria	856
17	Ga0070682_100015278	3300005337	Bacteria	4447
18	Ga0070682_100154843	3300005337	Bacteria	1577
19	Ga0070682_100348266	3300005337	Bacteria	1103
20	Ga0068868_100590599	3300005338	Bacteria	983
21	Ga0070660_100268369	3300005339	Bacteria	1394
22	Ga0070660_100471732	3300005339	Bacteria	1042
23	Ga0070660_100687506	3300005339	Bacteria	857
24	Ga0070661_100020187	3300005344	Bacteria	4750
25	Ga0070661_100254718	3300005344	Bacteria	1355
26	Ga0070661_100600424	3300005344	Bacteria	890
27	Ga0070659_100014825	3300005366	Bacteria	5828
28	Ga0070659_100045699	3300005366	Bacteria	3430
29	Ga0070659_100075497	3300005366	Bacteria	2686
30	Ga0070659_100588080	3300005366	Bacteria	956
31	Ga0070714_100729994	3300005435	Bacteria	957
32	Ga0070714_101147513	3300005435	Bacteria	758
33	Ga0070711_101641253	3300005439	Bacteria	563
34	Ga0070708_100132828	3300005445	Bacteria	2305
35	Ga0070708_101271884	3300005445	Bacteria	688
36	Ga0070663_100053269	3300005455	Bacteria	2888
37	Ga0070663_101295453	3300005455	Unclassified	643
38	Ga0070678_100046369	3300005456	Bacteria	3116
39	Ga0070681_10001855	3300005458	Bacteria	19089
40	Ga0070681_10027200	3300005458	Bacteria	5751
41	Ga0070681_10094169	3300005458	Bacteria	2944
42	Ga0070681_10145023	3300005458	Bacteria	2303
43	Ga0070681_10496921	3300005458	Bacteria	1133
44	Ga0070707_100002585	3300005468	Bacteria	17201
45	Ga0070707_100380288	3300005468	Bacteria	1372
46	Ga0070698_101780629	3300005471	Bacteria	569
47	Ga0070699_100180237	3300005518	Bacteria	1874
48	Ga0070679_100011004	3300005530	Bacteria	8600
49	Ga0070679_100022714	3300005530	Bacteria	6133
50	Ga0070679_100024040	3300005530	Bacteria	5969
51	Ga0070679_100106302	3300005530	Bacteria	2792
52	Ga0070679_100130876	3300005530	Bacteria	2490
53	Ga0070679_100133301	3300005530	Bacteria	2465
54	Ga0070679_100157859	3300005530	Bacteria	2243
55	Ga0070679_101188708	3300005530	Bacteria	708
56	Ga0070684_100050911	3300005535	Bacteria	3598
57	Ga0070684_100103688	3300005535	Bacteria	2544
58	Ga0070684_100227446	3300005535	Bacteria	1703
59	Ga0070684_100238029	3300005535	Bacteria	1663
60	Ga0068853_100184595	3300005539	Bacteria	1893
61	Ga0068853_100736365	3300005539	Bacteria	942
62	Ga0070693_100032753	3300005547	Bacteria	2861
63	Ga0070665_100090599	3300005548	Bacteria	3064
64	Ga0068855_100182389	3300005563	Bacteria	2372
65	Ga0068855_100808864	3300005563	Bacteria	995
66	Ga0068855_101676490	3300005563	Bacteria	649
67	Ga0070664_100484286	3300005564	Bacteria	1139
68	Ga0068857_100018224	3300005577	Bacteria	6157
69	Ga0068857_100243325	3300005577	Bacteria	1647
70	Ga0068856_100152722	3300005614	Bacteria	2318
71	Ga0068856_100303847	3300005614	Bacteria	1613
72	Ga0068856_100826625	3300005614	Bacteria	946
73	Ga0070702_100664233	3300005615	Bacteria	790
74	Ga0068852_100197160	3300005616	Bacteria	1904
75	Ga0068852_100642962	3300005616	Bacteria	1068
76	Ga0068852_101200015	3300005616	Bacteria	780
77	Ga0068861_100602304	3300005719	Bacteria	1009
78	Ga0081455_10083804	3300005937	Bacteria	2604
79	Ga0081455_10684329	3300005937	Unclassified	656
80	Ga0081538_10000151	3300005981	Bacteria	72583
81	Ga0081538_10001761	3300005981	Bacteria	21920
82	Ga0081538_10002077	3300005981	Bacteria	19957
83	Ga0081538_10002734	3300005981	Bacteria	16934
84	Ga0081538_10007728	3300005981	Bacteria	9259
85	Ga0081539_10062333	3300005985	Bacteria	2038
86	Ga0075430_100455337	3300006846	Bacteria	1056
87	Ga0075431_100051547	3300006847	Bacteria	4243
88	Ga0075434_101341496	3300006871	Bacteria	726
89	Ga0068865_101674768	3300006881	Unclassified	573
90	Ga0075436_100738084	3300006914	Unclassified	731
91	Ga0105240_10076875	3300009093	Bacteria	4114
92	Ga0111539_10480498	3300009094	Bacteria	1447
93	Ga0105245_10250360	3300009098	Bacteria	1721
94	Ga0114129_10583487	3300009147	Bacteria	1450
95	Ga0114129_10596469	3300009147	Bacteria	1432
96	Ga0105241_11184637	3300009174	Bacteria	723
97	Ga0105242_10930539	3300009176	Bacteria	872
98	Ga0105238_10072267	3300009551	Bacteria	3446
99	Ga0105238_11602152	3300009551	Bacteria	681
100	Ga0105238_12438983	3300009551	Unclassified	559
101	Ga0105239_10382721	3300010375	Bacteria	1591
102	Ga0105239_12862474	3300010375	Unclassified	563
103	Ga0105246_10194842	3300011119	Bacteria	1571
104	Ga0157373_10019815	3300013100	Bacteria	4894
105	Ga0157373_10845756	3300013100	Bacteria	677
106	Ga0157373_11199382	3300013100	Unclassified	572
107	Ga0157370_10127851	3300013104	Bacteria	2371
108	Ga0157370_10515046	3300013104	Bacteria	1098
109	Ga0157370_10569794	3300013104	Bacteria	1038
110	Ga0157369_10127560	3300013105	Bacteria	2696
111	Ga0157369_10801573	3300013105	Bacteria	968
112	Ga0157369_11265717	3300013105	Bacteria	752
113	Ga0157374_10980286	3300013296	Bacteria	864
114	Ga0157374_11117628	3300013296	Bacteria	809
115	Ga0157372_10263042	3300013307	Bacteria	2003
116	Ga0157372_11476347	3300013307	Bacteria	783
117	Ga0157375_10121277	3300013308	Bacteria	2724
118	Ga0163163_10306827	3300014325	Bacteria	1640
119	Ga0157376_10395430	3300014969	Bacteria	1335
120	Ga0163161_11093152	3300017792	Bacteria	685
121	Ga0197907_10369962	3300020069	Bacteria	758
122	Ga0197907_10648429	3300020069	Bacteria	1189
123	Ga0206356_11410211	3300020070	Bacteria	1083
124	Ga0206356_11501934	3300020070	Bacteria	1173
125	Ga0206350_10712675	3300020080	Unclassified	649
126	Ga0206354_10247831	3300020081	Bacteria	1506
127	Ga0206354_11183078	3300020081	Bacteria	1230
128	Ga0206353_10885954	3300020082	Bacteria	1018
129	Ga0206353_11089650	3300020082	Bacteria	5165
130	Ga0206353_11647635	3300020082	Bacteria	737
131	Ga0206353_12040689	3300020082	Bacteria	4534
132	Ga0213871_10121145	3300021441	Bacteria	780
133	Ga0207656_10051258	3300025321	Bacteria	1784
134	Ga0207647_10197100	3300025904	Bacteria	1166
135	Ga0207684_10071038	3300025910	Bacteria	2958
136	Ga0207654_10076866	3300025911	Bacteria	1999
137	Ga0207654_10687812	3300025911	Bacteria	734
138	Ga0207707_10002919	3300025912	Bacteria	15249
139	Ga0207707_10051905	3300025912	Bacteria	3571
140	Ga0207707_10065796	3300025912	Bacteria	3156
141	Ga0207707_10122497	3300025912	Bacteria	2274
142	Ga0207707_10384688	3300025912	Bacteria	1206
143	Ga0207695_11418319	3300025913	Unclassified	575
144	Ga0207671_10304417	3300025914	Bacteria	1259
145	Ga0207660_10017699	3300025917	Bacteria	4740
146	Ga0207660_10032985	3300025917	Bacteria	3578
147	Ga0207660_10047469	3300025917	Bacteria	3036
148	Ga0207657_10005284	3300025919	Bacteria	13530
149	Ga0207657_10015154	3300025919	Bacteria	7487
150	Ga0207657_10034499	3300025919	Bacteria	4548
151	Ga0207657_10383365	3300025919	Bacteria	1107
152	Ga0207649_10074133	3300025920	Bacteria	2183
153	Ga0207649_10821488	3300025920	Bacteria	726
154	Ga0207652_10032369	3300025921	Bacteria	4395
155	Ga0207652_10084152	3300025921	Bacteria	2786
156	Ga0207652_10351607	3300025921	Bacteria	1330
157	Ga0207652_10432409	3300025921	Bacteria	1187
158	Ga0207652_10566618	3300025921	Bacteria	1020
159	Ga0207646_10059910	3300025922	Bacteria	3400
160	Ga0207646_11283483	3300025922	Bacteria	640
161	Ga0207694_10060508	3300025924	Bacteria	2947
162	Ga0207694_10078985	3300025924	Bacteria	2580
163	Ga0207687_10008411	3300025927	Bacteria	6747
