F448357

General Info

Members Datasets Scaffolds Average Seq Length
459 288 918 83

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10270733|Ga0157373_102707332
Length 99
Sequence LLLPIRAGIGAAYVPVVPLYMDVHTVDGGVTIDDVVQAHRADLRTQAAYDVRFLRYWVDEARGRIFCLAEAPSADAAIAVHRQAHGLMADEVYQVQEGS

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
182 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
183 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
184 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
185 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
186 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
188 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
189 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
190 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
191 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
192 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
193 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
194 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
197 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
198 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
203 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
204 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
205 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
206 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
207 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
219 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
220 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
221 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
222 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
223 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
224 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
225 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
226 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
227 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
228 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
229 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
230 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
231 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
232 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
233 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
234 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
235 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
236 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
237 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
238 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
239 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
240 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
241 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
242 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
243 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
244 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
245 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
246 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
247 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
248 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
271 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
272 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
273 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
274 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
275 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
276 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
279 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
280 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
283 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.6
Metatranscriptomes 2.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.66
Rhizosphere 91.5
Stem 0
Stem Tuber 0
Unclassified 15.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10270733 3300013100 Bacteria 1202
2 JGI24741J21665_1061144 3300001915 Bacteria 556
3 JGI24752J21851_1018680 3300001976 Bacteria 904
4 JGI24743J22301_10141374 3300001991 Bacteria 536
5 JGI24033J26618_1071010 3300002155 Bacteria 523
6 JGI24751J29686_10027667 3300002459 Bacteria 1177
7 Ga0058858_1340263 3300004785 Bacteria 506
8 Ga0058859_10098817 3300004798 Bacteria 1439
9 Ga0058859_10111416 3300004798 Bacteria 746
10 Ga0058859_11811655 3300004798 Unclassified 831
11 Ga0058860_10221611 3300004801 Bacteria 1959
12 Ga0058860_10222029 3300004801 Bacteria 655
13 Ga0065707_10410557 3300005295 Bacteria 842
14 Ga0070658_10308328 3300005327 Bacteria 1350
15 Ga0070658_11927187 3300005327 Bacteria 510
16 Ga0070676_10901363 3300005328 Bacteria 659
17 Ga0070683_101783957 3300005329 Bacteria 591
18 Ga0070690_100112425 3300005330 Bacteria 1819
19 Ga0070670_101053701 3300005331 Bacteria 741