164	Ga0207664_10359791	3300025929	Bacteria	1289
165	Ga0207664_10735278	3300025929	Bacteria	887
166	Ga0207664_11767126	3300025929	Bacteria	541
167	Ga0207690_10011819	3300025932	Bacteria	5221
168	Ga0207690_10217251	3300025932	Bacteria	1461
169	Ga0207686_10537649	3300025934	Bacteria	912
170	Ga0207709_10031561	3300025935	Bacteria	3096
171	Ga0207711_11108222	3300025941	Bacteria	732
172	Ga0207661_10005687	3300025944	Bacteria	8794
173	Ga0207661_10022508	3300025944	Bacteria	4749
174	Ga0207661_10113176	3300025944	Bacteria	2299
175	Ga0207661_10198260	3300025944	Bacteria	1764
176	Ga0207679_10959223	3300025945	Bacteria	783
177	Ga0207667_10104673	3300025949	Bacteria	2919
178	Ga0207667_10335556	3300025949	Bacteria	1543
179	Ga0207667_10606328	3300025949	Bacteria	1103
180	Ga0207651_10901898	3300025960	Bacteria	787
181	Ga0207640_10370815	3300025981	Bacteria	1157
182	Ga0207677_10092352	3300026023	Bacteria	2204
183	Ga0207639_10045706	3300026041	Bacteria	3300
184	Ga0207639_10161159	3300026041	Bacteria	1890
185	Ga0207639_10436784	3300026041	Bacteria	1186
186	Ga0207678_10059014	3300026067	Bacteria	3301
187	Ga0207702_10002686	3300026078	Bacteria	16700
188	Ga0207702_10115634	3300026078	Bacteria	2393
189	Ga0207702_10315932	3300026078	Bacteria	1486
190	Ga0207702_11503121	3300026078	Bacteria	667
191	Ga0207648_10406222	3300026089	Bacteria	1235
192	Ga0207674_10060145	3300026116	Bacteria	3843
193	Ga0207675_100832793	3300026118	Bacteria	937
194	Ga0207683_10014446	3300026121	Bacteria	6723
195	Ga0207698_10351092	3300026142	Bacteria	1393
196	Ga0207698_10619671	3300026142	Bacteria	1069
197	Ga0207698_11212422	3300026142	Bacteria	769
198	Ga0209998_10035180	3300027717	Bacteria	1122
199	Ga0207428_10068629	3300027907	Bacteria	2788
200	Ga0268266_10046859	3300028379	Bacteria	3701
201	Ga0265319_1001733	3300028563	Bacteria	12556
202	Ga0265334_10001101	3300028573	Bacteria	13236
203	Ga0265318_10001418	3300028577	Bacteria	14174
204	Ga0265338_10099685	3300028800	Bacteria	2371
205	Ga0265330_10002530	3300031235	Bacteria	9938
206	Ga0265332_10001984	3300031238	Bacteria	10760
207	Ga0265328_10006199	3300031239	Bacteria	5086
208	Ga0265320_10028616	3300031240	Bacteria	2891
209	Ga0265325_10001202	3300031241	Bacteria	18438
210	Ga0265329_10004897	3300031242	Bacteria	5486
211	Ga0265340_10001330	3300031247	Bacteria	14159
212	Ga0265339_10004586	3300031249	Bacteria	9407
213	Ga0265331_10093491	3300031250	Bacteria	1388
214	Ga0265327_10009773	3300031251	Bacteria	6860
215	Ga0265316_10017243	3300031344	Bacteria	6247
216	Ga0307408_100030330	3300031548	Bacteria	3754
217	Ga0307408_101005551	3300031548	Bacteria	769
218	Ga0265313_10004804	3300031595	Bacteria	10176
219	Ga0265314_10008470	3300031711	Bacteria	8804
220	Ga0265342_10023644	3300031712	Bacteria	3886
221	Ga0307405_10664004	3300031731	Bacteria	859
222	Ga0307413_10020673	3300031824	Bacteria	3507
223	Ga0307406_10046866	3300031901	Bacteria	2721
224	Ga0307407_10080901	3300031903	Bacteria	1964
225	Ga0307412_10014671	3300031911	Bacteria	4629
226	Ga0307409_100057589	3300031995	Bacteria	3012
227	Ga0307416_100032245	3300032002	Bacteria	3955
228	Ga0307416_100083306	3300032002	Bacteria	2713
229	Ga0307414_10076757	3300032004	Bacteria	2429
230	Ga0307411_10085169	3300032005	Bacteria	2188
231	Ga0307415_100008441	3300032126	Bacteria	5709
232	Ga0373926_0111316	3300035083	Bacteria	1029
233	Ga0373944_0016874	3300035089	Bacteria	2065
234	Ga0373945_0141972	3300035116	Bacteria	969
235	Ga0373955_0033805	3300035172	Bacteria	2695
236	Ga0373937_0067243	3300036401	Bacteria	3301
237	Ga0373925_0828471	3300037068	Bacteria	763
238	Ga0395899_0006920	3300037312	Bacteria	8784
239	Ga0395899_0290612	3300037312	Bacteria	1109
240	Ga0395900_0025290	3300037418	Bacteria	6078
241	Ga0395900_0300206	3300037418	Bacteria	1592
242	Ga0395900_0343228	3300037418	Bacteria	1468
243	Ga0395900_0356010	3300037418	Bacteria	1436
244	Ga0395898_0001875	3300037466	Bacteria	26866
245	Ga0395898_0003526	3300037466	Bacteria	17447
246	Ga0395898_0080149	3300037466	Bacteria	3149
247	Ga0395898_0155396	3300037466	Bacteria	2188
248	Ga0395905_0021602	3300037471	Bacteria	6086
249	Ga0395905_0628897	3300037471	Bacteria	975
250	Ga0395901_0012794	3300038443	Bacteria	8510
251	Ga0395901_0019001	3300038443	Bacteria	7025
252	Ga0395901_0066637	3300038443	Bacteria	3750
253	Ga0395901_0155817	3300038443	Bacteria	2399
254	Ga0395901_1032395	3300038443	Bacteria	796
255	Ga0436360_0173849	3300039438	Bacteria	1299
256	Ga0451853_0090004	3300041512	Unclassified	590
257	Ga0451853_2478238	3300041512	Unclassified	697
258	Ga0439448_0051420	3300042005	Bacteria	1349
259	Ga0439458_0036027	3300042157	Bacteria	1191
260	Ga0450918_013821	3300042531	Bacteria	1404
261	Ga0439440_0103540	3300042993	Bacteria	777
262	Ga0466964_0005916	3300044706	Bacteria	4554
263	Ga0451576_0383249	3300045051	Bacteria	1474
264	Ga0466967_0000455	3300045976	Bacteria	19649
265	Ga0466967_0033564	3300045976	Bacteria	4345
266	Ga0466967_0121143	3300045976	Bacteria	2417
267	Ga0466967_0170297	3300045976	Bacteria	2048
268	Ga0466967_0722821	3300045976	Bacteria	987
269	Ga0495641_0004211	3300046461	Bacteria	10314
270	Ga0495653_0050259	3300046463	Bacteria	3207
271	Ga0495664_0711981	3300046477	Bacteria	593
272	Ga0495608_0042731	3300046511	Bacteria	3030
273	Ga0495665_0151413	3300046531	Bacteria	1211
274	Ga0495588_0001142	3300046674	Bacteria	11413
275	Ga0495657_0010689	3300046675	Bacteria	6901
276	Ga0495613_0289669	3300046689	Bacteria	1135
277	Ga0495676_0013121	3300047321	Bacteria	7454
278	Ga0495680_0046294	3300047322	Bacteria	3430
279	Ga0495684_0112963	3300047471	Bacteria	2048
280	Ga0496100_0473039	3300048903	Bacteria	963
281	Ga0496101_0093846	3300048904	Bacteria	2235
282	Ga0496101_0453226	3300048904	Bacteria	1012
283	Ga0496102_0005080	3300048905	Bacteria	11145
284	Ga0496102_1517015	3300048905	Bacteria	589
285	Ga0496103_0033886	3300048906	Bacteria	3121
286	Ga0496104_0154373	3300048907	Bacteria	2203
287	Ga0496105_0136468	3300048908	Bacteria	2021
288	Ga0496106_0003838	3300048909	Bacteria	11200
289	Ga0496107_0013209	3300048910	Bacteria	5770
290	Ga0496107_0701207	3300048910	Bacteria	744
291	Ga0496109_0039250	3300048912	Bacteria	4285
292	Ga0496109_0146832	3300048912	Bacteria	2207
293	Ga0496110_0061466	3300048913	Bacteria	3315
294	Ga0496110_0111935	3300048913	Bacteria	2454
295	Ga0496110_0338388	3300048913	Bacteria	1371
296	Ga0496110_0666983	3300048913	Bacteria	940
297	Ga0496111_0008012	3300048914	Bacteria	6968
298	Ga0496111_0034932	3300048914	Bacteria	3591
299	Ga0496111_0332872	3300048914	Bacteria	1124
300	Ga0496112_0125902	3300048915	Bacteria	2533
301	Ga0496112_0493546	3300048915	Bacteria	1160
302	Ga0496112_0648810	3300048915	Bacteria	985
303	Ga0496113_0609380	3300048916	Bacteria	874
304	Ga0496114_0000177	3300048917	Bacteria	45143
305	Ga0496114_0820429	3300048917	Unclassified	809
306	Ga0496115_0087488	3300048918	Bacteria	2542
307	Ga0501031_0000033	3300049568	Bacteria	76506
308	Ga0501031_0006310	3300049568	Bacteria	7730
309	Ga0501031_0073116	3300049568	Bacteria	2232
310	Ga0501032_0002047	3300049569	Bacteria	15929
311	Ga0501032_0047232	3300049569	Bacteria	2907
312	Ga0501032_0076317	3300049569	Bacteria	2231
313	Ga0501032_0845823	3300049569	Unclassified	577
314	Ga0501033_0000388	3300049570	Bacteria	42262
315	Ga0501033_0069261	3300049570	Bacteria	2593
316	Ga0501033_0190336	3300049570	Bacteria	1468
317	Ga0501033_0353193	3300049570	Bacteria	1029
318	Ga0501034_0074710	3300049571	Bacteria	3397
319	Ga0501036_0000462	3300049572	Bacteria	29122
320	Ga0501036_0020687	3300049572	Bacteria	5527
321	Ga0501036_0068778	3300049572	Bacteria	2996
322	Ga0501036_0134907	3300049572	Bacteria	2083
323	Ga0501037_0000915	3300049573	Bacteria	21941
324	Ga0501037_0519385	3300049573	Bacteria	806
325	Ga0501037_0580775	3300049573	Bacteria	754
326	Ga0501038_0001345	3300049574	Bacteria	22388
327	Ga0501038_0075570	3300049574	Bacteria	2847
328	Ga0501038_0515859	3300049574	Bacteria	912
329	Ga0501039_0000528	3300049575	Bacteria	27658
330	Ga0501039_0002890	3300049575	Bacteria	12850
331	Ga0501039_0054320	3300049575	Bacteria	3100
332	Ga0501039_0065473	3300049575	Bacteria	2819
333	Ga0501040_0000234	3300049576	Bacteria	32549
334	Ga0501040_0004493	3300049576	Bacteria	9062
335	Ga0501040_0040484	3300049576	Bacteria	3171
336	Ga0501040_0061569	3300049576	Bacteria	2581
337	Ga0501040_0187434	3300049576	Bacteria	1467
338	Ga0501040_0305540	3300049576	Bacteria	1137
339	Ga0501041_0000176	3300049577	Bacteria	28688
340	Ga0501041_0001613	3300049577	Bacteria	12589
341	Ga0501041_0022646	3300049577	Bacteria	3762
342	Ga0501042_0001987	3300049578	Bacteria	12329
343	Ga0501042_0007569	3300049578	Bacteria	7126
344	Ga0501042_0031348	3300049578	Bacteria	3760
345	Ga0501042_0177439	3300049578	Bacteria	1536
346	Ga0501043_0000798	3300049579	Bacteria	27990
347	Ga0501043_0104980	3300049579	Bacteria	2220
348	Ga0501043_0164777	3300049579	Bacteria	1731
349	Ga0501043_0575287	3300049579	Bacteria	834
350	Ga0501046_0000577	3300049580	Bacteria	36233
351	Ga0501046_0001998	3300049580	Bacteria	19348
352	Ga0501046_0057511	3300049580	Bacteria	3050
353	Ga0501046_0074882	3300049580	Bacteria	2625
354	Ga0501046_0135535	3300049580	Bacteria	1865
355	Ga0501047_0001088	3300049581	Bacteria	27110
356	Ga0501048_0000440	3300049582	Bacteria	29199
357	Ga0501048_0080873	3300049582	Bacteria	2292
358	Ga0501048_0212642	3300049582	Bacteria	1371
359	Ga0501048_0311063	3300049582	Bacteria	1121
360	Ga0501067_0000470	3300049583	Bacteria	21961
361	Ga0501067_0008570	3300049583	Bacteria	5671
362	Ga0501067_0017132	3300049583	Bacteria	4004
363	Ga0501067_0434521	3300049583	Bacteria	733
364	Ga0501068_0000344	3300049584	Bacteria	23396
365	Ga0501068_0047509	3300049584	Bacteria	2589
366	Ga0501068_0053171	3300049584	Bacteria	2451
367	Ga0501068_0456851	3300049584	Bacteria	826
368	Ga0501069_0003245	3300049585	Bacteria	8341
369	Ga0501069_0021717	3300049585	Bacteria	3486
370	Ga0501070_0002078	3300049586	Bacteria	17588
371	Ga0501070_0031201	3300049586	Bacteria	4464
372	Ga0501070_0180268	3300049586	Bacteria	1738
373	Ga0501070_1298992	3300049586	Unclassified	555
374	Ga0501071_0000054	3300049587	Bacteria	38443
375	Ga0501071_0001775	3300049587	Bacteria	12713
376	Ga0501071_0048976	3300049587	Bacteria	3040
377	Ga0501071_0111669	3300049587	Bacteria	2020
378	Ga0501071_0697620	3300049587	Bacteria	781
379	Ga0501072_0001204	3300049588	Bacteria	19296
380	Ga0501072_0017146	3300049588	Bacteria	5564
381	Ga0501072_0251476	3300049588	Bacteria	1407
382	Ga0501073_0006519	3300049589	Bacteria	8684
383	Ga0501073_0008654	3300049589	Bacteria	7540
384	Ga0501073_0380895	3300049589	Bacteria	974
385	Ga0501073_0389563	3300049589	Bacteria	963
386	Ga0501074_0000008	3300049590	Bacteria	105048
387	Ga0501074_0041006	3300049590	Bacteria	3351
388	Ga0501074_0074220	3300049590	Bacteria	2442
389	Ga0501074_0532376	3300049590	Bacteria	832
390	Ga0501075_0000096	3300049591	Bacteria	40796
391	Ga0501075_0000800	3300049591	Bacteria	19695
392	Ga0501075_0053142	3300049591	Bacteria	3046
393	Ga0501075_0196259	3300049591	Bacteria	1539
394	Ga0501076_0000020	3300049592	Bacteria	86221
395	Ga0501076_0000459	3300049592	Bacteria	25828
396	Ga0501076_0075018	3300049592	Bacteria	2710
397	Ga0501076_0100313	3300049592	Bacteria	2332
398	Ga0501076_0385669	3300049592	Bacteria	1152
399	Ga0501076_0551321	3300049592	Bacteria	950
400	Ga0501077_0001221	3300049593	Bacteria	15525
401	Ga0501077_0011129	3300049593	Bacteria	5613
402	Ga0501077_0021332	3300049593	Bacteria	4098
403	Ga0501077_0348023	3300049593	Bacteria	945
404	Ga0501079_0000001	3300049741	Bacteria	121247
405	Ga0501079_0003968	3300049741	Bacteria	10931
406	Ga0501079_0017178	3300049741	Bacteria	5524
407	Ga0501079_0057524	3300049741	Bacteria	3000
408	Ga0501079_0328032	3300049741	Bacteria	1198
409	Ga0501080_0002158	3300049742	Bacteria	17095
410	Ga0501080_0032227	3300049742	Bacteria	4886
411	Ga0501080_0497006	3300049742	Bacteria	1090
412	Ga0501081_0000001	3300049743	Bacteria	115059
413	Ga0501081_0003671	3300049743	Bacteria	9825
414	Ga0501081_0005491	3300049743	Bacteria	8184
415	Ga0501081_0208814	3300049743	Bacteria	1418
416	Ga0501081_0390330	3300049743	Bacteria	1029
417	Ga0501081_0601616	3300049743	Bacteria	823
418	Ga0501083_0000490	3300049744	Bacteria	25303
419	Ga0501083_0002293	3300049744	Bacteria	13098
420	Ga0501035_0001281	3300049822	Bacteria	25975
421	Ga0501035_0014222	3300049822	Bacteria	7344
422	Ga0501035_0149812	3300049822	Bacteria	2025
423	Ga0501035_0215516	3300049822	Bacteria	1641
424	Ga0501044_0004690	3300049823	Bacteria	15285
425	Ga0501045_0000736	3300049824	Bacteria	20879
426	Ga0501045_0000928	3300049824	Bacteria	19139
427	Ga0501045_0009428	3300049824	Bacteria	6828
428	Ga0501045_0032587	3300049824	Bacteria	3776
429	Ga0501045_0164385	3300049824	Bacteria	1652
430	Ga0501045_0636770	3300049824	Bacteria	788
431	nmdc:mga0yw44_504283_c1	3300050492	Bacteria	821
432	nmdc:mga05p37_2318_c1	3300050507	Bacteria	22162
433	nmdc:mga05p37_386806_c1	3300050507	Bacteria	1637
434	nmdc:mga05p37_803500_c1	3300050507	Bacteria	1029
435	nmdc:mga0qj67_106600_c1	3300050509	Bacteria	2261
436	nmdc:mga0qj67_26573_c1	3300050509	Bacteria	4480
437	nmdc:mga0qj67_283040_c1	3300050509	Bacteria	1344
438	nmdc:mga06r32_51930_c1	3300050510	Bacteria	3925
439	nmdc:mga08y16_115456_c1	3300050511	Bacteria	2795
440	nmdc:mga08y16_362862_c1	3300050511	Bacteria	1487
441	nmdc:mga0a205_160329_c1	3300050515	Bacteria	2146
442	Ga0501084_0000283	3300054114	Bacteria	38382
443	Ga0501084_0000615	3300054114	Bacteria	27138
444	Ga0501084_0051727	3300054114	Bacteria	3438
445	Ga0501084_0072393	3300054114	Bacteria	2886
446	Ga0501084_0445689	3300054114	Bacteria	1094
447	Ga0501084_0589230	3300054114	Bacteria	939
448	Ga0501084_0604087	3300054114	Bacteria	927
449	Ga0590074_003965	3300059423	Bacteria	2447
450	Ga0590077_005658	3300059426	Bacteria	2554
451	Ga0501082_0000620	3300060353	Bacteria	31200
452	Ga0501082_0458768	3300060353	Bacteria	1113
453	Ga0530510_0001002	3300061734	Bacteria	18761
454	Ga0530510_0001060	3300061734	Bacteria	18252
455	Ga0530510_0006705	3300061734	Bacteria	8028
456	Ga0530510_0018790	3300061734	Bacteria	4902
457	Ga0530510_0068560	3300061734	Bacteria	2573
458	Ga0530510_0124087	3300061734	Bacteria	1897
459	Ga0530510_0427301	3300061734	Bacteria	1000