20 Ga0070670_101304922 3300005331 Bacteria 664
21 Ga0068869_100002858 3300005334 Bacteria 10472
22 Ga0070680_100172272 3300005336 Bacteria 1821
23 Ga0070680_101373536 3300005336 Unclassified 612
24 Ga0070682_101191098 3300005337 Bacteria 642
25 Ga0070682_101432763 3300005337 Bacteria 592
26 Ga0068868_100778328 3300005338 Unclassified 862
27 Ga0070689_100056933 3300005340 Bacteria 3033
28 Ga0070689_100299335 3300005340 Bacteria 1338
29 Ga0070691_10003331 3300005341 Bacteria 7208
30 Ga0070687_100134648 3300005343 Bacteria 1431
31 Ga0070687_100468222 3300005343 Bacteria 842
32 Ga0070661_101631751 3300005344 Bacteria 545
33 Ga0070692_10028679 3300005345 Bacteria 2768
34 Ga0070668_100897914 3300005347 Bacteria 792
35 Ga0070675_100001503 3300005354 Bacteria 17221
36 Ga0070675_100280023 3300005354 Bacteria 1465
37 Ga0070675_101294509 3300005354 Unclassified 672
38 Ga0070671_100002506 3300005355 Bacteria 14222
39 Ga0070671_100952153 3300005355 Bacteria 751
40 Ga0070674_100349035 3300005356 Bacteria 1194
41 Ga0070673_100063268 3300005364 Bacteria 2943
42 Ga0070688_100102572 3300005365 Unclassified 1889
43 Ga0070659_100564096 3300005366 Bacteria 976
44 Ga0070667_100800134 3300005367 Bacteria 875
45 Ga0070709_10471240 3300005434 Unclassified 949
46 Ga0070714_100294497 3300005435 Bacteria 1511
47 Ga0070701_10552035 3300005438 Unclassified 756
48 Ga0070711_100100985 3300005439 Bacteria 2099
49 Ga0070705_100316293 3300005440 Bacteria 1125
50 Ga0070700_100016169 3300005441 Bacteria 4246
51 Ga0070700_100731586 3300005441 Bacteria 790
52 Ga0070708_100002758 3300005445 Bacteria 13638
53 Ga0070708_100530234 3300005445 Bacteria 1111
54 Ga0070663_100000640 3300005455 Bacteria 18760
55 Ga0070663_100159633 3300005455 Bacteria 1735
56 Ga0070678_100001700 3300005456 Bacteria 11816
57 Ga0070678_100721377 3300005456 Bacteria 900
58 Ga0070662_100219578 3300005457 Bacteria 1516
59 Ga0070681_10013867 3300005458 Bacteria 8021
60 Ga0070681_10541085 3300005458 Bacteria 1078
61 Ga0070681_11923301 3300005458 Bacteria 519
62 Ga0070681_11925966 3300005458 Unclassified 519
63 Ga0068867_100374133 3300005459 Bacteria 1195
64 Ga0070685_10038297 3300005466 Bacteria 2719
65 Ga0070685_10310354 3300005466 Bacteria 1066
66 Ga0070685_10322449 3300005466 Unclassified 1048
67 Ga0070685_10643277 3300005466 Bacteria 768
68 Ga0070706_100561430 3300005467 Bacteria 1062
69 Ga0070706_101488642 3300005467 Bacteria 619
70 Ga0070706_101582054 3300005467 Unclassified 598
71 Ga0070707_101034077 3300005468 Unclassified 787
72 Ga0070699_100723582 3300005518 Bacteria 910
73 Ga0070679_100729493 3300005530 Unclassified 934
74 Ga0070679_100945071 3300005530 Bacteria 806
75 Ga0070684_100010817 3300005535 Bacteria 7246
76 Ga0070684_100109774 3300005535 Bacteria 2472
77 Ga0070684_100649537 3300005535 Bacteria 982
78 Ga0070684_100676410 3300005535 Unclassified 961
79 Ga0070684_100912314 3300005535 Unclassified 823
80 Ga0070684_101869731 3300005535 Bacteria 566
81 Ga0070697_100409213 3300005536 Bacteria 1178
82 Ga0068853_101541204 3300005539 Bacteria 644
83 Ga0070672_100071531 3300005543 Bacteria 2760
84 Ga0070672_100156615 3300005543 Bacteria 1887
85 Ga0070672_101753304 3300005543 Unclassified 558
86 Ga0070686_100886973 3300005544 Unclassified 725
87 Ga0070686_100935130 3300005544 Unclassified 707
88 Ga0070686_101095029 3300005544 Bacteria 658
89 Ga0070686_101198688 3300005544 Unclassified 631
90 Ga0070693_101154562 3300005547 Bacteria 593
91 Ga0070693_101386756 3300005547 Unclassified 546
92 Ga0070665_100049160 3300005548 Bacteria 4231
93 Ga0070665_101113899 3300005548 Bacteria 801
94 Ga0070704_100255160 3300005549 Bacteria 1442
95 Ga0070704_100562308 3300005549 Bacteria 998
96 Ga0070704_101301737 3300005549 Unclassified 665
97 Ga0068855_100447251 3300005563 Bacteria 1410
98 Ga0070664_100512543 3300005564 Bacteria 1106
99 Ga0070664_100734598 3300005564 Bacteria 921
100 Ga0068857_100090264 3300005577 Bacteria 2742
101 Ga0068857_101847683 3300005577 Bacteria 591
102 Ga0068854_101600695 3300005578 Bacteria 593
103 Ga0068856_101008982 3300005614 Bacteria 850
104 Ga0068856_101989970 3300005614 Bacteria 591
105 Ga0068856_101989972 3300005614 Bacteria 591
106 Ga0070702_100001888 3300005615 Bacteria 8782
107 Ga0070702_100238138 3300005615 Bacteria 1227
108 Ga0068852_100188063 3300005616 Bacteria 1946
109 Ga0068859_100040106 3300005617 Bacteria 4699
110 Ga0068859_101191963 3300005617 Unclassified 839
111 Ga0068859_101401905 3300005617 Unclassified 771
112 Ga0068859_102104661 3300005617 Unclassified 623
113 Ga0068864_100333410 3300005618 Bacteria 1428
114 Ga0068864_100759746 3300005618 Bacteria 950
115 Ga0068864_100944595 3300005618 Bacteria 853
116 Ga0068864_101373945 3300005618 Bacteria 708
117 Ga0068866_10594605 3300005718 Bacteria 746