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300025924	Ga0207694_10078985	Ga0207694_100789852	147
2	3300005616	Ga0068852_101200015	Ga0068852_1012000152	150
3	3300009551	Ga0105238_12438983	Ga0105238_124389831	150
4	3300041512	Ga0451853_0090004	Ga0451853_0090004_55_507	150
5	3300048915	Ga0496112_0493546	Ga0496112_0493546_74_526	150
6	3300005327	Ga0070658_10070570	Ga0070658_100705702	151
7	3300005336	Ga0070680_100174254	Ga0070680_1001742542	151
8	3300005336	Ga0070680_100497730	Ga0070680_1004977302	151
9	3300005366	Ga0070659_100588080	Ga0070659_1005880802	151
10	3300005530	Ga0070679_100133301	Ga0070679_1001333013	151
11	3300005530	Ga0070679_100157859	Ga0070679_1001578592	151
12	3300005535	Ga0070684_100238029	Ga0070684_1002380292	151
13	3300005539	Ga0068853_100736365	Ga0068853_1007363652	151
14	3300013100	Ga0157373_11199382	Ga0157373_111993822	151
15	3300025912	Ga0207707_10122497	Ga0207707_101224972	151
16	3300025919	Ga0207657_10034499	Ga0207657_100344994	151
17	3300026041	Ga0207639_10436784	Ga0207639_104367842	151
18	3300042005	Ga0439448_0051420	Ga0439448_0051420_174_629	151
19	3300049583	Ga0501067_0017132	Ga0501067_0017132_616_1071	151
20	3300005366	Ga0070659_100014825	Ga0070659_1000148253	152
21	3300005458	Ga0070681_10496921	Ga0070681_104969212	152
22	3300005530	Ga0070679_100130876	Ga0070679_1001308762	152
23	3300005530	Ga0070679_101188708	Ga0070679_1011887082	152
24	3300005616	Ga0068852_100197160	Ga0068852_1001971602	152
25	3300009551	Ga0105238_11602152	Ga0105238_116021521	152
26	3300013104	Ga0157370_10515046	Ga0157370_105150462	152
27	3300017792	Ga0163161_11093152	Ga0163161_110931522	152
28	3300020069	Ga0197907_10369962	Ga0197907_103699622	152
29	3300020081	Ga0206354_10247831	Ga0206354_102478312	152
30	3300020082	Ga0206353_11089650	Ga0206353_110896502	152
31	3300025912	Ga0207707_10384688	Ga0207707_103846881	152
32	3300025921	Ga0207652_10351607	Ga0207652_103516072	152
33	3300026142	Ga0207698_10351092	Ga0207698_103510922	152
34	3300035116	Ga0373945_0141972	Ga0373945_0141972_448_909	152
35	3300037068	Ga0373925_0828471	Ga0373925_0828471_13_486	152
36	3300037312	Ga0395899_0006920	Ga0395899_0006920_5288_5746	152
37	3300037418	Ga0395900_0300206	Ga0395900_0300206_979_1437	152
38	3300037466	Ga0395898_0001875	Ga0395898_0001875_18637_19095	152
39	3300038443	Ga0395901_0019001	Ga0395901_0019001_1523_1981	152
40	3300042157	Ga0439458_0036027	Ga0439458_0036027_565_1026	152
41	3300046689	Ga0495613_0289669	Ga0495613_0289669_648_1118	152
42	3300005337	Ga0070682_100154843	Ga0070682_1001548432	153
43	3300005339	Ga0070660_100268369	Ga0070660_1002683692	153
44	3300005366	Ga0070659_100045699	Ga0070659_1000456993	153
45	3300005435	Ga0070714_100729994	Ga0070714_1007299942	153
46	3300005458	Ga0070681_10094169	Ga0070681_100941693	153
47	3300005471	Ga0070698_101780629	Ga0070698_1017806291	153
48	3300005530	Ga0070679_100106302	Ga0070679_1001063022	153
49	3300005535	Ga0070684_100227446	Ga0070684_1002274461	153
50	3300005563	Ga0068855_101676490	Ga0068855_1016764902	153
51	3300005616	Ga0068852_100642962	Ga0068852_1006429621	153
52	3300013105	Ga0157369_10801573	Ga0157369_108015732	153
53	3300020070	Ga0206356_11410211	Ga0206356_114102112	153
54	3300020070	Ga0206356_11501934	Ga0206356_115019341	153
55	3300020082	Ga0206353_12040689	Ga0206353_120406892	153
56	3300021441	Ga0213871_10121145	Ga0213871_101211452	153
57	3300025912	Ga0207707_10065796	Ga0207707_100657962	153
58	3300025917	Ga0207660_10032985	Ga0207660_100329853	153
59	3300025919	Ga0207657_10015154	Ga0207657_100151544	153
60	3300025922	Ga0207646_11283483	Ga0207646_112834832	153
61	3300025929	Ga0207664_10735278	Ga0207664_107352782	153
62	3300025929	Ga0207664_11767126	Ga0207664_117671261	153
63	3300025932	Ga0207690_10217251	Ga0207690_102172512	153
64	3300026078	Ga0207702_10315932	Ga0207702_103159322	153
65	3300026142	Ga0207698_10619671	Ga0207698_106196712	153
66	3300028563	Ga0265319_1001733	Ga0265319_10017338	153
67	3300028573	Ga0265334_10001101	Ga0265334_100011014	153
68	3300028577	Ga0265318_10001418	Ga0265318_100014182	153
69	3300028800	Ga0265338_10099685	Ga0265338_100996853	153
70	3300031235	Ga0265330_10002530	Ga0265330_1000253010	153
71	3300031238	Ga0265332_10001984	Ga0265332_100019849	153
72	3300031239	Ga0265328_10006199	Ga0265328_100061997	153
73	3300031240	Ga0265320_10028616	Ga0265320_100286162	153
74	3300031241	Ga0265325_10001202	Ga0265325_1000120218	153
75	3300031242	Ga0265329_10004897	Ga0265329_100048972	153
76	3300031247	Ga0265340_10001330	Ga0265340_100013305	153
77	3300031249	Ga0265339_10004586	Ga0265339_100045862	153
78	3300031250	Ga0265331_10093491	Ga0265331_100934912	153
79	3300031251	Ga0265327_10009773	Ga0265327_100097732	153
80	3300031344	Ga0265316_10017243	Ga0265316_100172432	153
81	3300031595	Ga0265313_10004804	Ga0265313_100048045	153
82	3300031711	Ga0265314_10008470	Ga0265314_100084702	153
83	3300031712	Ga0265342_10023644	Ga0265342_100236446	153
84	3300035172	Ga0373955_0033805	Ga0373955_0033805_1925_2392	153
85	3300036401	Ga0373937_0067243	Ga0373937_0067243_1213_1680	153
86	3300037312	Ga0395899_0290612	Ga0395899_0290612_446_907	153
87	3300037418	Ga0395900_0343228	Ga0395900_0343228_771_1232	153
88	3300038443	Ga0395901_0155817	Ga0395901_0155817_511_972	153
89	3300038443	Ga0395901_1032395	Ga0395901_1032395_313_774	153
90	3300039438	Ga0436360_0173849	Ga0436360_0173849_406_867	153
91	3300045051	Ga0451576_0383249	Ga0451576_0383249_531_995	153
92	3300045976	Ga0466967_0121143	Ga0466967_0121143_244_705	153
93	3300046463	Ga0495653_0050259	Ga0495653_0050259_1357_1824	153
94	3300046477	Ga0495664_0711981	Ga0495664_0711981_23_490	153
95	3300046511	Ga0495608_0042731	Ga0495608_0042731_130_597	153
96	3300046675	Ga0495657_0010689	Ga0495657_0010689_5445_5912	153
97	3300047322	Ga0495680_0046294	Ga0495680_0046294_1732_2199	153
98	3300047471	Ga0495684_0112963	Ga0495684_0112963_1488_1955	153
99	3300048909	Ga0496106_0003838	Ga0496106_0003838_9238_9702	153
100	3300048910	Ga0496107_0013209	Ga0496107_0013209_3285_3749	153
101	3300048912	Ga0496109_0039250	Ga0496109_0039250_3046_3519	153
102	3300048913	Ga0496110_0338388	Ga0496110_0338388_16_480	153
103	3300048913	Ga0496110_0666983	Ga0496110_0666983_357_830	153
104	3300048914	Ga0496111_0034932	Ga0496111_0034932_2456_2929	153
105	3300048915	Ga0496112_0125902	Ga0496112_0125902_1521_1994	153
106	3300048917	Ga0496114_0820429	Ga0496114_0820429_98_571	153
107	3300049569	Ga0501032_0845823	Ga0501032_0845823_20_490	153
108	3300061734	Ga0530510_0427301	Ga0530510_0427301_130_600	153
109	3300005327	Ga0070658_10015063	Ga0070658_100150634	154
110	3300005327	Ga0070658_10116793	Ga0070658_101167933	154
111	3300005329	Ga0070683_100075139	Ga0070683_1000751392	154
112	3300005329	Ga0070683_100099907	Ga0070683_1000999072	154
113	3300005329	Ga0070683_100815674	Ga0070683_1008156742	154
114	3300005336	Ga0070680_100299104	Ga0070680_1002991042	154
115	3300005337	Ga0070682_100348266	Ga0070682_1003482662	154
116	3300005339	Ga0070660_100471732	Ga0070660_1004717322	154
117	3300005339	Ga0070660_100687506	Ga0070660_1006875061	154
118	3300005344	Ga0070661_100020187	Ga0070661_1000201874	154
119	3300005344	Ga0070661_100254718	Ga0070661_1002547181	154