118 Ga0068866_10666909 3300005718 Bacteria 710
119 Ga0068866_11076420 3300005718 Bacteria 575
120 Ga0068861_101578501 3300005719 Bacteria 646
121 Ga0068851_10015276 3300005834 Bacteria 3656
122 Ga0068870_10030557 3300005840 Bacteria 2723
123 Ga0068863_100000817 3300005841 Bacteria 31196
124 Ga0068863_101069915 3300005841 Bacteria 811
125 Ga0068863_101929077 3300005841 Unclassified 601
126 Ga0068863_102125317 3300005841 Unclassified 571
127 Ga0068858_100275126 3300005842 Bacteria 1603
128 Ga0068858_101023603 3300005842 Unclassified 810
129 Ga0068860_100041011 3300005843 Bacteria 4423
130 Ga0068860_101688635 3300005843 Unclassified 655
131 Ga0070716_100650824 3300006173 Bacteria 799
132 Ga0070712_100031995 3300006175 Bacteria 3549
133 Ga0097621_100042830 3300006237 Bacteria 3647
134 Ga0097621_102410231 3300006237 Bacteria 503
135 Ga0068871_100711560 3300006358 Bacteria 921
136 Ga0075428_100255047 3300006844 Bacteria 1889
137 Ga0075428_101913576 3300006844 Bacteria 616
138 Ga0075431_100625664 3300006847 Bacteria 1058
139 Ga0075434_100020122 3300006871 Bacteria 6468
140 Ga0075434_100510513 3300006871 Bacteria 1223
141 Ga0075429_100527815 3300006880 Bacteria 1034
142 Ga0068865_100239397 3300006881 Archaea 1427
143 Ga0068865_100300931 3300006881 Bacteria 1284
144 Ga0068865_101684723 3300006881 Bacteria 571
145 Ga0075436_100003503 3300006914 Bacteria 10757
146 Ga0097620_100040107 3300006931 Bacteria 4699
147 Ga0097620_101192001 3300006931 Unclassified 839
148 Ga0097620_101402085 3300006931 Unclassified 771
149 Ga0097620_102104924 3300006931 Unclassified 623
150 Ga0075435_100092535 3300007076 Bacteria 2497
151 Ga0105251_10022319 3300009011 Bacteria 3287
152 Ga0105251_10386445 3300009011 Bacteria 642
153 Ga0105244_10561828 3300009036 Bacteria 525
154 Ga0105240_10952326 3300009093 Bacteria 921
155 Ga0105240_11818252 3300009093 Bacteria 635
156 Ga0105240_12306770 3300009093 Unclassified 557
157 Ga0111539_10343118 3300009094 Bacteria 1738
158 Ga0111539_10421324 3300009094 Bacteria 1555
159 Ga0111539_10517467 3300009094 Bacteria 1390
160 Ga0111539_12932461 3300009094 Unclassified 552
161 Ga0105245_11766509 3300009098 Bacteria 671
162 Ga0105245_12185948 3300009098 Unclassified 607
163 Ga0105245_12262288 3300009098 Bacteria 597
164 Ga0105245_12262290 3300009098 Bacteria 597
165 Ga0105247_10013549 3300009101 Bacteria 4890
166 Ga0105247_10742577 3300009101 Bacteria 743
167 Ga0114129_10314780 3300009147 Bacteria 2083
168 Ga0105243_10498553 3300009148 Bacteria 1153
169 Ga0105243_11002516 3300009148 Bacteria 838
170 Ga0105241_10003590 3300009174 Bacteria 11538
171 Ga0105242_10160091 3300009176 Bacteria 1970
172 Ga0105242_12147116 3300009176 Bacteria 603
173 Ga0105248_10054523 3300009177 Bacteria 4483
174 Ga0105248_11857289 3300009177 Bacteria 683
175 Ga0105237_10391999 3300009545 Bacteria 1393
176 Ga0105237_10399197 3300009545 Bacteria 1380
177 Ga0105238_10650471 3300009551 Bacteria 1064
178 Ga0105249_10213995 3300009553 Bacteria 1893
179 Ga0105249_10256553 3300009553 Bacteria 1735
180 Ga0105249_10832198 3300009553 Unclassified 988
181 Ga0105239_10029859 3300010375 Bacteria 5995
182 Ga0105239_10180926 3300010375 Unclassified 2359
183 Ga0105246_10011393 3300011119 Bacteria 5520
184 Ga0105246_10669462 3300011119 Bacteria 906
185 Ga0105246_11855841 3300011119 Unclassified 577
186 Ga0157373_10181728 3300013100 Unclassified 1481
187 Ga0157373_10246507 3300013100 Bacteria 1263
188 Ga0157371_10010017 3300013102 Bacteria 7412
189 Ga0157370_10021689 3300013104 Bacteria 6399
190 Ga0157369_10131620 3300013105 Bacteria 2650
191 Ga0157374_10630332 3300013296 Unclassified 1083
192 Ga0157378_10857395 3300013297 Bacteria 937
193 Ga0163162_10122955 3300013306 Bacteria 2700
194 Ga0163162_10365956 3300013306 Archaea 1575
195 Ga0163162_10616049 3300013306 Bacteria 1211
196 Ga0163162_10868972 3300013306 Bacteria 1016
197 Ga0157372_10637531 3300013307 Bacteria 1241
198 Ga0157375_10153918 3300013308 Bacteria 2437
199 Ga0157375_10523791 3300013308 Unclassified 1348
200 Ga0157375_10654007 3300013308 Bacteria 1207
201 Ga0163163_10182783 3300014325 Bacteria 2144
202 Ga0163163_10328083 3300014325 Bacteria 1584
203 Ga0163163_10559004 3300014325 Bacteria 1207
204 Ga0163163_10914413 3300014325 Unclassified 941
205 Ga0163163_11016802 3300014325 Bacteria 892
206 Ga0163163_12748723 3300014325 Bacteria 549
207 Ga0157380_12993662 3300014326 Archaea 538
208 Ga0182008_10022748 3300014497 Bacteria 3208
209 Ga0157377_10041967 3300014745 Bacteria 2540
210 Ga0157377_10104115 3300014745 Bacteria 1696
211 Ga0157377_10545120 3300014745 Bacteria 818
212 Ga0157379_10076368 3300014968 Bacteria 3000
213 Ga0157379_10313881 3300014968 Bacteria 1430
214 Ga0157379_12295754 3300014968 Bacteria 537
215 Ga0157376_10318326 3300014969 Bacteria 1478