120	3300005366	Ga0070659_100075497	Ga0070659_1000754971	154
121	3300005435	Ga0070714_101147513	Ga0070714_1011475131	154
122	3300005439	Ga0070711_101641253	Ga0070711_1016412531	154
123	3300005445	Ga0070708_100132828	Ga0070708_1001328283	154
124	3300005445	Ga0070708_101271884	Ga0070708_1012718841	154
125	3300005455	Ga0070663_101295453	Ga0070663_1012954531	154
126	3300005458	Ga0070681_10027200	Ga0070681_100272003	154
127	3300005458	Ga0070681_10145023	Ga0070681_101450232	154
128	3300005468	Ga0070707_100380288	Ga0070707_1003802882	154
129	3300005530	Ga0070679_100011004	Ga0070679_1000110047	154
130	3300005530	Ga0070679_100022714	Ga0070679_1000227145	154
131	3300005535	Ga0070684_100103688	Ga0070684_1001036882	154
132	3300005539	Ga0068853_100184595	Ga0068853_1001845951	154
133	3300005548	Ga0070665_100090599	Ga0070665_1000905992	154
134	3300005563	Ga0068855_100182389	Ga0068855_1001823893	154
135	3300005563	Ga0068855_100808864	Ga0068855_1008088642	154
136	3300005564	Ga0070664_100484286	Ga0070664_1004842862	154
137	3300005577	Ga0068857_100018224	Ga0068857_1000182245	154
138	3300005577	Ga0068857_100243325	Ga0068857_1002433252	154
139	3300005614	Ga0068856_100826625	Ga0068856_1008266252	154
140	3300005985	Ga0081539_10062333	Ga0081539_100623332	154
141	3300006914	Ga0075436_100738084	Ga0075436_1007380842	154
142	3300009093	Ga0105240_10076875	Ga0105240_100768756	154
143	3300009147	Ga0114129_10596469	Ga0114129_105964692	154
144	3300009551	Ga0105238_10072267	Ga0105238_100722672	154
145	3300010375	Ga0105239_10382721	Ga0105239_103827212	154
146	3300010375	Ga0105239_12862474	Ga0105239_128624741	154
147	3300013100	Ga0157373_10019815	Ga0157373_100198152	154
148	3300013104	Ga0157370_10127851	Ga0157370_101278513	154
149	3300013104	Ga0157370_10569794	Ga0157370_105697942	154
150	3300013105	Ga0157369_10127560	Ga0157369_101275603	154
151	3300013105	Ga0157369_11265717	Ga0157369_112657172	154
152	3300013296	Ga0157374_11117628	Ga0157374_111176281	154
153	3300013307	Ga0157372_10263042	Ga0157372_102630422	154
154	3300013307	Ga0157372_11476347	Ga0157372_114763472	154
155	3300020069	Ga0197907_10648429	Ga0197907_106484292	154
156	3300020080	Ga0206350_10712675	Ga0206350_107126751	154
157	3300020081	Ga0206354_11183078	Ga0206354_111830782	154
158	3300020082	Ga0206353_10885954	Ga0206353_108859542	154
159	3300020082	Ga0206353_11647635	Ga0206353_116476352	154
160	3300025321	Ga0207656_10051258	Ga0207656_100512582	154
161	3300025904	Ga0207647_10197100	Ga0207647_101971002	154
162	3300025911	Ga0207654_10687812	Ga0207654_106878122	154
163	3300025912	Ga0207707_10051905	Ga0207707_100519052	154
164	3300025913	Ga0207695_11418319	Ga0207695_114183192	154
165	3300025914	Ga0207671_10304417	Ga0207671_103044172	154
166	3300025917	Ga0207660_10017699	Ga0207660_100176993	154
167	3300025919	Ga0207657_10005284	Ga0207657_100052845	154
168	3300025919	Ga0207657_10383365	Ga0207657_103833652	154
169	3300025920	Ga0207649_10074133	Ga0207649_100741333	154
170	3300025921	Ga0207652_10032369	Ga0207652_100323695	154
171	3300025921	Ga0207652_10566618	Ga0207652_105666182	154
172	3300025922	Ga0207646_10059910	Ga0207646_100599102	154
173	3300025924	Ga0207694_10060508	Ga0207694_100605083	154
174	3300025929	Ga0207664_10359791	Ga0207664_103597912	154
175	3300025932	Ga0207690_10011819	Ga0207690_100118196	154
176	3300025944	Ga0207661_10022508	Ga0207661_100225082	154
177	3300025944	Ga0207661_10113176	Ga0207661_101131762	154
178	3300025949	Ga0207667_10104673	Ga0207667_101046733	154
179	3300025949	Ga0207667_10335556	Ga0207667_103355562	154
180	3300025949	Ga0207667_10606328	Ga0207667_106063282	154
181	3300025981	Ga0207640_10370815	Ga0207640_103708152	154
182	3300026041	Ga0207639_10045706	Ga0207639_100457063	154
183	3300026041	Ga0207639_10161159	Ga0207639_101611592	154
184	3300026078	Ga0207702_11503121	Ga0207702_115031212	154
185	3300026116	Ga0207674_10060145	Ga0207674_100601453	154
186	3300026142	Ga0207698_11212422	Ga0207698_112124222	154
187	3300028379	Ga0268266_10046859	Ga0268266_100468593	154
188	3300037466	Ga0395898_0155396	Ga0395898_0155396_602_1075	154
189	3300044706	Ga0466964_0005916	Ga0466964_0005916_289_759	154
190	3300045976	Ga0466967_0000455	Ga0466967_0000455_8515_8982	154
191	3300045976	Ga0466967_0033564	Ga0466967_0033564_1413_1883	154
192	3300045976	Ga0466967_0170297	Ga0466967_0170297_1046_1516	154
193	3300046531	Ga0495665_0151413	Ga0495665_0151413_25_489	154
194	3300048905	Ga0496102_1517015	Ga0496102_1517015_92_562	154
195	3300049569	Ga0501032_0047232	Ga0501032_0047232_347_820	154
196	3300049570	Ga0501033_0353193	Ga0501033_0353193_43_516	154
197	3300049572	Ga0501036_0068778	Ga0501036_0068778_2347_2820	154
198	3300049573	Ga0501037_0580775	Ga0501037_0580775_143_616	154
199	3300049574	Ga0501038_0515859	Ga0501038_0515859_308_781	154
200	3300049575	Ga0501039_0002890	Ga0501039_0002890_3863_4336	154
201	3300049576	Ga0501040_0187434	Ga0501040_0187434_457_930	154
202	3300049578	Ga0501042_0177439	Ga0501042_0177439_293_766	154
203	3300049579	Ga0501043_0575287	Ga0501043_0575287_223_696	154
204	3300049580	Ga0501046_0057511	Ga0501046_0057511_684_1157	154
205	3300049582	Ga0501048_0311063	Ga0501048_0311063_140_613	154
206	3300049583	Ga0501067_0000470	Ga0501067_0000470_3760_4227	154
207	3300049583	Ga0501067_0434521	Ga0501067_0434521_169_636	154
208	3300049584	Ga0501068_0053171	Ga0501068_0053171_1662_2129	154
209	3300049584	Ga0501068_0456851	Ga0501068_0456851_176_649	154
210	3300049585	Ga0501069_0003245	Ga0501069_0003245_5023_5490	154
211	3300049586	Ga0501070_0031201	Ga0501070_0031201_69_542	154
212	3300049587	Ga0501071_0697620	Ga0501071_0697620_16_489	154
213	3300049589	Ga0501073_0380895	Ga0501073_0380895_243_716	154
214	3300049592	Ga0501076_0551321	Ga0501076_0551321_398_871	154
215	3300049593	Ga0501077_0348023	Ga0501077_0348023_457_930	154
216	3300049741	Ga0501079_0057524	Ga0501079_0057524_2154_2627	154
217	3300049743	Ga0501081_0390330	Ga0501081_0390330_100_573	154
218	3300049743	Ga0501081_0601616	Ga0501081_0601616_246_713	154
219	3300049744	Ga0501083_0002293	Ga0501083_0002293_11003_11476	154
220	3300049822	Ga0501035_0014222	Ga0501035_0014222_293_766	154
221	3300049824	Ga0501045_0032587	Ga0501045_0032587_2561_3034	154
222	3300054114	Ga0501084_0445689	Ga0501084_0445689_329_802	154
223	3300054114	Ga0501084_0589230	Ga0501084_0589230_161_634	154
224	3300060353	Ga0501082_0458768	Ga0501082_0458768_184_657	154
225	3300061734	Ga0530510_0068560	Ga0530510_0068560_243_710	154
226	3300005719	Ga0068861_100602304	Ga0068861_1006023042	155
227	3300006847	Ga0075431_100051547	Ga0075431_1000515475	155
228	3300009147	Ga0114129_10583487	Ga0114129_105834872	155
229	3300027717	Ga0209998_10035180	Ga0209998_100351802	155
230	3300027907	Ga0207428_10068629	Ga0207428_100686292	155
231	3300031548	Ga0307408_100030330	Ga0307408_1000303303	155
232	3300031548	Ga0307408_101005551	Ga0307408_1010055512	155
233	3300031824	Ga0307413_10020673	Ga0307413_100206733	155
234	3300031901	Ga0307406_10046866	Ga0307406_100468662	155
235	3300031903	Ga0307407_10080901	Ga0307407_100809012	155
236	3300031911	Ga0307412_10014671	Ga0307412_100146713	155
237	3300031995	Ga0307409_100057589	Ga0307409_1000575893	155
238	3300032002	Ga0307416_100032245	Ga0307416_1000322452	155
239	3300032004	Ga0307414_10076757	Ga0307414_100767572	155
240	3300032005	Ga0307411_10085169	Ga0307411_100851692	155
241	3300032126	Ga0307415_100008441	Ga0307415_1000084415	155
242	3300035083	Ga0373926_0111316	Ga0373926_0111316_31_498	155
243	3300035089	Ga0373944_0016874	Ga0373944_0016874_1286_1753	155
244	3300037418	Ga0395900_0025290	Ga0395900_0025290_4270_4737	155
245	3300037466	Ga0395898_0003526	Ga0395898_0003526_5160_5627	155
246	3300037471	Ga0395905_0021602	Ga0395905_0021602_900_1367	155
247	3300038443	Ga0395901_0012794	Ga0395901_0012794_3093_3560	155
248	3300046461	Ga0495641_0004211	Ga0495641_0004211_4699_5166	155
249	3300046674	Ga0495588_0001142	Ga0495588_0001142_2057_2524	155
250	3300047321	Ga0495676_0013121	Ga0495676_0013121_2854_3321	155
251	3300050492	nmdc:mga0yw44_504283_c1	nmdc:mga0yw44_504283_c1_91_561	155
252	3300050507	nmdc:mga05p37_2318_c1	nmdc:mga05p37_2318_c1_16699_17169	155
253	3300050507	nmdc:mga05p37_803500_c1	nmdc:mga05p37_803500_c1_270_743	155
254	3300050509	nmdc:mga0qj67_106600_c1	nmdc:mga0qj67_106600_c1_402_872	155
255	3300050510	nmdc:mga06r32_51930_c1	nmdc:mga06r32_51930_c1_359_829	155
256	3300050511	nmdc:mga08y16_362862_c1	nmdc:mga08y16_362862_c1_740_1213	155
257	3300005937	Ga0081455_10083804	Ga0081455_100838043	156
258	3300006871	Ga0075434_101341496	Ga0075434_1013414962	156
259	3300006881	Ga0068865_101674768	Ga0068865_1016747682	156
260	3300009094	Ga0111539_10480498	Ga0111539_104804982	156
261	3300026118	Ga0207675_100832793	Ga0207675_1008327931	156
262	3300041512	Ga0451853_2478238	Ga0451853_2478238_92_562	156
263	3300045976	Ga0466967_0722821	Ga0466967_0722821_271_801	156
264	3300049568	Ga0501031_0073116	Ga0501031_0073116_1094_1564	156
265	3300049573	Ga0501037_0519385	Ga0501037_0519385_57_527	156
266	3300049574	Ga0501038_0075570	Ga0501038_0075570_981_1451	156
267	3300049575	Ga0501039_0054320	Ga0501039_0054320_791_1261	156
268	3300049576	Ga0501040_0061569	Ga0501040_0061569_512_982	156
269	3300049576	Ga0501040_0305540	Ga0501040_0305540_296_766	156
270	3300049577	Ga0501041_0022646	Ga0501041_0022646_1632_2102	156
271	3300049578	Ga0501042_0031348	Ga0501042_0031348_1358_1828	156
272	3300049579	Ga0501043_0164777	Ga0501043_0164777_993_1463	156
273	3300049580	Ga0501046_0135535	Ga0501046_0135535_1168_1638	156
274	3300049582	Ga0501048_0080873	Ga0501048_0080873_603_1073	156
275	3300049587	Ga0501071_0048976	Ga0501071_0048976_602_1072	156
276	3300049588	Ga0501072_0017146	Ga0501072_0017146_4276_4746	156
277	3300049590	Ga0501074_0532376	Ga0501074_0532376_249_719	156
278	3300049591	Ga0501075_0196259	Ga0501075_0196259_761_1231	156
279	3300049592	Ga0501076_0075018	Ga0501076_0075018_1472_1942	156
280	3300049593	Ga0501077_0011129	Ga0501077_0011129_4639_5109	156
281	3300049741	Ga0501079_0017178	Ga0501079_0017178_311_781	156
282	3300049742	Ga0501080_0497006	Ga0501080_0497006_206_676	156
283	3300049743	Ga0501081_0005491	Ga0501081_0005491_7435_7905	156
284	3300049822	Ga0501035_0149812	Ga0501035_0149812_1508_1978	156
285	3300049824	Ga0501045_0009428	Ga0501045_0009428_1788_2258	156
286	3300050511	nmdc:mga08y16_115456_c1	nmdc:mga08y16_115456_c1_1850_2323	156
287	3300050515	nmdc:mga0a205_160329_c1	nmdc:mga0a205_160329_c1_795_1268	156
288	3300054114	Ga0501084_0072393	Ga0501084_0072393_576_1046	156
289	3300061734	Ga0530510_0006705	Ga0530510_0006705_5145_5615	156
290	3300061734	Ga0530510_0124087	Ga0530510_0124087_1052_1522	156
291	3300005937	Ga0081455_10684329	Ga0081455_106843292	157
292	3300042993	Ga0439440_0103540	Ga0439440_0103540_20_496	157
293	3300050507	nmdc:mga05p37_386806_c1	nmdc:mga05p37_386806_c1_379_852	157
294	3300003373	JGI25407J50210_10027950	JGI25407J50210_100279502	158
295	3300005329	Ga0070683_100022595	Ga0070683_1000225953	158
296	3300005329	Ga0070683_100316183	Ga0070683_1003161832	158
297	3300005329	Ga0070683_101195209	Ga0070683_1011952091	158
298	3300005336	Ga0070680_100155257	Ga0070680_1001552572	158
299	3300005336	Ga0070680_100724517	Ga0070680_1007245172	158
300	3300005337	Ga0070682_100015278	Ga0070682_1000152782	158
301	3300005338	Ga0068868_100590599	Ga0068868_1005905992	158
302	3300005344	Ga0070661_100600424	Ga0070661_1006004242	158
303	3300005455	Ga0070663_100053269	Ga0070663_1000532692	158
304	3300005456	Ga0070678_100046369	Ga0070678_1000463692	158
305	3300005458	Ga0070681_10001855	Ga0070681_100018558	158
306	3300005468	Ga0070707_100002585	Ga0070707_10000258514	158
307	3300005518	Ga0070699_100180237	Ga0070699_1001802372	158
308	3300005530	Ga0070679_100024040	Ga0070679_1000240408	158
309	3300005535	Ga0070684_100050911	Ga0070684_1000509113	158
310	3300005547	Ga0070693_100032753	Ga0070693_1000327533	158
311	3300005614	Ga0068856_100152722	Ga0068856_1001527222	158
312	3300005614	Ga0068856_100303847	Ga0068856_1003038472	158
313	3300005615	Ga0070702_100664233	Ga0070702_1006642332	158
314	3300005981	Ga0081538_10007728	Ga0081538_100077288	158
315	3300006846	Ga0075430_100455337	Ga0075430_1004553372	158
316	3300009098	Ga0105245_10250360	Ga0105245_102503602	158
317	3300009174	Ga0105241_11184637	Ga0105241_111846372	158
318	3300009176	Ga0105242_10930539	Ga0105242_109305392	158
319	3300011119	Ga0105246_10194842	Ga0105246_101948422	158
320	3300013100	Ga0157373_10845756	Ga0157373_108457561	158
321	3300013296	Ga0157374_10980286	Ga0157374_109802862	158
322	3300013308	Ga0157375_10121277	Ga0157375_101212773	158
323	3300014969	Ga0157376_10395430	Ga0157376_103954302	158
324	3300025910	Ga0207684_10071038	Ga0207684_100710382	158
325	3300025911	Ga0207654_10076866	Ga0207654_100768662	158
326	3300025912	Ga0207707_10002919	Ga0207707_100029199	158
327	3300025917	Ga0207660_10047469	Ga0207660_100474693	158
328	3300025920	Ga0207649_10821488	Ga0207649_108214881	158
329	3300025921	Ga0207652_10084152	Ga0207652_100841522	158
330	3300025921	Ga0207652_10432409	Ga0207652_104324092	158
331	3300025927	Ga0207687_10008411	Ga0207687_100084112	158
332	3300025934	Ga0207686_10537649	Ga0207686_105376492	158
333	3300025935	Ga0207709_10031561	Ga0207709_100315612	158
334	3300025941	Ga0207711_11108222	Ga0207711_111082222	158
335	3300025944	Ga0207661_10005687	Ga0207661_100056872	158
336	3300025960	Ga0207651_10901898	Ga0207651_109018982	158
337	3300026023	Ga0207677_10092352	Ga0207677_100923522	158
338	3300026067	Ga0207678_10059014	Ga0207678_100590144	158
339	3300026078	Ga0207702_10002686	Ga0207702_100026868	158
340	3300026078	Ga0207702_10115634	Ga0207702_101156342	158
341	3300026089	Ga0207648_10406222	Ga0207648_104062222	158
342	3300026121	Ga0207683_10014446	Ga0207683_100144465	158
343	3300037418	Ga0395900_0356010	Ga0395900_0356010_635_1120	158
344	3300037466	Ga0395898_0080149	Ga0395898_0080149_866_1351	158
345	3300037471	Ga0395905_0628897	Ga0395905_0628897_190_675	158
346	3300038443	Ga0395901_0066637	Ga0395901_0066637_2903_3433	158
347	3300042531	Ga0450918_013821	Ga0450918_013821_57_533	158
348	3300048903	Ga0496100_0473039	Ga0496100_0473039_291_773	158
349	3300048904	Ga0496101_0093846	Ga0496101_0093846_1560_2042	158
350	3300048904	Ga0496101_0453226	Ga0496101_0453226_344_823	158