216 Ga0157376_10516506 3300014969 Bacteria 1177
217 Ga0157376_11883330 3300014969 Unclassified 635
218 Ga0157376_12295446 3300014969 Unclassified 579
219 Ga0157376_12798765 3300014969 Unclassified 528
220 Ga0163161_10132738 3300017792 Bacteria 1880
221 Ga0163161_10221278 3300017792 Bacteria 1466
222 Ga0206354_10112977 3300020081 Bacteria 1186
223 Ga0206354_10482257 3300020081 Bacteria 638
224 Ga0206353_12006440 3300020082 Bacteria 603
225 Ga0213876_10094355 3300021384 Unclassified 1585
226 Ga0207656_10020359 3300025321 Bacteria 2637
227 Ga0207656_10239596 3300025321 Bacteria 886
228 Ga0207713_1035202 3300025735 Bacteria 2163
229 Ga0207642_10319678 3300025899 Bacteria 906
230 Ga0207688_10002312 3300025901 Bacteria 10244
231 Ga0207688_10209246 3300025901 Bacteria 1172
232 Ga0207688_10812437 3300025901 Bacteria 592
233 Ga0207699_10376457 3300025906 Unclassified 1007
234 Ga0207645_10105887 3300025907 Bacteria 1818
235 Ga0207645_10843379 3300025907 Bacteria 623
236 Ga0207643_10000053 3300025908 Bacteria 74738
237 Ga0207643_10077409 3300025908 Bacteria 1923
238 Ga0207705_10009148 3300025909 Bacteria 7220
239 Ga0207705_10060630 3300025909 Bacteria 2733
240 Ga0207684_10118471 3300025910 Bacteria 2269
241 Ga0207684_11281465 3300025910 Unclassified 604
242 Ga0207654_10184877 3300025911 Bacteria 1362
243 Ga0207707_10191671 3300025912 Bacteria 1783
244 Ga0207707_10776772 3300025912 Bacteria 799
245 Ga0207671_10548852 3300025914 Unclassified 921
246 Ga0207693_10040601 3300025915 Bacteria 3664
247 Ga0207660_10006237 3300025917 Bacteria 7742
248 Ga0207662_10139348 3300025918 Bacteria 1535
249 Ga0207662_10230527 3300025918 Bacteria 1209
250 Ga0207662_10254255 3300025918 Bacteria 1154
251 Ga0207662_10408175 3300025918 Bacteria 922
252 Ga0207662_10691359 3300025918 Unclassified 714
253 Ga0207657_10016092 3300025919 Bacteria 7219
254 Ga0207657_10563851 3300025919 Bacteria 890
255 Ga0207649_10056760 3300025920 Bacteria 2446
256 Ga0207649_10443624 3300025920 Bacteria 978
257 Ga0207652_10005366 3300025921 Bacteria 10397
258 Ga0207694_10298490 3300025924 Unclassified 1326
259 Ga0207650_10001803 3300025925 Bacteria 15141
260 Ga0207659_10050218 3300025926 Bacteria 2962
261 Ga0207659_10719708 3300025926 Bacteria 855
262 Ga0207687_10043256 3300025927 Bacteria 3103
263 Ga0207687_11915214 3300025927 Unclassified 507
264 Ga0207700_11099534 3300025928 Unclassified 711
265 Ga0207664_10190205 3300025929 Bacteria 1767
266 Ga0207644_10069237 3300025931 Bacteria 2576
267 Ga0207644_10915529 3300025931 Bacteria 735
268 Ga0207690_10226525 3300025932 Bacteria 1433
269 Ga0207706_10219254 3300025933 Bacteria 1666
270 Ga0207686_11669259 3300025934 Bacteria 527
271 Ga0207709_10576475 3300025935 Bacteria 888
272 Ga0207709_11314690 3300025935 Bacteria 598
273 Ga0207670_10219264 3300025936 Bacteria 1455
274 Ga0207669_10109280 3300025937 Bacteria 1849
275 Ga0207704_10289155 3300025938 Bacteria 1250
276 Ga0207704_10473600 3300025938 Unclassified 1004
277 Ga0207665_10098812 3300025939 Bacteria 2034
278 Ga0207691_10106118 3300025940 Bacteria 2502
279 Ga0207691_10166146 3300025940 Bacteria 1934
280 Ga0207711_10793240 3300025941 Bacteria 882
281 Ga0207711_11499699 3300025941 Bacteria 617
282 Ga0207711_11849491 3300025941 Bacteria 547
283 Ga0207689_10006383 3300025942 Bacteria 10438
284 Ga0207661_10044049 3300025944 Bacteria 3524
285 Ga0207661_10140147 3300025944 Bacteria 2080
286 Ga0207661_10714407 3300025944 Bacteria 922
287 Ga0207661_10850121 3300025944 Bacteria 840
288 Ga0207661_11853080 3300025944 Unclassified 549
289 Ga0207679_10011011 3300025945 Bacteria 5837
290 Ga0207679_10447500 3300025945 Bacteria 1145
291 Ga0207679_11826848 3300025945 Bacteria 555
292 Ga0207667_10667145 3300025949 Bacteria 1044
293 Ga0207651_10075891 3300025960 Bacteria 2400
294 Ga0207712_10278467 3300025961 Bacteria 1364
295 Ga0207712_10486365 3300025961 Bacteria 1053
296 Ga0207668_10049370 3300025972 Bacteria 2893
297 Ga0207640_10006969 3300025981 Bacteria 6217
298 Ga0207658_10207577 3300025986 Bacteria 1640
299 Ga0207677_10052346 3300026023 Bacteria 2773
300 Ga0207703_10315545 3300026035 Bacteria 1430
301 Ga0207703_10761808 3300026035 Unclassified 923
302 Ga0207703_11276416 3300026035 Bacteria 706
303 Ga0207639_11399422 3300026041 Bacteria 656
304 Ga0207678_10000099 3300026067 Bacteria 70673
305 Ga0207678_10066021 3300026067 Bacteria 3107
306 Ga0207708_10173209 3300026075 Bacteria 1710
307 Ga0207708_10338724 3300026075 Bacteria 1231
308 Ga0207702_10001089 3300026078 Bacteria 27798
309 Ga0207702_11493663 3300026078 Bacteria 669
310 Ga0207641_10130945 3300026088 Bacteria 2252
311 Ga0207641_10401809 3300026088 Bacteria 1316
312 Ga0207641_10657795 3300026088 Bacteria 1029
313 Ga0207641_10963522 3300026088 Bacteria 849
314 Ga0207648_10170779 3300026089 Bacteria 1922