351	3300048905	Ga0496102_0005080	Ga0496102_0005080_4460_4942	158
352	3300048906	Ga0496103_0033886	Ga0496103_0033886_1608_2090	158
353	3300048907	Ga0496104_0154373	Ga0496104_0154373_237_719	158
354	3300048908	Ga0496105_0136468	Ga0496105_0136468_432_914	158
355	3300048910	Ga0496107_0701207	Ga0496107_0701207_194_676	158
356	3300048912	Ga0496109_0146832	Ga0496109_0146832_1561_2040	158
357	3300048913	Ga0496110_0061466	Ga0496110_0061466_1911_2390	158
358	3300048913	Ga0496110_0111935	Ga0496110_0111935_991_1473	158
359	3300048914	Ga0496111_0008012	Ga0496111_0008012_666_1145	158
360	3300048914	Ga0496111_0332872	Ga0496111_0332872_521_1027	158
361	3300048915	Ga0496112_0648810	Ga0496112_0648810_161_640	158
362	3300048916	Ga0496113_0609380	Ga0496113_0609380_139_618	158
363	3300048917	Ga0496114_0000177	Ga0496114_0000177_32318_32800	158
364	3300048918	Ga0496115_0087488	Ga0496115_0087488_935_1417	158
365	3300049592	Ga0501076_0385669	Ga0501076_0385669_208_696	158
366	3300049743	Ga0501081_0208814	Ga0501081_0208814_723_1199	158
367	3300050509	nmdc:mga0qj67_26573_c1	nmdc:mga0qj67_26573_c1_847_1323	158
368	3300050509	nmdc:mga0qj67_283040_c1	nmdc:mga0qj67_283040_c1_223_699	158
369	3300054114	Ga0501084_0604087	Ga0501084_0604087_371_859	158
370	3300003373	JGI25407J50210_10015139	JGI25407J50210_100151392	159
371	3300005981	Ga0081538_10000151	Ga0081538_100001513	159
372	3300005981	Ga0081538_10001761	Ga0081538_1000176120	159
373	3300005981	Ga0081538_10002077	Ga0081538_1000207710	159
374	3300005981	Ga0081538_10002734	Ga0081538_100027342	159
375	3300014325	Ga0163163_10306827	Ga0163163_103068272	159
376	3300025944	Ga0207661_10198260	Ga0207661_101982602	159
377	3300025945	Ga0207679_10959223	Ga0207679_109592232	159
378	3300031731	Ga0307405_10664004	Ga0307405_106640042	159
379	3300032002	Ga0307416_100083306	Ga0307416_1000833062	159
380	3300049568	Ga0501031_0000033	Ga0501031_0000033_11798_12277	159
381	3300049568	Ga0501031_0006310	Ga0501031_0006310_6280_6759	159
382	3300049569	Ga0501032_0002047	Ga0501032_0002047_8497_8976	159
383	3300049569	Ga0501032_0076317	Ga0501032_0076317_654_1133	159
384	3300049570	Ga0501033_0000388	Ga0501033_0000388_12700_13179	159
385	3300049570	Ga0501033_0069261	Ga0501033_0069261_654_1133	159
386	3300049570	Ga0501033_0190336	Ga0501033_0190336_241_720	159
387	3300049571	Ga0501034_0074710	Ga0501034_0074710_339_818	159
388	3300049572	Ga0501036_0000462	Ga0501036_0000462_12700_13179	159
389	3300049572	Ga0501036_0020687	Ga0501036_0020687_1909_2388	159
390	3300049572	Ga0501036_0134907	Ga0501036_0134907_1491_1970	159
391	3300049573	Ga0501037_0000915	Ga0501037_0000915_9241_9720	159
392	3300049574	Ga0501038_0001345	Ga0501038_0001345_14849_15328	159
393	3300049575	Ga0501039_0000528	Ga0501039_0000528_14587_15066	159
394	3300049575	Ga0501039_0065473	Ga0501039_0065473_1832_2311	159
395	3300049576	Ga0501040_0000234	Ga0501040_0000234_20273_20752	159
396	3300049576	Ga0501040_0004493	Ga0501040_0004493_7975_8454	159
397	3300049576	Ga0501040_0040484	Ga0501040_0040484_2149_2628	159
398	3300049577	Ga0501041_0000176	Ga0501041_0000176_16412_16891	159
399	3300049577	Ga0501041_0001613	Ga0501041_0001613_4543_5022	159
400	3300049578	Ga0501042_0001987	Ga0501042_0001987_9942_10421	159
401	3300049578	Ga0501042_0007569	Ga0501042_0007569_2359_2838	159
402	3300049579	Ga0501043_0000798	Ga0501043_0000798_15392_15871	159
403	3300049579	Ga0501043_0104980	Ga0501043_0104980_33_512	159
404	3300049580	Ga0501046_0000577	Ga0501046_0000577_23055_23534	159
405	3300049580	Ga0501046_0001998	Ga0501046_0001998_5701_6180	159
406	3300049580	Ga0501046_0074882	Ga0501046_0074882_1419_1898	159
407	3300049581	Ga0501047_0001088	Ga0501047_0001088_14513_14992	159
408	3300049582	Ga0501048_0000440	Ga0501048_0000440_16049_16528	159
409	3300049582	Ga0501048_0212642	Ga0501048_0212642_511_990	159
410	3300049583	Ga0501067_0008570	Ga0501067_0008570_2721_3200	159
411	3300049584	Ga0501068_0000344	Ga0501068_0000344_17837_18316	159
412	3300049584	Ga0501068_0047509	Ga0501068_0047509_2037_2516	159
413	3300049585	Ga0501069_0021717	Ga0501069_0021717_1909_2388	159
414	3300049586	Ga0501070_0002078	Ga0501070_0002078_12443_12922	159
415	3300049586	Ga0501070_0180268	Ga0501070_0180268_33_512	159
416	3300049586	Ga0501070_1298992	Ga0501070_1298992_44_523	159
417	3300049587	Ga0501071_0000054	Ga0501071_0000054_23116_23595	159
418	3300049587	Ga0501071_0001775	Ga0501071_0001775_10326_10805	159
419	3300049587	Ga0501071_0111669	Ga0501071_0111669_1097_1576	159
420	3300049588	Ga0501072_0001204	Ga0501072_0001204_7057_7536	159
421	3300049588	Ga0501072_0251476	Ga0501072_0251476_569_1048	159
422	3300049589	Ga0501073_0006519	Ga0501073_0006519_7791_8270	159
423	3300049589	Ga0501073_0008654	Ga0501073_0008654_782_1261	159
424	3300049589	Ga0501073_0389563	Ga0501073_0389563_94_573	159
425	3300049590	Ga0501074_0000008	Ga0501074_0000008_92483_92962	159
426	3300049590	Ga0501074_0041006	Ga0501074_0041006_2272_2751	159
427	3300049590	Ga0501074_0074220	Ga0501074_0074220_1642_2121	159
428	3300049591	Ga0501075_0000096	Ga0501075_0000096_25840_26319	159
429	3300049591	Ga0501075_0000800	Ga0501075_0000800_8216_8695	159
430	3300049591	Ga0501075_0053142	Ga0501075_0053142_1124_1603	159
431	3300049592	Ga0501076_0000020	Ga0501076_0000020_11777_12256	159
432	3300049592	Ga0501076_0000459	Ga0501076_0000459_13544_14023	159
433	3300049592	Ga0501076_0100313	Ga0501076_0100313_46_525	159
434	3300049593	Ga0501077_0001221	Ga0501077_0001221_8585_9064	159
435	3300049593	Ga0501077_0021332	Ga0501077_0021332_609_1088	159
436	3300049741	Ga0501079_0000001	Ga0501079_0000001_105920_106399	159
437	3300049741	Ga0501079_0003968	Ga0501079_0003968_7568_8047	159
438	3300049741	Ga0501079_0328032	Ga0501079_0328032_151_630	159
439	3300049742	Ga0501080_0002158	Ga0501080_0002158_15260_15739	159
440	3300049742	Ga0501080_0032227	Ga0501080_0032227_1837_2316	159
441	3300049743	Ga0501081_0000001	Ga0501081_0000001_105991_106470	159
442	3300049743	Ga0501081_0003671	Ga0501081_0003671_1372_1851	159
443	3300049744	Ga0501083_0000490	Ga0501083_0000490_602_1081	159
444	3300049822	Ga0501035_0001281	Ga0501035_0001281_9064_9543	159
445	3300049822	Ga0501035_0215516	Ga0501035_0215516_462_941	159
446	3300049823	Ga0501044_0004690	Ga0501044_0004690_11192_11671	159
447	3300049824	Ga0501045_0000736	Ga0501045_0000736_1517_1996	159
448	3300049824	Ga0501045_0000928	Ga0501045_0000928_4563_5042	159
449	3300049824	Ga0501045_0164385	Ga0501045_0164385_749_1228	159
450	3300049824	Ga0501045_0636770	Ga0501045_0636770_213_692	159
451	3300054114	Ga0501084_0000283	Ga0501084_0000283_14849_15328	159
452	3300054114	Ga0501084_0000615	Ga0501084_0000615_7905_8384	159
453	3300054114	Ga0501084_0051727	Ga0501084_0051727_2843_3322	159
454	3300059423	Ga0590074_003965	Ga0590074_003965_1534_2025	159
455	3300059426	Ga0590077_005658	Ga0590077_005658_323_814	159
456	3300060353	Ga0501082_0000620	Ga0501082_0000620_13544_14023	159
457	3300061734	Ga0530510_0001002	Ga0530510_0001002_7636_8115	159
458	3300061734	Ga0530510_0001060	Ga0530510_0001060_2452_2931	159
459	3300061734	Ga0530510_0018790	Ga0530510_0018790_568_1047	159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01257