315 Ga0207648_10436302 3300026089 Bacteria 1191
316 Ga0207676_10017755 3300026095 Bacteria 5162
317 Ga0207676_10849693 3300026095 Bacteria 893
318 Ga0207676_11113808 3300026095 Bacteria 781
319 Ga0207674_10062555 3300026116 Bacteria 3760
320 Ga0207674_10098597 3300026116 Bacteria 2905
321 Ga0207675_100364657 3300026118 Bacteria 1418
322 Ga0207675_101928161 3300026118 Bacteria 609
323 Ga0207683_10003708 3300026121 Bacteria 13265
324 Ga0207683_10019015 3300026121 Bacteria 5862
325 Ga0207698_10573311 3300026142 Bacteria 1109
326 Ga0207698_10999120 3300026142 Bacteria 847
327 Ga0207428_10004062 3300027907 Bacteria 14030
328 Ga0207428_10542118 3300027907 Bacteria 842
329 Ga0268266_10172971 3300028379 Bacteria 1961
330 Ga0268265_11249337 3300028380 Bacteria 742
331 Ga0268264_10175794 3300028381 Bacteria 1940
332 Ga0268264_11494252 3300028381 Bacteria 686
333 Ga0265334_10007319 3300028573 Bacteria 4737
334 Ga0265318_10003271 3300028577 Bacteria 8240
335 Ga0265322_10184426 3300028654 Unclassified 597
336 Ga0265338_10018514 3300028800 Bacteria 7452
337 Ga0265324_10057892 3300029957 Bacteria 1326
338 Ga0265760_10033648 3300031090 Bacteria 1514
339 Ga0265330_10186289 3300031235 Bacteria 879
340 Ga0265328_10157085 3300031239 Bacteria 856
341 Ga0265320_10009014 3300031240 Bacteria 6050
342 Ga0265325_10022245 3300031241 Bacteria 3476
343 Ga0265325_10408159 3300031241 Unclassified 595
344 Ga0265329_10185484 3300031242 Unclassified 681
345 Ga0265340_10012997 3300031247 Bacteria 4385
346 Ga0265340_10138444 3300031247 Bacteria 1114
347 Ga0265331_10002298 3300031250 Bacteria 13026
348 Ga0265327_10159754 3300031251 Unclassified 1042
349 Ga0265316_10041501 3300031344 Bacteria 3682
350 Ga0265316_10287273 3300031344 Bacteria 1201
351 Ga0307413_10494380 3300031824 Unclassified 981
352 Ga0307413_10846801 3300031824 Unclassified 772
353 Ga0307410_11469822 3300031852 Bacteria 600
354 Ga0307407_10222261 3300031903 Bacteria 1278
355 Ga0307407_10407302 3300031903 Bacteria 977
356 Ga0307409_100587476 3300031995 Unclassified 1099
357 Ga0307416_101394637 3300032002 Unclassified 806
358 Ga0307416_101719206 3300032002 Bacteria 732
359 Ga0307411_10913330 3300032005 Bacteria 781
360 Ga0373938_0022405 3300034957 Bacteria 1290
361 Ga0373949_0079044 3300035090 Bacteria 874
362 Ga0373939_0104254 3300035114 Bacteria 978
363 Ga0373961_0044602 3300035241 Bacteria 1294
364 Ga0316574_0605312 3300035398 Bacteria 677
365 Ga0316574_0860723 3300035398 Bacteria 550
366 Ga0373924_0273086 3300035410 Bacteria 750
367 Ga0373931_0927322 3300035691 Bacteria 586
368 Ga0373935_1205175 3300035692 Bacteria 564
369 Ga0373947_0265486 3300035725 Bacteria 1138
370 Ga0373937_1903263 3300036401 Bacteria 541
371 Ga0373925_1662013 3300037068 Bacteria 522
372 Ga0395900_0989854 3300037418 Bacteria 761
373 Ga0395898_0543423 3300037466 Unclassified 1104
374 Ga0436364_0224749 3300037853 Bacteria 2972
375 Ga0395901_0861028 3300038443 Bacteria 891
376 Ga0436365_1504520 3300039437 Unclassified 3460
377 Ga0436363_0529361 3300039450 Bacteria 1248
378 Ga0451787_327232 3300041441 Bacteria 624
379 Ga0451789_0839730 3300041443 Bacteria 627
380 Ga0451791_1351775 3300041451 Bacteria 697
381 Ga0451793_0298944 3300041452 Unclassified 1004
382 Ga0451802_1154891 3300041460 Bacteria 976
383 Ga0451833_0511429 3300041491 Bacteria 914
384 Ga0451843_1157943 3300041509 Bacteria 749
385 Ga0451853_0167967 3300041512 Bacteria 590
386 Ga0439463_001218 3300042016 Bacteria 6875
387 Ga0450902_002574 3300042137 Bacteria 2581
388 Ga0439458_0007121 3300042157 Bacteria 2490
389 Ga0439459_0039453 3300042438 Bacteria 997
390 Ga0439464_0063026 3300042439 Bacteria 1088
391 Ga0451577_0527168 3300042876 Bacteria 1073
392 Ga0451577_1303429 3300042876 Bacteria 646
393 Ga0453683_0322153 3300044673 Bacteria 990
394 Ga0466963_0350488 3300044694 Bacteria 1040
395 Ga0466964_0177750 3300044706 Bacteria 1007
396 Ga0453684_0133854 3300044712 Bacteria 2971
397 Ga0466970_0809869 3300044765 Unclassified 549
398 Ga0466960_0194217 3300044901 Unclassified 1106
399 Ga0466967_0004288 3300045976 Bacteria 9590
400 Ga0495641_0542914 3300046461 Bacteria 531
401 Ga0495639_0473455 3300046475 Bacteria 638
402 Ga0495594_0035391 3300046499 Bacteria 2720
403 Ga0495630_0335349 3300046517 Bacteria 1157
404 Ga0495644_0160895 3300046523 Bacteria 861
405 Ga0495665_0672328 3300046531 Bacteria 515
406 Ga0495586_0084340 3300046535 Bacteria 1749
407 Ga0495622_0096201 3300046557 Archaea 1359
408 Ga0495647_0211719 3300046681 Bacteria 853
409 Ga0496100_0181769 3300048903 Bacteria 1521
410 Ga0496101_0033602 3300048904 Bacteria 3618
411 Ga0496102_0013933 3300048905 Bacteria 6978
412 Ga0496104_0003444 3300048907 Bacteria 13633
413 Ga0496105_0010455 3300048908 Bacteria 7296
414 Ga0496106_0093355 3300048909 Bacteria 2325
415 Ga0496107_0334300 3300048910 Bacteria 1127
416 Ga0496108_0088343 3300048911 Bacteria 2633
417 Ga0496108_1144564 3300048911 Bacteria 660
418 Ga0496109_0144063 3300048912 Bacteria 2228
419 Ga0496109_0980812 3300048912 Unclassified 783
420 Ga0496110_0009480 3300048913 Bacteria 7882
421 Ga0496110_1182916 3300048913 Bacteria 673
422 Ga0496111_0008101 3300048914 Bacteria 6939
423 Ga0496112_0024580 3300048915 Bacteria 5772
424 Ga0496112_1334121 3300048915 Bacteria 633
425 Ga0496113_0053886 3300048916 Bacteria 3008
426 Ga0496114_0023485 3300048917 Bacteria 5033
427 Ga0496114_0224091 3300048917 Bacteria 1651
428 Ga0496114_1044922 3300048917 Bacteria 701
429 Ga0496115_0928910 3300048918 Bacteria 669
430 Ga0501307_071817 3300049162 Bacteria 553
431 Ga0501038_0864886 3300049574 Unclassified 669
432 Ga0501039_0037687 3300049575 Bacteria 3733
433 Ga0501041_0345940 3300049577 Bacteria 939
434 Ga0501046_0052668 3300049580 Bacteria 3207
435 Ga0501048_0684758 3300049582 Bacteria 736
436 Ga0501068_0139584 3300049584 Bacteria 1519
437 Ga0501072_0276634 3300049588 Bacteria 1335
438 Ga0501075_0019784 3300049591 Bacteria 4887
439 Ga0501076_0084340 3300049592 Bacteria 2552
440 Ga0501077_0105921 3300049593 Bacteria 1782
441 Ga0501257_164234 3300049686 Bacteria 620
442 Ga0501079_0136613 3300049741 Bacteria 1909
443 Ga0501080_0666486 3300049742 Bacteria 920
444 Ga0501081_0015868 3300049743 Bacteria 4973
445 Ga0501081_1136330 3300049743 Bacteria 591
446 Ga0501045_0344400 3300049824 Bacteria 1109
447 nmdc:mga06r32_830683_c1 3300050510 Bacteria 883
448 nmdc:mga08y16_1161135_c1 3300050511 Bacteria 744
449 nmdc:mga08y16_2411_c1 3300050511 Bacteria 19206
450 nmdc:mga08y16_643738_c1 3300050511 Bacteria 1065
451 nmdc:mga0n895_120429_c1 3300050512 Bacteria 2646
452 nmdc:mga0rr50_14406_c1 3300050513 Bacteria 5185
453 nmdc:mga08x19_10233_c1 3300050514 Bacteria 5627
454 nmdc:mga0a205_15370_c1 3300050515 Bacteria 6730
455 Ga0495619_0778894 3300053085 Bacteria 648
456 Ga0501084_0201913 3300054114 Bacteria 1677
457 Ga0501084_0568092 3300054114 Unclassified 958
458 Ga0501084_1528929 3300054114 Bacteria 558
459 Ga0530510_0169449 3300061734 Bacteria 1617
460 Ga0157373_10270733
461 JGI24741J21665_1061144
462 JGI24752J21851_1018680
463 JGI24743J22301_10141374
464 JGI24033J26618_1071010
465 JGI24751J29686_10027667
466 Ga0058858_1340263
467 Ga0058859_10098817
468 Ga0058859_10111416
469 Ga0058859_11811655
470 Ga0058860_10221611
471 Ga0058860_10222029
472 Ga0065707_10410557
473 Ga0070658_10308328
474 Ga0070658_11927187
475 Ga0070676_10901363
476 Ga0070683_101783957
477 Ga0070690_100112425
478 Ga0070670_101053701
479 Ga0070670_101304922
480 Ga0068869_100002858
481 Ga0070680_100172272
482 Ga0070680_101373536
483 Ga0070682_101191098
484 Ga0070682_101432763
485 Ga0068868_100778328
486 Ga0070689_100056933
487 Ga0070689_100299335
488 Ga0070691_10003331
489 Ga0070687_100134648
490 Ga0070687_100468222
491 Ga0070661_101631751
492 Ga0070692_10028679
493 Ga0070668_100897914
494 Ga0070675_100001503
495 Ga0070675_100280023
496 Ga0070675_101294509
497 Ga0070671_100002506
498 Ga0070671_100952153
499 Ga0070674_100349035
500 Ga0070673_100063268
501 Ga0070688_100102572
502 Ga0070659_100564096
503 Ga0070667_100800134
504 Ga0070709_10471240
505 Ga0070714_100294497
506 Ga0070701_10552035
507 Ga0070711_100100985
508 Ga0070705_100316293
509 Ga0070700_100016169
510 Ga0070700_100731586
511 Ga0070708_100002758
512 Ga0070708_100530234
513 Ga0070663_100000640
514 Ga0070663_100159633
515 Ga0070678_100001700
516 Ga0070678_100721377
517 Ga0070662_100219578
518 Ga0070681_10013867
519 Ga0070681_10541085
520 Ga0070681_11923301
521 Ga0070681_11925966
522 Ga0068867_100374133
523 Ga0070685_10038297
524 Ga0070685_10310354
525 Ga0070685_10322449
526 Ga0070685_10643277
527 Ga0070706_100561430
528 Ga0070706_101488642
529 Ga0070706_101582054
530 Ga0070707_101034077
531 Ga0070699_100723582
532 Ga0070679_100729493
533 Ga0070679_100945071
534 Ga0070684_100010817
535 Ga0070684_100109774
536 Ga0070684_100649537
537 Ga0070684_100676410
538 Ga0070684_100912314
539 Ga0070684_101869731
540 Ga0070697_100409213
541 Ga0068853_101541204
542 Ga0070672_100071531
543 Ga0070672_100156615
544 Ga0070672_101753304
545 Ga0070686_100886973
546 Ga0070686_100935130
547 Ga0070686_101095029
548 Ga0070686_101198688
549 Ga0070693_101154562
550 Ga0070693_101386756
551 Ga0070665_100049160
552 Ga0070665_101113899
553 Ga0070704_100255160
554 Ga0070704_100562308
555 Ga0070704_101301737
556 Ga0068855_100447251
557 Ga0070664_100512543
558 Ga0070664_100734598
559 Ga0068857_100090264
560 Ga0068857_101847683
561 Ga0068854_101600695
562 Ga0068856_101008982
563 Ga0068856_101989970
564 Ga0068856_101989972
565 Ga0070702_100001888
566 Ga0070702_100238138
567 Ga0068852_100188063
568 Ga0068859_100040106
569 Ga0068859_101191963