2Fe-2S_thioredx

Thioredoxin-like [2Fe-2S] ferredoxin

30

175

0.98 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7p8n-assembly1.cif.gz_B	tmhydabc- t. maritima hydrogenase with bridge closed	0.8521	77	153
7p8n-assembly1.cif.gz_b	tmhydabc- t. maritima hydrogenase with bridge closed	0.838	77	159
8bew-assembly1.cif.gz_B	cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the oxidised state	0.8321	75	159
7p5h-assembly1.cif.gz_C	tmhydabc- d2 map	0.8042	10	157
7q4v-assembly1.cif.gz_B	electron bifurcating hydrogenase - hydabc from a. woodii	0.8025	72	159

ID	Description	Score	Start	End	Superfamily
af_P0AFD1_83_165_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9664	73	154	3.40.30.10
af_Q9D6J6_126_223_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9621	74	158	3.40.30.10
af_P0AFD1_83_165_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9441	73	154	3.40.30.10
af_B4FPX5_191_300_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9381	74	158	3.40.30.10
af_P9WIV5_106_200_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9367	74	157	3.40.30.10

ID	Description	Score	Start	End	GO Terms
AF-A0A2M7JZR8-F1-model_v4	NADH-quinone oxidoreductase subunit NuoE	0.8728	18	157	GO:0016491 GO:0046872 GO:0051537
AF-A0A1F6PF55-F1-model_v4	Ferredoxin	0.8594	7	156	GO:0005506 GO:0008137 GO:0008901 GO:0016020 GO:0042773 GO:0051539
AF-A0A653A7F6-F1-model_v4	Respiratory-chain NADH dehydrogenase 24 Kd subunit	0.8584	7	156	GO:0016491 GO:0046872 GO:0051537
AF-A0A3N5QQK3-F1-model_v4	NADH-quinone oxidoreductase subunit NuoE (EC 1.6.5.11)	0.8571	13	158	GO:0016491 GO:0046872 GO:0051537
AF-A0A661PR46-F1-model_v4	NADH-quinone oxidoreductase subunit NuoE	0.8546	7	157	GO:0016491 GO:0046872 GO:0051537

Feature Viewer

pLDDT	pTM	Quality
91.24	0.77	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F448366

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01257

2Fe-2S_thioredx

Thioredoxin-like [2Fe-2S] ferredoxin

30

175

0.98

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map