570 Ga0068859_101401905
571 Ga0068859_102104661
572 Ga0068864_100333410
573 Ga0068864_100759746
574 Ga0068864_100944595
575 Ga0068864_101373945
576 Ga0068866_10594605
577 Ga0068866_10666909
578 Ga0068866_11076420
579 Ga0068861_101578501
580 Ga0068851_10015276
581 Ga0068870_10030557
582 Ga0068863_100000817
583 Ga0068863_101069915
584 Ga0068863_101929077
585 Ga0068863_102125317
586 Ga0068858_100275126
587 Ga0068858_101023603
588 Ga0068860_100041011
589 Ga0068860_101688635
590 Ga0070716_100650824
591 Ga0070712_100031995
592 Ga0097621_100042830
593 Ga0097621_102410231
594 Ga0068871_100711560
595 Ga0075428_100255047
596 Ga0075428_101913576
597 Ga0075431_100625664
598 Ga0075434_100020122
599 Ga0075434_100510513
600 Ga0075429_100527815
601 Ga0068865_100239397
602 Ga0068865_100300931
603 Ga0068865_101684723
604 Ga0075436_100003503
605 Ga0097620_100040107
606 Ga0097620_101192001
607 Ga0097620_101402085
608 Ga0097620_102104924
609 Ga0075435_100092535
610 Ga0105251_10022319
611 Ga0105251_10386445
612 Ga0105244_10561828
613 Ga0105240_10952326
614 Ga0105240_11818252
615 Ga0105240_12306770
616 Ga0111539_10343118
617 Ga0111539_10421324
618 Ga0111539_10517467
619 Ga0111539_12932461
620 Ga0105245_11766509
621 Ga0105245_12185948
622 Ga0105245_12262288
623 Ga0105245_12262290
624 Ga0105247_10013549
625 Ga0105247_10742577
626 Ga0114129_10314780
627 Ga0105243_10498553
628 Ga0105243_11002516
629 Ga0105241_10003590
630 Ga0105242_10160091
631 Ga0105242_12147116
632 Ga0105248_10054523
633 Ga0105248_11857289
634 Ga0105237_10391999
635 Ga0105237_10399197
636 Ga0105238_10650471
637 Ga0105249_10213995
638 Ga0105249_10256553
639 Ga0105249_10832198
640 Ga0105239_10029859
641 Ga0105239_10180926
642 Ga0105246_10011393
643 Ga0105246_10669462
644 Ga0105246_11855841
645 Ga0157373_10181728
646 Ga0157373_10246507
647 Ga0157371_10010017
648 Ga0157370_10021689
649 Ga0157369_10131620
650 Ga0157374_10630332
651 Ga0157378_10857395
652 Ga0163162_10122955
653 Ga0163162_10365956
654 Ga0163162_10616049
655 Ga0163162_10868972
656 Ga0157372_10637531
657 Ga0157375_10153918
658 Ga0157375_10523791
659 Ga0157375_10654007
660 Ga0163163_10182783
661 Ga0163163_10328083
662 Ga0163163_10559004
663 Ga0163163_10914413
664 Ga0163163_11016802
665 Ga0163163_12748723
666 Ga0157380_12993662
667 Ga0182008_10022748
668 Ga0157377_10041967
669 Ga0157377_10104115
670 Ga0157377_10545120
671 Ga0157379_10076368
672 Ga0157379_10313881
673 Ga0157379_12295754
674 Ga0157376_10318326
675 Ga0157376_10516506
676 Ga0157376_11883330
677 Ga0157376_12295446
678 Ga0157376_12798765
679 Ga0163161_10132738
680 Ga0163161_10221278
681 Ga0206354_10112977
682 Ga0206354_10482257
683 Ga0206353_12006440
684 Ga0213876_10094355
685 Ga0207656_10020359
686 Ga0207656_10239596
687 Ga0207713_1035202
688 Ga0207642_10319678
689 Ga0207688_10002312
690 Ga0207688_10209246
691 Ga0207688_10812437
692 Ga0207699_10376457
693 Ga0207645_10105887
694 Ga0207645_10843379
695 Ga0207643_10000053
696 Ga0207643_10077409
697 Ga0207705_10009148
698 Ga0207705_10060630
699 Ga0207684_10118471
700 Ga0207684_11281465
701 Ga0207654_10184877
702 Ga0207707_10191671
703 Ga0207707_10776772
704 Ga0207671_10548852
705 Ga0207693_10040601
706 Ga0207660_10006237
707 Ga0207662_10139348
708 Ga0207662_10230527
709 Ga0207662_10254255
710 Ga0207662_10408175
711 Ga0207662_10691359
712 Ga0207657_10016092
713 Ga0207657_10563851
714 Ga0207649_10056760
715 Ga0207649_10443624
716 Ga0207652_10005366
717 Ga0207694_10298490
718 Ga0207650_10001803
719 Ga0207659_10050218
720 Ga0207659_10719708
721 Ga0207687_10043256
722 Ga0207687_11915214
723 Ga0207700_11099534
724 Ga0207664_10190205
725 Ga0207644_10069237
726 Ga0207644_10915529
727 Ga0207690_10226525
728 Ga0207706_10219254
729 Ga0207686_11669259
730 Ga0207709_10576475
731 Ga0207709_11314690
732 Ga0207670_10219264
733 Ga0207669_10109280
734 Ga0207704_10289155
735 Ga0207704_10473600
736 Ga0207665_10098812
737 Ga0207691_10106118
738 Ga0207691_10166146
739 Ga0207711_10793240
740 Ga0207711_11499699
741 Ga0207711_11849491
742 Ga0207689_10006383
743 Ga0207661_10044049
744 Ga0207661_10140147
745 Ga0207661_10714407
746 Ga0207661_10850121
747 Ga0207661_11853080
748 Ga0207679_10011011
749 Ga0207679_10447500
750 Ga0207679_11826848
751 Ga0207667_10667145
752 Ga0207651_10075891
753 Ga0207712_10278467
754 Ga0207712_10486365
755 Ga0207668_10049370
756 Ga0207640_10006969
757 Ga0207658_10207577
758 Ga0207677_10052346
759 Ga0207703_10315545
760 Ga0207703_10761808
761 Ga0207703_11276416
762 Ga0207639_11399422
763 Ga0207678_10000099
764 Ga0207678_10066021
765 Ga0207708_10173209
766 Ga0207708_10338724
767 Ga0207702_10001089
768 Ga0207702_11493663
769 Ga0207641_10130945
770 Ga0207641_10401809
771 Ga0207641_10657795
772 Ga0207641_10963522
773 Ga0207648_10170779
774 Ga0207648_10436302
775 Ga0207676_10017755
776 Ga0207676_10849693
777 Ga0207676_11113808
778 Ga0207674_10062555
779 Ga0207674_10098597
780 Ga0207675_100364657
781 Ga0207675_101928161
782 Ga0207683_10003708
783 Ga0207683_10019015
784 Ga0207698_10573311
785 Ga0207698_10999120
786 Ga0207428_10004062
787 Ga0207428_10542118
788 Ga0268266_10172971
789 Ga0268265_11249337
790 Ga0268264_10175794
791 Ga0268264_11494252
792 Ga0265334_10007319
793 Ga0265318_10003271
794 Ga0265322_10184426
795 Ga0265338_10018514
796 Ga0265324_10057892
797 Ga0265760_10033648
798 Ga0265330_10186289
799 Ga0265328_10157085
800 Ga0265320_10009014
801 Ga0265325_10022245
802 Ga0265325_10408159
803 Ga0265329_10185484
804 Ga0265340_10012997
805 Ga0265340_10138444
806 Ga0265331_10002298
807 Ga0265327_10159754
808 Ga0265316_10041501
809 Ga0265316_10287273
810 Ga0307413_10494380
811 Ga0307413_10846801
812 Ga0307410_11469822
813 Ga0307407_10222261
814 Ga0307407_10407302
815 Ga0307409_100587476
816 Ga0307416_101394637
817 Ga0307416_101719206
818 Ga0307411_10913330
819 Ga0373938_0022405
820 Ga0373949_0079044
821 Ga0373939_0104254
822 Ga0373961_0044602
823 Ga0316574_0605312
824 Ga0316574_0860723
825 Ga0373924_0273086
826 Ga0373931_0927322
827 Ga0373935_1205175
828 Ga0373947_0265486
829 Ga0373937_1903263
830 Ga0373925_1662013
831 Ga0395900_0989854
832 Ga0395898_0543423
833 Ga0436364_0224749
834 Ga0395901_0861028
835 Ga0436365_1504520
836 Ga0436363_0529361
837 Ga0451787_327232
838 Ga0451789_0839730
839 Ga0451791_1351775
840 Ga0451793_0298944
841 Ga0451802_1154891
842 Ga0451833_0511429
843 Ga0451843_1157943
844 Ga0451853_0167967
845 Ga0439463_001218
846 Ga0450902_002574
847 Ga0439458_0007121
848 Ga0439459_0039453
849 Ga0439464_0063026
850 Ga0451577_0527168
851 Ga0451577_1303429
852 Ga0453683_0322153
853 Ga0466963_0350488
854 Ga0466964_0177750
855 Ga0453684_0133854
856 Ga0466970_0809869
857 Ga0466960_0194217
858 Ga0466967_0004288
859 Ga0495641_0542914
860 Ga0495639_0473455
861 Ga0495594_0035391
862 Ga0495630_0335349
863 Ga0495644_0160895
864 Ga0495665_0672328
865 Ga0495586_0084340
866 Ga0495622_0096201
867 Ga0495647_0211719
868 Ga0496100_0181769
869 Ga0496101_0033602
870 Ga0496102_0013933
871 Ga0496104_0003444
872 Ga0496105_0010455
873 Ga0496106_0093355
874 Ga0496107_0334300
875 Ga0496108_0088343
876 Ga0496108_1144564
877 Ga0496109_0144063
878 Ga0496109_0980812
879 Ga0496110_0009480
880 Ga0496110_1182916
881 Ga0496111_0008101
882 Ga0496112_0024580
883 Ga0496112_1334121
884 Ga0496113_0053886
885 Ga0496114_0023485
886 Ga0496114_0224091
887 Ga0496114_1044922
888 Ga0496115_0928910
889 Ga0501307_071817
890 Ga0501038_0864886
891 Ga0501039_0037687
892 Ga0501041_0345940
893 Ga0501046_0052668
894 Ga0501048_0684758
895 Ga0501068_0139584
896 Ga0501072_0276634
897 Ga0501075_0019784
898 Ga0501076_0084340
899 Ga0501077_0105921
900 Ga0501257_164234
901 Ga0501079_0136613
902 Ga0501080_0666486
903 Ga0501081_0015868
904 Ga0501081_1136330
905 Ga0501045_0344400
906 nmdc:mga06r32_830683_c1
907 nmdc:mga08y16_1161135_c1
908 nmdc:mga08y16_2411_c1
909 nmdc:mga08y16_643738_c1
910 nmdc:mga0n895_120429_c1
911 nmdc:mga0rr50_14406_c1
912 nmdc:mga08x19_10233_c1
913 nmdc:mga0a205_15370_c1
914 Ga0495619_0778894
915 Ga0501084_0201913
916 Ga0501084_0568092
917 Ga0501084_1528929
918 Ga0530510_0169449

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14026

SCO4226-like

Nickel responsive protein SCO4226-like

20

95

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.9311 3 83
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.9095 3 83
3rhu-assembly1.cif.gz_A epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.7386 35 55
7siu-assembly1.cif.gz_B crystal structure of hpk1 (map4k1) complex with inhibitor a-745 0.7057 5 54
1v4p-assembly3.cif.gz_C crystal structure of alanyl-trna synthetase from pyrococcus horikoshii ot3 0.6941 35 57
ID Description Score Start End Superfamily
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.9228 4 83 3.30.70.3090
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.901 4 83 3.30.70.3090
af_I1LY76_336_406_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7002 3 54 3.30.200.20
af_Q1ZXR2_492_809_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.6958 5 54 1.10.510.10
af_E7F2H7_25_252_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.6949 3 54 1.10.510.10
ID Description Score Start End GO Terms
AF-A0A536XPP4-F1-model_v4 DUF4242 domain-containing protein 1.002 1 80 GO:0004016
GO:0009190
GO:0035556
AF-A0A535VYW5-F1-model_v4 DUF4242 domain-containing protein 0.9986 2 83
AF-A0A7Y1UV69-F1-model_v4 DUF4242 domain-containing protein 0.9981 1 83
AF-A0A2V6D1B3-F1-model_v4 DUF4242 domain-containing protein 0.9974 1 80 GO:0004016
GO:0009190
GO:0035556
AF-A0A2V5LTW0-F1-model_v4 DUF4242 domain-containing protein 0.9965 6 80 GO:0004016
GO:0006171
GO:0035556

Map